NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|20150828]
View 

Protein Classification

immunoglobulin domain-containing protein (domain architecture ID 12207553)

immunoglobulin (Ig) domain-containing protein adopts a fold comprised of a sandwich of two beta sheets and may function in cell adhesion and pattern recognition

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
IgV_TCR_beta cd05899
Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) bet a chain. IgV_TCR_beta: ...
4-116 3.93e-40

Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) bet a chain. IgV_TCR_beta: immunoglobulin (Ig) variable domain of the beta chain of alpha/beta T-cell antigen receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are composed of alpha and beta, or gamma and delta, polypeptide chains with variable (V) and constant (C) regions. This group includes the variable domain of the alpha chain of alpha/beta TCRs. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. The variable domain of TCRs is responsible for antigen recognition, and is located at the N-terminus of the receptor. Gamma/delta TCRs recognize intact protein antigens; they recognize proteins antigens directly and without antigen processing, and MHC independently of the bound peptide.


:

Pssm-ID: 143307  Cd Length: 110  Bit Score: 128.95  E-value: 3.93e-40
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20150828   4 LEQNPRWRLVPRGQAVNLRCILKnSQYPWMSWYQQDLQKQLQWLFTLRSPGDKEVKSLPGADYLATRVTDTELRLQVANM 83
Cdd:cd05899   1 VTQSPRYLIKGRGQSVTLRCSQT-SGHDNMYWYRQDPGKGLQLLFYSNGGSLNEEEGDPKDRFSASRPSLTRSSLTIKSA 79
                        90       100       110
                ....*....|....*....|....*....|....*
gi 20150828  84 S--QGRTLYCTCSAAPDwgasAETLYFGSGTRLTV 116
Cdd:cd05899  80 EpeDSAVYLCASSLGGG----ADEAYFGPGTRLTV 110
 
Name Accession Description Interval E-value
IgV_TCR_beta cd05899
Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) bet a chain. IgV_TCR_beta: ...
4-116 3.93e-40

Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) bet a chain. IgV_TCR_beta: immunoglobulin (Ig) variable domain of the beta chain of alpha/beta T-cell antigen receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are composed of alpha and beta, or gamma and delta, polypeptide chains with variable (V) and constant (C) regions. This group includes the variable domain of the alpha chain of alpha/beta TCRs. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. The variable domain of TCRs is responsible for antigen recognition, and is located at the N-terminus of the receptor. Gamma/delta TCRs recognize intact protein antigens; they recognize proteins antigens directly and without antigen processing, and MHC independently of the bound peptide.


Pssm-ID: 143307  Cd Length: 110  Bit Score: 128.95  E-value: 3.93e-40
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20150828   4 LEQNPRWRLVPRGQAVNLRCILKnSQYPWMSWYQQDLQKQLQWLFTLRSPGDKEVKSLPGADYLATRVTDTELRLQVANM 83
Cdd:cd05899   1 VTQSPRYLIKGRGQSVTLRCSQT-SGHDNMYWYRQDPGKGLQLLFYSNGGSLNEEEGDPKDRFSASRPSLTRSSLTIKSA 79
                        90       100       110
                ....*....|....*....|....*....|....*
gi 20150828  84 S--QGRTLYCTCSAAPDwgasAETLYFGSGTRLTV 116
Cdd:cd05899  80 EpeDSAVYLCASSLGGG----ADEAYFGPGTRLTV 110
V-set pfam07686
Immunoglobulin V-set domain. This domain is found in antibodies as well as neural protein P0 ...
6-117 3.02e-17

Immunoglobulin V-set domain. This domain is found in antibodies as well as neural protein P0 and CTL4 amongst others.


Pssm-ID: 369466  Cd Length: 109  Bit Score: 70.95  E-value: 3.02e-17
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20150828     6 QNPRWRLVPRGQAVNLRCILKNS---QYPWMSWYQQDLQKQLQWLFTLRSPGDKEVKSlPGADYLA--TRVTDTELRLQV 80
Cdd:pfam07686   1 QTPREVTVALGGSVTLPCTFSSSmssGSLSVYWYRQPPGKGPEFLIAYYSNGSNEGKK-KGRFSLRgdPSNSDGSLTIQN 79
                          90       100       110
                  ....*....|....*....|....*....|....*..
gi 20150828    81 ANMSQGRTLYCTCSAAPDWgasaetlYFGSGTRLTVL 117
Cdd:pfam07686  80 LTPSDSGTYTCAVIPNGIV-------VFGKGTRLTVL 109
IG smart00409
Immunoglobulin;
8-42 2.67e-04

Immunoglobulin;


Pssm-ID: 214652  Cd Length: 85  Bit Score: 36.71  E-value: 2.67e-04
                           10        20        30
                   ....*....|....*....|....*....|....*
gi 20150828      8 PRWRLVPRGQAVNLRCILKNSQYPWMSWYQQDLQK 42
Cdd:smart00409   1 PPSVTVKEGESVTLSCEASGSPPPEVTWYKQGGKL 35
 
Name Accession Description Interval E-value
IgV_TCR_beta cd05899
Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) bet a chain. IgV_TCR_beta: ...
4-116 3.93e-40

Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) bet a chain. IgV_TCR_beta: immunoglobulin (Ig) variable domain of the beta chain of alpha/beta T-cell antigen receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are composed of alpha and beta, or gamma and delta, polypeptide chains with variable (V) and constant (C) regions. This group includes the variable domain of the alpha chain of alpha/beta TCRs. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. The variable domain of TCRs is responsible for antigen recognition, and is located at the N-terminus of the receptor. Gamma/delta TCRs recognize intact protein antigens; they recognize proteins antigens directly and without antigen processing, and MHC independently of the bound peptide.


Pssm-ID: 143307  Cd Length: 110  Bit Score: 128.95  E-value: 3.93e-40
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20150828   4 LEQNPRWRLVPRGQAVNLRCILKnSQYPWMSWYQQDLQKQLQWLFTLRSPGDKEVKSLPGADYLATRVTDTELRLQVANM 83
Cdd:cd05899   1 VTQSPRYLIKGRGQSVTLRCSQT-SGHDNMYWYRQDPGKGLQLLFYSNGGSLNEEEGDPKDRFSASRPSLTRSSLTIKSA 79
                        90       100       110
                ....*....|....*....|....*....|....*
gi 20150828  84 S--QGRTLYCTCSAAPDwgasAETLYFGSGTRLTV 116
Cdd:cd05899  80 EpeDSAVYLCASSLGGG----ADEAYFGPGTRLTV 110
IgV cd00099
Immunoglobulin variable domain (IgV). IgV: Immunoglobulin variable domain (IgV). Members of ...
11-116 9.50e-28

Immunoglobulin variable domain (IgV). IgV: Immunoglobulin variable domain (IgV). Members of the IgV family are components of immunoglobulin (Ig) and T cell receptors. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. In Ig, each chain is composed of one variable domain (IgV) and one or more constant domains (IgC); these names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. Within the variable domain, there are regions of even more variability called the hypervariable or complementarity-determining regions (CDRs) which are responsible for antigen binding. A predominant feature of most Ig domains is the disulfide bridge connecting 2 beta-sheets with a tryptophan residue packed against the disulfide bond.


Pssm-ID: 319275  Cd Length: 103  Bit Score: 97.47  E-value: 9.50e-28
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20150828  11 RLVPRGQAVNLRCILKNS-QYPWMSWYQQDLQKQLQWLFTLRSPGdkevKSLPGADYLATRVTD-TELRLQVANMS--QG 86
Cdd:cd00099   1 VSVSTGESVTLNCVLSGSfSLYSISWYRQKPGKQPQFLISGSSTG----KPGIPGRFSGTRNGGsSSFSLTISNLRpeDS 76
                        90       100       110
                ....*....|....*....|....*....|
gi 20150828  87 RTLYCTCSAAPDWGasaETLYFGSGTRLTV 116
Cdd:cd00099  77 GTYYCAVSEGPGGG---DKLVFGAGTRLTV 103
V-set pfam07686
Immunoglobulin V-set domain. This domain is found in antibodies as well as neural protein P0 ...
6-117 3.02e-17

Immunoglobulin V-set domain. This domain is found in antibodies as well as neural protein P0 and CTL4 amongst others.


Pssm-ID: 369466  Cd Length: 109  Bit Score: 70.95  E-value: 3.02e-17
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20150828     6 QNPRWRLVPRGQAVNLRCILKNS---QYPWMSWYQQDLQKQLQWLFTLRSPGDKEVKSlPGADYLA--TRVTDTELRLQV 80
Cdd:pfam07686   1 QTPREVTVALGGSVTLPCTFSSSmssGSLSVYWYRQPPGKGPEFLIAYYSNGSNEGKK-KGRFSLRgdPSNSDGSLTIQN 79
                          90       100       110
                  ....*....|....*....|....*....|....*..
gi 20150828    81 ANMSQGRTLYCTCSAAPDWgasaetlYFGSGTRLTVL 117
Cdd:pfam07686  80 LTPSDSGTYTCAVIPNGIV-------VFGKGTRLTVL 109
IgV_TCR_alpha cd04983
Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) alpha chain and similar ...
5-116 1.47e-09

Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) alpha chain and similar proteins. IgV_TCR_alpha: immunoglobulin (Ig) variable domain of the alpha chain of alpha/beta T-cell antigen receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are composed of alpha and beta, or gamma and delta, polypeptide chains with variable (V) and constant (C) regions. This group represents the variable domain of the alpha chain of TCRs and also includes the variable domain of delta chains of TCRs. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. The variable domain of TCRs is responsible for antigen recognition, and is located at the N-terminus of the receptor. Gamma/delta TCRs recognize intact protein antigens; they recognize proteins antigens directly and without antigen processing, and MHC independently of the bound peptide.


Pssm-ID: 319287  Cd Length: 109  Bit Score: 51.11  E-value: 1.47e-09
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20150828   5 EQNPRWRLVPRGQAVNLRCILKNSQYPWMSWYQQDLQKQLQWLftLRSPGDKEVKSLPGAD-YLATRVTDTELRLQVANM 83
Cdd:cd04983   2 TQSPQSLSVQEGENVTLNCNYSTSTFPYLFWYRQYPGQGPEFL--LYISSNGEEKEKGRFSaTLDKSRKSSSLHITAAQL 79
                        90       100       110
                ....*....|....*....|....*....|...
gi 20150828  84 SQGRTLYCtcsAAPDWGaSAETLYFGSGTRLTV 116
Cdd:cd04983  80 SDSAVYYC---ALSESS-GTGKLTFGQGTRLTV 108
IgV_H_TCR_mu cd16095
T-cell receptor Mu, Heavy chain, variable (V) domain. IgV_H: Immunoglobulin (Ig) heavy chain ...
14-116 2.07e-04

T-cell receptor Mu, Heavy chain, variable (V) domain. IgV_H: Immunoglobulin (Ig) heavy chain (H), variable (V) domain in mu. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. In Ig, each chain is composed of one variable domain (IgV) and one or more constant domains (IgC); these names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. There are five types of heavy chains (alpha, gamma, delta, epsilon, and mu), which determine the type of immunoglobulin: IgA, IgG, IgD, IgE, and IgM, respectively. In higher vertebrates, there are two types of light chain, designated kappa and lambda, which can associate with any of the heavy chains. This family includes alpha, gamma, delta, epsilon, and mu heavy chains.


Pssm-ID: 319344  Cd Length: 112  Bit Score: 37.92  E-value: 2.07e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20150828  14 PRGQAVNLRC-----ILKNSQypwMSWYQQDLQKQLQWLFTLRSpgdkeVKSLPGADYLATRVTDTE--LRLQVANMSQG 86
Cdd:cd16095  10 PAGKTLSLKCqtsgfQFNTSQ---LSWYLWVPGHAPLWLTSLDH-----ISTKASEDRITSSREDTNsqIFLQIKGLGLR 81
                        90       100       110
                ....*....|....*....|....*....|
gi 20150828  87 RTLYCTCSAAPDWGASAETLYFGSGTRLTV 116
Cdd:cd16095  82 DSGQYHCARRVGYGDDTDKLIFGPGTDVIV 111
IG smart00409
Immunoglobulin;
8-42 2.67e-04

Immunoglobulin;


Pssm-ID: 214652  Cd Length: 85  Bit Score: 36.71  E-value: 2.67e-04
                           10        20        30
                   ....*....|....*....|....*....|....*
gi 20150828      8 PRWRLVPRGQAVNLRCILKNSQYPWMSWYQQDLQK 42
Cdd:smart00409   1 PPSVTVKEGESVTLSCEASGSPPPEVTWYKQGGKL 35
IG_like smart00410
Immunoglobulin like; IG domains that cannot be classified into one of IGv1, IGc1, IGc2, IG.
8-42 2.67e-04

Immunoglobulin like; IG domains that cannot be classified into one of IGv1, IGc1, IGc2, IG.


Pssm-ID: 214653  Cd Length: 85  Bit Score: 36.71  E-value: 2.67e-04
                           10        20        30
                   ....*....|....*....|....*....|....*
gi 20150828      8 PRWRLVPRGQAVNLRCILKNSQYPWMSWYQQDLQK 42
Cdd:smart00410   1 PPSVTVKEGESVTLSCEASGSPPPEVTWYKQGGKL 35
IgV_TCR_delta cd07706
Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) delta chain. IgV_TCR_delta: ...
13-116 7.62e-03

Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) delta chain. IgV_TCR_delta: immunoglobulin (Ig) variable (V) domain of the delta chain of gamma/delta T-cell receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are heterodimers consisting of alpha and beta chains or gamma and delta chains. Each chain contains a variable (V) and a constant (C) region. The majority of T cells contain alpha/beta TCRs but a small subset contain gamma/delta TCRs. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. Gamma/delta TCRs recognize intact protein antigens; they recognize protein antigens directly and without antigen processing, and MHC independently of the bound peptide. Gamma/delta T cells can also be stimulated by non-peptide antigens such as small phosphate- or amine-containing compounds. The variable domain of gamma/delta TCRs is responsible for antigen recognition and is located at the N-terminus of the receptor.


Pssm-ID: 319330  Cd Length: 112  Bit Score: 33.63  E-value: 7.62e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20150828  13 VPRGQAVNLRCILKNS-QYPWMSWYQQDLQKQLQWLFTLRSPGDKEVKSLPGADYLATR----VTDTELRLQvanmsQGR 87
Cdd:cd07706  11 VQVGEEVTLNCRYETSwTNYYLFWYKQLPSGEMTFLIRQDSSRSNATSGRYSVNFQKAQksisLTISALQLE-----DSA 85
                        90       100
                ....*....|....*....|....*....
gi 20150828  88 TLYCTCSAAPDwgasAETLYFGSGTRLTV 116
Cdd:cd07706  86 KYFCALSLPYP----TDKLIFGKGTRLTV 110
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH