NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|222537776|ref|NP_001138512|]
View 

Protein Classification

7tmA_CXCR3 domain-containing protein (domain architecture ID 11606914)

7tmA_CXCR3 domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
7tmA_CXCR3 cd15180
CXC chemokine receptor type 3, member of the class A family of seven-transmembrane G ...
54-329 3.97e-134

CXC chemokine receptor type 3, member of the class A family of seven-transmembrane G protein-coupled receptors; CXCR3 is an inflammatory chemotactic receptor for a group of CXC chemokines distinguished by the presence of the amino acid motif ELR immediately adjacent to their CXC motif. CXCR3 specifically binds three chemokines CXCL9 (monokine induced by gamma-interferon), CXCL10 (interferon induced protein of 10 kDa), and CXCL11 (interferon inducible T-cell alpha-chemoattractant, I-TAC). CXC3R is expressed on CD4+ Th1 and CD8+ cytotoxic T lymphocytes as well as highly on innate lymphocytes, such as NK cells and NK T cells, where it may mediate the recruitment of these cells to the sites of infection and inflammation. Chemokines are principal regulators for leukocyte trafficking, recruitment, and activation. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling. Currently, there are ten known receptors for CC chemokines, seven for CXC chemokines, and single receptors for the XC and CX3C chemokines.


:

Pssm-ID: 341335 [Multi-domain]  Cd Length: 280  Bit Score: 384.04  E-value: 3.97e-134
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776  54 AFLPALYSLLFLLGLLGNGAVAAVLLSRRAALSSTDTFLLHLAVADTLLVLTLPLWAVDAAVQWVFGSGLCKVAGALFNI 133
Cdd:cd15180    1 VFLPVLYSLVFLLGLLGNGLVLAVLLQKRRNLSVTDTFILHLALADILLLVTLPFWAVQAVHGWIFGTGLCKLAGAVFKI 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 134 NFYAGALLLACISFDRYLNIVHATQLYRRGPPARVTLTCLAVWGLCLLFALPDFIFLSAHHDERLNATHCQYNFPQV--- 210
Cdd:cd15180   81 NFYCGIFLLACISFDRYLSIVHAVQMYSRKKPMLVHLSCLIVWLFCLLLSIPDFIFLEATKDPRQNKTECVHNFPQSdty 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 211 GRTALRVLQLVAGFLLPLLVMAYCYAHILAVLLVS-RGQRRLRAMRLVVAVVVAFALCWTPYHLVVLVDILMDLGALARN 289
Cdd:cd15180  161 WWLALRLLYHIVGFLLPLAVMVYCYTSILLRLLRSsQGFQKQRAIRVIVAVVVVFFLCWTPYNIALLVDTLIDLSVLDRN 240
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|
gi 222537776 290 CGRESRVDVAKSVTSGLGYMHCCLNPLLYAFVGVKFRERM 329
Cdd:cd15180  241 CGTESRLDIALSVTSSLGYFHCCLNPLLYAFVGVKFRRKL 280
 
Name Accession Description Interval E-value
7tmA_CXCR3 cd15180
CXC chemokine receptor type 3, member of the class A family of seven-transmembrane G ...
54-329 3.97e-134

CXC chemokine receptor type 3, member of the class A family of seven-transmembrane G protein-coupled receptors; CXCR3 is an inflammatory chemotactic receptor for a group of CXC chemokines distinguished by the presence of the amino acid motif ELR immediately adjacent to their CXC motif. CXCR3 specifically binds three chemokines CXCL9 (monokine induced by gamma-interferon), CXCL10 (interferon induced protein of 10 kDa), and CXCL11 (interferon inducible T-cell alpha-chemoattractant, I-TAC). CXC3R is expressed on CD4+ Th1 and CD8+ cytotoxic T lymphocytes as well as highly on innate lymphocytes, such as NK cells and NK T cells, where it may mediate the recruitment of these cells to the sites of infection and inflammation. Chemokines are principal regulators for leukocyte trafficking, recruitment, and activation. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling. Currently, there are ten known receptors for CC chemokines, seven for CXC chemokines, and single receptors for the XC and CX3C chemokines.


Pssm-ID: 341335 [Multi-domain]  Cd Length: 280  Bit Score: 384.04  E-value: 3.97e-134
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776  54 AFLPALYSLLFLLGLLGNGAVAAVLLSRRAALSSTDTFLLHLAVADTLLVLTLPLWAVDAAVQWVFGSGLCKVAGALFNI 133
Cdd:cd15180    1 VFLPVLYSLVFLLGLLGNGLVLAVLLQKRRNLSVTDTFILHLALADILLLVTLPFWAVQAVHGWIFGTGLCKLAGAVFKI 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 134 NFYAGALLLACISFDRYLNIVHATQLYRRGPPARVTLTCLAVWGLCLLFALPDFIFLSAHHDERLNATHCQYNFPQV--- 210
Cdd:cd15180   81 NFYCGIFLLACISFDRYLSIVHAVQMYSRKKPMLVHLSCLIVWLFCLLLSIPDFIFLEATKDPRQNKTECVHNFPQSdty 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 211 GRTALRVLQLVAGFLLPLLVMAYCYAHILAVLLVS-RGQRRLRAMRLVVAVVVAFALCWTPYHLVVLVDILMDLGALARN 289
Cdd:cd15180  161 WWLALRLLYHIVGFLLPLAVMVYCYTSILLRLLRSsQGFQKQRAIRVIVAVVVVFFLCWTPYNIALLVDTLIDLSVLDRN 240
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|
gi 222537776 290 CGRESRVDVAKSVTSGLGYMHCCLNPLLYAFVGVKFRERM 329
Cdd:cd15180  241 CGTESRLDIALSVTSSLGYFHCCLNPLLYAFVGVKFRRKL 280
7tm_1 pfam00001
7 transmembrane receptor (rhodopsin family); This family contains, amongst other ...
74-318 6.13e-59

7 transmembrane receptor (rhodopsin family); This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins.


Pssm-ID: 394960 [Multi-domain]  Cd Length: 256  Bit Score: 191.36  E-value: 6.13e-59
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776   74 VAAVLLSRRAALSSTDTFLLHLAVADTLL-VLTLPLWAVDAAV--QWVFGSGLCKVAGALFNINFYAGALLLACISFDRY 150
Cdd:pfam00001   5 VILVILRNKKLRTPTNIFLLNLAVADLLFgLLTLPFWLVYYLLhgDWPFGSALCKLVGALFYVNMYASILLLTAISIDRY 84
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776  151 LNIVHATQLYRRGPPARVTLTCLAVWGLCLLFALPDFIFLSAHHDERLNATHC--QYNFPQVGRTALRVLQLVAGFLLPL 228
Cdd:pfam00001  85 LAIVHPLRYRRIRTPRRAKVLILLVWVLALLLSLPPLLFGWTLTVPEGNVTVCliDFPEDLVKPVSYTLLISVLGFLLPL 164
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776  229 LVMAYCYAHILAVLL--------VSRGQRRLRAMRLVVAVVVAFALCWTPYHLVVLVDilmdlgALARNCGRESRVDVAK 300
Cdd:pfam00001 165 LVILVCYTRIYRTLRksaskqksEERTQRRRKALKTLAVVVVVFILCWLPYHIVLLLD------SLALDCELSRLLDKAL 238
                         250
                  ....*....|....*...
gi 222537776  301 SVTSGLGYMHCCLNPLLY 318
Cdd:pfam00001 239 SVTLWLAYVNSCLNPIIY 256
PHA03087 PHA03087
G protein-coupled chemokine receptor-like protein; Provisional
74-329 2.42e-37

G protein-coupled chemokine receptor-like protein; Provisional


Pssm-ID: 222976 [Multi-domain]  Cd Length: 335  Bit Score: 137.22  E-value: 2.42e-37
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776  74 VAAVLLSRRAALSSTDTFLLHLAVADTLLVLTLPLWAVDA-AVQWVFGSGLCKVAGALFNINFYAGALLLACISFDRYLN 152
Cdd:PHA03087  60 IVIYVLTKTKIKTPMDIYLLNLAVSDLLFVMTLPFQIYYYiLFQWSFGEFACKIVSGLYYIGFYNSMNFITVMSVDRYIA 139
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 153 IVHATQLYRRGPPARVTLTCLAVWGLCLLFALPDFIFLSAHHDERLNATHCQYNF-PQVGRTALRVLQLVAGFLLPLLVM 231
Cdd:PHA03087 140 IVHPVKSNKINTVKYGYIVSLVIWIISIIETTPILFVYTTKKDHETLICCMFYNNkTMNWKLFINFEINIIGMLIPLTIL 219
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 232 AYCYAHILAVL-LVSRGQRRLRAMRLVVAVVVAFALCWTPYHLVVLVDILMDLGALArNCGRESRVDVAKSVTSGLGYMH 310
Cdd:PHA03087 220 LYCYSKILITLkGINKSKKNKKAIKLVLIIVILFVIFWLPFNVSVFVYSLHILHFKS-GCKAVKYIQYALHVTEIISLSH 298
                        250
                 ....*....|....*....
gi 222537776 311 CCLNPLLYAFVGVKFRERM 329
Cdd:PHA03087 299 CCINPLIYAFVSEFFNKHK 317
 
Name Accession Description Interval E-value
7tmA_CXCR3 cd15180
CXC chemokine receptor type 3, member of the class A family of seven-transmembrane G ...
54-329 3.97e-134

CXC chemokine receptor type 3, member of the class A family of seven-transmembrane G protein-coupled receptors; CXCR3 is an inflammatory chemotactic receptor for a group of CXC chemokines distinguished by the presence of the amino acid motif ELR immediately adjacent to their CXC motif. CXCR3 specifically binds three chemokines CXCL9 (monokine induced by gamma-interferon), CXCL10 (interferon induced protein of 10 kDa), and CXCL11 (interferon inducible T-cell alpha-chemoattractant, I-TAC). CXC3R is expressed on CD4+ Th1 and CD8+ cytotoxic T lymphocytes as well as highly on innate lymphocytes, such as NK cells and NK T cells, where it may mediate the recruitment of these cells to the sites of infection and inflammation. Chemokines are principal regulators for leukocyte trafficking, recruitment, and activation. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling. Currently, there are ten known receptors for CC chemokines, seven for CXC chemokines, and single receptors for the XC and CX3C chemokines.


Pssm-ID: 341335 [Multi-domain]  Cd Length: 280  Bit Score: 384.04  E-value: 3.97e-134
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776  54 AFLPALYSLLFLLGLLGNGAVAAVLLSRRAALSSTDTFLLHLAVADTLLVLTLPLWAVDAAVQWVFGSGLCKVAGALFNI 133
Cdd:cd15180    1 VFLPVLYSLVFLLGLLGNGLVLAVLLQKRRNLSVTDTFILHLALADILLLVTLPFWAVQAVHGWIFGTGLCKLAGAVFKI 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 134 NFYAGALLLACISFDRYLNIVHATQLYRRGPPARVTLTCLAVWGLCLLFALPDFIFLSAHHDERLNATHCQYNFPQV--- 210
Cdd:cd15180   81 NFYCGIFLLACISFDRYLSIVHAVQMYSRKKPMLVHLSCLIVWLFCLLLSIPDFIFLEATKDPRQNKTECVHNFPQSdty 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 211 GRTALRVLQLVAGFLLPLLVMAYCYAHILAVLLVS-RGQRRLRAMRLVVAVVVAFALCWTPYHLVVLVDILMDLGALARN 289
Cdd:cd15180  161 WWLALRLLYHIVGFLLPLAVMVYCYTSILLRLLRSsQGFQKQRAIRVIVAVVVVFFLCWTPYNIALLVDTLIDLSVLDRN 240
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|
gi 222537776 290 CGRESRVDVAKSVTSGLGYMHCCLNPLLYAFVGVKFRERM 329
Cdd:cd15180  241 CGTESRLDIALSVTSSLGYFHCCLNPLLYAFVGVKFRRKL 280
7tmA_Chemokine_R cd14984
classical and atypical chemokine receptors, member of the class A family of ...
74-329 1.52e-113

classical and atypical chemokine receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Chemokines are principal regulators for leukocyte trafficking, recruitment, and activation. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling. Currently, there are ten known receptors for CC chemokines, seven for CXC chemokines, and single receptors for the XC and CX3C chemokines. In addition to these classical chemokine receptors, there exists a subfamily of atypical chemokine receptors (ACKRs) that are unable to couple to G-proteins and, instead, they preferentially mediate beta-arrestin dependent processes, such as receptor internalization, after ligand binding. The classical chemokine receptors contain a conserved DRYLAIV motif in the second intracellular loop, which is required for G-protein coupling. However, the ACKRs lack this conserved motif and fail to couple to G-proteins and induce classical GPCR signaling. Five receptors have been identified for the ACKR family, including CC-chemokine receptors like 1 and 2 (CCRL1 and CCRL2), CXCR7, Duffy antigen receptor for chemokine (DARC), and D6. Both ACKR1 (DARC) and ACKR3 (CXCR7) show low sequence homology to the classic chemokine receptors.


Pssm-ID: 341319 [Multi-domain]  Cd Length: 278  Bit Score: 331.49  E-value: 1.52e-113
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776  74 VAAVLLSRRAALSSTDTFLLHLAVADTLLVLTLPLWAVDAAVQWVFGSGLCKVAGALFNINFYAGALLLACISFDRYLNI 153
Cdd:cd14984   21 VLLVLLYYRKLRSMTDVYLLNLALADLLFVLTLPFWAVYAADGWVFGSFLCKLVSALYTINFYSGILFLACISIDRYLAI 100
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 154 VHATQLYRRGPPARVTLTCLAVWGLCLLFALPDFIFLSAHHdeRLNATHCQYNFPQVG----RTALRVLQLVAGFLLPLL 229
Cdd:cd14984  101 VHAVSALRARTLLHGKLTCLGVWALALLLSLPEFIFSQVSE--ENGSSICSYDYPEDTattwKTLLRLLQNILGFLLPLL 178
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 230 VMAYCYAHILAVLLVSRGQRRLRAMRLVVAVVVAFALCWTPYHLVVLVDILMDLGALARNCGRESRVDVAKSVTSGLGYM 309
Cdd:cd14984  179 VMLFCYSRIIRTLLRARNHKKHRALRVIFAVVVVFFLCWLPYNIVLLLDTLQLLGIISRSCELSKSLDYALQVTESLAFS 258
                        250       260
                 ....*....|....*....|
gi 222537776 310 HCCLNPLLYAFVGVKFRERM 329
Cdd:cd14984  259 HCCLNPVLYAFVGVKFRKYL 278
7tmA_CXCR1_2 cd15178
CXC chemokine receptor types 1 and 2, member of the class A family of seven-transmembrane G ...
74-329 6.32e-84

CXC chemokine receptor types 1 and 2, member of the class A family of seven-transmembrane G protein-coupled receptors; CXCR1 and CXCR2 are closely related chemotactic receptors for a group of CXC chemokines distinguished by the presence of the amino acid motif ELR immediately adjacent to their CXC motif. Expression of CXCR1 and CXCR2 is strictly controlled in neutrophils by external stimuli such as lipopolysaccharide (LPS), tumor necrosis factor (TNF)-alpha, Toll-like receptor agonists, and nitric oxide. CXCL8 (formerly known as interleukin-8) binds with high-affinity and activates both receptors. CXCR1 also binds CXCL7 (neutrophil-activating protein-2), whereas CXCR2 non-selectively binds to all seven ELR-positive chemokines (CXCL1-7). Chemokines are principal regulators for leukocyte trafficking, recruitment, and activation. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling. Currently, there are ten known receptors for CC chemokines, seven for CXC chemokines, and single receptors for the XC and CX3C chemokines.


Pssm-ID: 341333 [Multi-domain]  Cd Length: 279  Bit Score: 256.05  E-value: 6.32e-84
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776  74 VAAVLLSRRAALSSTDTFLLHLAVADTLLVLTLPLWAVDAAVQWVFGSGLCKVAGALFNINFYAGALLLACISFDRYLNI 153
Cdd:cd15178   21 VVLVILYNRRSRSSTDVYLLHLAIADLLFALTLPFWAVSVVKGWIFGTFMCKLVSLLQEANFYSGILLLACISVDRYLAI 100
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 154 VHATQLyRRGPPARVTLTCLAVWGLCLLFALPDFIFLSAHHDERLNATHCQYNF----PQVGRTALRVLQLVAGFLLPLL 229
Cdd:cd15178  101 VHATRA-LTQKRHLVKFVCAGVWLLSLLLSLPALLNRDAFKPPNSGRTVCYENLgnesADKWRVVLRILRHTLGFLLPLV 179
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 230 VMAYCYAHILAVLLVSRGQRRLRAMRLVVAVVVAFALCWTPYHLVVLVDILMDLGALARNCGRESRVDVAKSVTSGLGYM 309
Cdd:cd15178  180 VMLFCYGFTIKTLLQTRSFQKHRAMRVIFAVVLAFLLCWLPYNVTVLIDTLMRTKLITETCELRNHVDVALYVTQILGFL 259
                        250       260
                 ....*....|....*....|
gi 222537776 310 HCCLNPLLYAFVGVKFRERM 329
Cdd:cd15178  260 HSCINPVLYAFIGQKFRNNL 279
7tmA_CXCR5 cd15181
CXC chemokine receptor type 5, member of the class A family of seven-transmembrane G ...
74-326 2.90e-81

CXC chemokine receptor type 5, member of the class A family of seven-transmembrane G protein-coupled receptors; CXCR5 is a B-cell selective receptor that binds specifically to the homeostatic chemokine CXCL13 and regulates adaptive immunity. The receptor is found on all peripheral blood and tonsillar B cells and is involved in lymphocyte migration (homing) to specific tissues and development of normal lymphoid tissue. Chemokines are principal regulators for leukocyte trafficking, recruitment, and activation. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling. Currently, there are ten known receptors for CC chemokines, seven for CXC chemokines, and single receptors for the XC and CX3C chemokines.


Pssm-ID: 341336 [Multi-domain]  Cd Length: 281  Bit Score: 249.67  E-value: 2.90e-81
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776  74 VAAVLLSRRAALSSTDTFLLHLAVADTLLVLTLPLWAVDAAVQWVFGSGLCKVAGALFNINFYAGALLLACISFDRYLNI 153
Cdd:cd15181   21 VLTILLRRRRSRRTTENYLLHLALADLLLLLTFPFSVVESIAGWVFGTFLCKLVGAIHKLNFYCSSLLLACISVDRYLAI 100
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 154 VHATQLYRRGPPARVTLTCLAVWGLCLLFALPDFIFLSAHHDERLNATHCqyNFPQVGRTALRVLQL------VAGFLLP 227
Cdd:cd15181  101 VHAIHSYRHRRLRSVHLTCGSIWLVCFLLSLPNLVFLEVETSTNANRTSC--SFHQYGIHESNWWLTsrflyhVVGFFLP 178
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 228 LLVMAYCYAHILAVLL-VSRGQRRLRAMRLVVAVVVAFALCWTPYHLVVLVDILMDLGALARNCGRESRVDVAKSVTSGL 306
Cdd:cd15181  179 LLIMGYCYATIVVTLCqSSRRLQKQKAIRVAILVTLVFCLCWLPYNIVIFLDTLDDLKAVVKNCKLNDLLDAAITVTESL 258
                        250       260
                 ....*....|....*....|
gi 222537776 307 GYMHCCLNPLLYAFVGVKFR 326
Cdd:cd15181  259 GFSHCCLNPILYAFIGVKFR 278
7tmA_CXCR4 cd15179
CXC chemokine receptor type 4, member of the class A family of seven-transmembrane G ...
86-327 8.99e-66

CXC chemokine receptor type 4, member of the class A family of seven-transmembrane G protein-coupled receptors; CXCR4 is the only known G protein-coupled chemokine receptor for the key homeostatic ligand CXCL12, which is constitutively secreted by bone marrow stromal cells. Atypical chemokine receptor CXCR7 (ACKR3) also binds CXCL12, but activates signaling in a G protein-independent manner. CXCR4 is also a co-receptor for HIV infection and plays critical roles in the development of immune system during both lymphopoiesis and myelopoiesis. Chemokines are principal regulators for leukocyte trafficking, recruitment, and activation. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling. Currently, there are ten known receptors for CC chemokines, seven for CXC chemokines, and single receptors for the XC and CX3C chemokines.


Pssm-ID: 341334 [Multi-domain]  Cd Length: 278  Bit Score: 209.62  E-value: 8.99e-66
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776  86 SSTDTFLLHLAVADTLLVLTLPLWAVDAAVQWVFGSGLCKVAGALFNINFYAGALLLACISFDRYLNIVHATQLYRRGPP 165
Cdd:cd15179   33 TMTDKYRLHLSVADLLFVLTLPFWAVDAAANWYFGNFLCKAVHVIYTVNLYSSVLILAFISLDRYLAIVHATNSQRPRKL 112
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 166 ARVTLTCLAVWGLCLLFALPDFIFlsAHHDERLNATHCQYNFPQ----VGRTALRVLQLVAGFLLPLLVMAYCYAHILAV 241
Cdd:cd15179  113 LAEKVVYVGVWLPALLLTVPDLVF--AKVSELDDRYICDRIYPEdtfeLWVVAFRFQHILVGLVLPGLVILTCYCIIISK 190
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 242 LLVSRGQRRLRAMRLVVAVVVAFALCWTPYHLVVLVDILMDLGALARNCGRESRVDVAKSVTSGLGYMHCCLNPLLYAFV 321
Cdd:cd15179  191 LSHSKGHQKRKALKTTVILILAFFACWLPYYIGISIDTFMLLEIIKQSCEMEQTVHKWISITEALAFFHCCLNPILYAFL 270

                 ....*.
gi 222537776 322 GVKFRE 327
Cdd:cd15179  271 GAKFKT 276
7tmA_CCR10 cd15177
CC chemokine receptor type 10, member of the class A family of seven-transmembrane G ...
74-326 1.03e-65

CC chemokine receptor type 10, member of the class A family of seven-transmembrane G protein-coupled receptors; CCR10 is a homeostatic receptor specific for two C-C motif chemokines, CCL27 and CCL28. Activation of CCR10 by its two ligands mediates diverse activities, ranging from leukocyte trafficking to skin cancer. Chemokines are principal regulators for leukocyte trafficking, recruitment, and activation. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling. Currently, there are ten known receptors for CC chemokines, seven for CXC chemokines, and single receptors for the XC and CX3C chemokines. The CC chemokine receptors are all activating the G protein Gi.


Pssm-ID: 341332 [Multi-domain]  Cd Length: 280  Bit Score: 209.63  E-value: 1.03e-65
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776  74 VAAVLLSRRAALSSTDTFLLHLAVADTLLVLTLPLWAVDAAVQWVFGSGLCKVAGALFNINFYAGALLLACISFDRYLNI 153
Cdd:cd15177   21 VLATHTRYRRLRSMTDVYLLNLALADLLLLLTLPFAAAETLQGWIFGNAMCKLIQGLYAINFYSGFLFLTCISVDRYVVI 100
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 154 VHATQLYRRGP--PARVTLTCLAVWGLCLLFALPDFIFlsAHHDERLNATHCQYNFPQVG----RTALRVLQLVAGFLLP 227
Cdd:cd15177  101 VRATSAHRLRPktLFYSVLTSLIVWLLSILFALPQLIY--SRVENRSELSSCRMIFPEVVsrtvKGATALTQVVLGFAIP 178
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 228 LLVMAYCYAHILAVLLVSRGQRRLRAMRLVVAVVVAFALCWTPYHLVVLVDILMDLGALARNCGRESRVDVAKSVTSGLG 307
Cdd:cd15177  179 LIVMAVCYAAIGRTLLAARGWERHRALRVIAALVVAFVLFQLPYSVVLLLDTADLLATLELSCSQSKRKDIALLVTSGLA 258
                        250
                 ....*....|....*....
gi 222537776 308 YMHCCLNPLLYAFVGVKFR 326
Cdd:cd15177  259 YVRCCLNPLLYAFVGVRFR 277
7tmA_CCR9 cd15174
CC chemokine receptor type 9, member of the class A family of seven-transmembrane G ...
74-326 1.50e-65

CC chemokine receptor type 9, member of the class A family of seven-transmembrane G protein-coupled receptors; CCR9 is a homeostatic receptor specific for CCL25 (formerly known as thymus expressed chemokine) and is highly expressed on both immature and mature thymocytes as well as on intestinal homing T Lymphocytes and mucosal Lymphocytes. In cutaneous melanoma, activation of CCR9-CCL25 has been shown to stimulate metastasis to the small intestine. Chemokines are principal regulators for leukocyte trafficking, recruitment, and activation. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling. Currently, there are ten known receptors for CC chemokines, seven for CXC chemokines, and single receptors for the XC and CX3C chemokines. The CC chemokine receptors are all activating the G protein Gi.


Pssm-ID: 320302  Cd Length: 280  Bit Score: 209.22  E-value: 1.50e-65
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776  74 VAAVLLSRRAALSSTDTFLLHLAVADTLLVLTLPLWAVDAAVQWVFGSGLCKVAGALFNINFYAGALLLACISFDRYLNI 153
Cdd:cd15174   21 VVLIYTYYRRRKTMTDVYLLNLAIADLLFLCTLPFWATAASSGWVFGTFLCKVVNSMYKINFYSCMLLLTCISVDRYIAI 100
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 154 VHAT--QLYRRGPPARVTLTCLAVWGLCLLFALPDFIFLSAHHDErlNATHCQYNFPQVGRTALRV----LQLVAGFLLP 227
Cdd:cd15174  101 VQATkaHNSKNKRLLYSKLVCFFVWLLSTILSLPEILFSQSKEEE--SVTTCTMVYPSNESNRFKVavlaLKVTVGFFLP 178
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 228 LLVMAYCYAHILAVLLVSRGQRRLRAMRLVVAVVVAFALCWTPYHLVVLVDILMDLGALARNCGRESRVDVAKSVTSGLG 307
Cdd:cd15174  179 FVVMVICYTLIIHTLLQAKRFQKHKALKVIIAVVTVFVLSQLPYNSILLIKTINAYNITITDCATSQNLDIAGQVTQSIA 258
                        250
                 ....*....|....*....
gi 222537776 308 YMHCCLNPLLYAFVGVKFR 326
Cdd:cd15174  259 FLHSCLNPFLYVFVGVRFR 277
7tmA_CCR6 cd15172
CC chemokine receptor type 6, member of the class A family of seven-transmembrane G ...
86-326 9.43e-65

CC chemokine receptor type 6, member of the class A family of seven-transmembrane G protein-coupled receptors; CCR6 is the only known receptor identified for the chemokine CCL20 (also known as macrophage inflammatory protein-3alpha, MIP-3alpha). CCR6 is expressed by all mature human B cells, effector memory T-cells, and dendritic cells found in the gut mucosal immune system. CCL20 contributes to recruitment of CCR6-expressing cells to Peyer's patches and isolated lymphoid follicles in the intestine, thereby promoting the assembly and maintenance of organized lymphoid structures. Also, CCL20 expression is highly inducible in response to inflammatory signals. Thus, CCL20 is involved in both inflammatory and homeostatic functions in the immune system. Chemokines are principal regulators for leukocyte trafficking, recruitment, and activation. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling. Currently, there are ten known receptors for CC chemokines, seven for CXC chemokines, and single receptors for the XC and CX3C chemokines. The CC chemokine receptors are all activating the G protein Gi.


Pssm-ID: 341330 [Multi-domain]  Cd Length: 281  Bit Score: 207.30  E-value: 9.43e-65
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776  86 SSTDTFLLHLAVADTLLVLTLPLWAVDAAVQWVFGSGLCKVAGALFNINFYAGALLLACISFDRYLNIVHATQ--LYRRG 163
Cdd:cd15172   33 SMTDVYLLNMAIADILFVLTLPFWAVYEAHQWIFGNFSCKLLRGIYAINFYSGMLLLACISVDRYIAIVQATKsfRLRSR 112
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 164 PPARVTLTCLAVWGLCLLFALPDFIFLSAHHDERLNATHCQYNFPQ-----VGRTALRVLQLVAGFLLPLLVMAYCYAHI 238
Cdd:cd15172  113 TLAYSKLICAAVWLLAILISLPTFIFSEVYDFGLEEQYVCEPKYPKnstaiMWKLLVLSLQVSLGFFIPLLVMIFCYSFI 192
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 239 LAVLLVSRGQRRLRAMRLVVAVVVAFALCWTPYHLVVLVDIlMDLGaLARNCGRESRVDVAKSVTSGLGYMHCCLNPLLY 318
Cdd:cd15172  193 IKTLLQAQNSQRHKAVRVVVAVVLVFLVCQVPYNIVLLIEA-INLG-EQQSCSSEKAVAYAKTITECLAFFHCCLNPVLY 270

                 ....*...
gi 222537776 319 AFVGVKFR 326
Cdd:cd15172  271 AFIGVKFR 278
7tm_1 pfam00001
7 transmembrane receptor (rhodopsin family); This family contains, amongst other ...
74-318 6.13e-59

7 transmembrane receptor (rhodopsin family); This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins.


Pssm-ID: 394960 [Multi-domain]  Cd Length: 256  Bit Score: 191.36  E-value: 6.13e-59
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776   74 VAAVLLSRRAALSSTDTFLLHLAVADTLL-VLTLPLWAVDAAV--QWVFGSGLCKVAGALFNINFYAGALLLACISFDRY 150
Cdd:pfam00001   5 VILVILRNKKLRTPTNIFLLNLAVADLLFgLLTLPFWLVYYLLhgDWPFGSALCKLVGALFYVNMYASILLLTAISIDRY 84
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776  151 LNIVHATQLYRRGPPARVTLTCLAVWGLCLLFALPDFIFLSAHHDERLNATHC--QYNFPQVGRTALRVLQLVAGFLLPL 228
Cdd:pfam00001  85 LAIVHPLRYRRIRTPRRAKVLILLVWVLALLLSLPPLLFGWTLTVPEGNVTVCliDFPEDLVKPVSYTLLISVLGFLLPL 164
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776  229 LVMAYCYAHILAVLL--------VSRGQRRLRAMRLVVAVVVAFALCWTPYHLVVLVDilmdlgALARNCGRESRVDVAK 300
Cdd:pfam00001 165 LVILVCYTRIYRTLRksaskqksEERTQRRRKALKTLAVVVVVFILCWLPYHIVLLLD------SLALDCELSRLLDKAL 238
                         250
                  ....*....|....*...
gi 222537776  301 SVTSGLGYMHCCLNPLLY 318
Cdd:pfam00001 239 SVTLWLAYVNSCLNPIIY 256
7tmA_ACKR2_D6 cd15188
atypical chemokine receptor 2, member of the class A family of seven-transmembrane G ...
88-326 5.60e-58

atypical chemokine receptor 2, member of the class A family of seven-transmembrane G protein-coupled receptors; ACKR2 (also known as D6) binds non-selectively to all inflammatory CC-chemokines, but not to homeostatic CC-chemokines involved in controlling the migration of cells. Unlike the classical chemokine receptors that contain a conserved DRYLAIV motif in the second intracellular loop, which is required for G-protein coupling, the ACKRs lack this conserved motif and fail to couple to G-proteins and induce classical GPCR signaling. Five receptors have been identified for the ACKR family, including CC-chemokine receptors like 1 and 2 (CCRL1 and CCRL2), CXCR7, Duffy antigen receptor for chemokine (DARC), and D6. Both ACKR1 (DARC) and ACKR3 (CXCR7) show low sequence homology to the classic chemokine receptors.


Pssm-ID: 320316 [Multi-domain]  Cd Length: 278  Bit Score: 189.61  E-value: 5.60e-58
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776  88 TDTFLLHLAVADTLLVLTLPLWAVDAAVQWVFGSGLCKVAGALFNINFYAGALLLACISFDRYLNIVHATQLYRRGPPAR 167
Cdd:cd15188   36 TEVYLLNLAVSDLLFLVTLPFWAMYVAWHWVFGSFLCKFVSTLYTINFYSGIFFVSCMSLDKYLEIVHAQSPHRLRTRRK 115
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 168 VTLTCLAVWGLCLLFALPDFIFLSAHHDERlNATHCQYNFPQVG---RTALRVLQLVAGFLLPLLVMAYCYAHILAVLLV 244
Cdd:cd15188  116 SLLVLVAVWVLSIALSVPDMVFVQTHHTNN-GVWVCHADYGGHHtiwKLVFQFQQNLLGFLFPLLAMVFFYSRIACVLTR 194
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 245 SRGQRRLRAMRLVVAVVVAFALCWTPYHLVVLVDILMDLGALaRNCGRESRVDVAKSVTSGLGYMHCCLNPLLYAFVGVK 324
Cdd:cd15188  195 LRPPGQGRALRFVAALVVVFFVLWFPYNLTLFLHSLQDLHVI-GNCERSRHLDYALQVTESLAFVHCCLNPLLYAFVSKR 273

                 ..
gi 222537776 325 FR 326
Cdd:cd15188  274 FR 275
7tmA_ACKR4_CCR11 cd15176
atypical chemokine receptor 4, member of the class A family of seven-transmembrane G ...
55-329 1.08e-56

atypical chemokine receptor 4, member of the class A family of seven-transmembrane G protein-coupled receptors; ACKR4 was first reported to bind several CC chemokines including CCL19, CCL21, and CCL25 and was originally designated CCR11. AKCR4 is unable to couple to G-protein and, instead, it preferentially mediates beta-arrestin dependent processes, such as receptor internalization, after ligand binding. Thus, ACKR4 may act as a scavenger receptor to suppress the effects of proinflammatory chemokines. Unlike the classical chemokine receptors that contain a conserved DRYLAIV motif in the second intracellular loop, which is required for G-protein coupling, the ACKRs lack this conserved motif and fail to couple to G-proteins and induce classical GPCR signaling. Five receptors have been identified for the ACKR family, including CC-chemokine receptors like 1 and 2 (CCRL1 and CCRL2), CXCR7, Duffy antigen receptor for chemokine (DARC), and D6. Both ACKR1 (DARC) and ACKR3 (CXCR7) show low sequence homology to the classic chemokine receptors.


Pssm-ID: 320304 [Multi-domain]  Cd Length: 276  Bit Score: 186.10  E-value: 1.08e-56
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776  55 FLPALYSLLFLLGLLGNGAVAAVLLSRRAALSSTDTFLLHLAVADTLLVLTLPLWAVDAAVQWVFGSGLCKVAGALFNIN 134
Cdd:cd15176    2 FLPVFYTIALVVGLAGNSLVVAIYAYYKKLKTKTDVYILNLAVADLLLLFTLPFWAADAVNGWVLGTAMCKITSALYTMN 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 135 FYAGALLLACISFDRYLNIVHATQLYRRGPPARVtlTCLAVWGLCLLFALPDFIFLSAHhdERLNATHCQYNFP-QVGRT 213
Cdd:cd15176   82 FSCGMQFLACISVDRYVAITKATSRQFTGKHCWI--VCLCVWLLAILLSIPDLVFSTVR--ENSDRYRCLPVFPpSLVTS 157
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 214 A---LRVLQLVAGFLLPLLVMAYCYAHILAVLLVSRGQRRLRAMRLVVAVVVAFALCWTPYHLVVLVDILMDLGALARNC 290
Cdd:cd15176  158 AkatIQILEVLLGFVLPFLVMVFCYSRVARALSRTPNVKKSRALKVLLAVVGVFIVTQLPYNVVKFYRAIDVIYLLITDC 237
                        250       260       270
                 ....*....|....*....|....*....|....*....
gi 222537776 291 GRESRVDVAKSVTSGLGYMHCCLNPLLYAFVGVKFRERM 329
Cdd:cd15176  238 SMSKTLDIAIQVTESIALFHSCLNPVLYVFMGASFKSHI 276
7tmA_CCR7 cd15175
CC chemokine receptor type 7, member of the class A family of seven-transmembrane G ...
88-326 5.99e-55

CC chemokine receptor type 7, member of the class A family of seven-transmembrane G protein-coupled receptors; CCR7 is a major homeostatic receptor responsible for lymph node development and effective adaptive immune responses and plays a critical role in trafficking of dendritic cells and B and T lymphocytes. Its only two ligands, CCL and CCl21, are primarily produced by stromal cells in the T cell zones of lymph nodes and spleen. Chemokines are principal regulators for leukocyte trafficking, recruitment, and activation. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling. Currently, there are ten known receptors for CC chemokines, seven for CXC chemokines, and single receptors for the XC and CX3C chemokines. The CC chemokine receptors are all activating the G protein Gi.


Pssm-ID: 341331  Cd Length: 278  Bit Score: 181.89  E-value: 5.99e-55
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776  88 TDTFLLHLAVADTLLVLTLPLWAVDAAVQWVFGSGLCKVAGALFNINFYAGALLLACISFDRYLNIVHATQLYRRGPPAR 167
Cdd:cd15175   35 TDIYLLNLALADILFLLTLPFWAASAAKKWVFGEEMCKAVYCLYKMSFFSGMLLLMCISIDRYFAIVQAASAHRHRSRAV 114
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 168 V--TLTCLAVWGLCLLFALPDFIFLSAHHDERLNATHCQYNFPQVGRTALRVLQLVAGFLLPLLVMAYCYAHILAVLLVS 245
Cdd:cd15175  115 FisKVSSLGVWVLAFILSIPELLYSGVNNNDGNGTCSIFTNNKQTLSVKIQISQMVLGFLVPLVVMSFCYSVIIKTLLQA 194
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 246 RGQRRLRAMRLVVAVVVAFALCWTPYHLVVLVDILMDLGALARNCGRESRVDVAKSVTSGLGYMHCCLNPLLYAFVGVKF 325
Cdd:cd15175  195 RNFEKNKAIKVIIAVVVVFVVFQLPYNSVMLVSTLSSFKGNTTDCDYSKNLDFALDVTYSLACFRCCLNPFLYAFIGVKF 274

                 .
gi 222537776 326 R 326
Cdd:cd15175  275 R 275
7tmA_CXCR6 cd15173
CXC chemokine receptor type 6, member of the class A family of seven-transmembrane G ...
88-327 2.10e-52

CXC chemokine receptor type 6, member of the class A family of seven-transmembrane G protein-coupled receptors; CXCR6 binds specifically to the chemokine CXCL16, which is expressed on dendritic cells, monocyte/macrophages, activated T cells, fibroblastic reticular cells, and cancer cells. CXCR6 is phylogenetically more closely related to CC-type chemokine receptors (CCR6 and CCR9) than other CXC receptors. Chemokines are principal regulators for leukocyte trafficking, recruitment, and activation. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling. Currently, there are ten known receptors for CC chemokines, seven for CXC chemokines, and single receptors for the XC and CX3C chemokines.


Pssm-ID: 320301 [Multi-domain]  Cd Length: 270  Bit Score: 174.96  E-value: 2.10e-52
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776  88 TDTFLLHLAVADTLLVLTLPLWAVDAAVQWVFGSGLCKVAGALFNINFYAGALLLACISFDRYLNIVHATQLYRRGPPAR 167
Cdd:cd15173   35 TDIFLVNLAVADLLFLCTLPFWAYSAAHEWIFGTVMCKITNGLYTINLYSSMLILTCITVDRFIVIVQATKAHNCHAKKM 114
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 168 V--TLTCLAVWGLCLLFALPDFIFLSAHHDERLNathCQYNFPQVG-RTALRVLQLVAGFLLPLLVMAYCYAHILAVLLV 244
Cdd:cd15173  115 RwgKVVCTLVWVISLLLSLPQFIYSEVRNLSSKI---CSMVYPPDAiEVVVNIIQMTVGFFLPLLAMIICYSVIIKTLLH 191
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 245 SRGQRRLRAMRLVVAVVVAFALCWTPYHLVVLVDILMDLGALARNcgresrVDVAKSVTSGLGYMHCCLNPLLYAFVGVK 324
Cdd:cd15173  192 AKGFQKHKSLKIIFVVVAVFILTQLPYNIMKLIRTLHIENTDSTN------FKYAILITEAIAYLHACLNPILYAFVGVK 265

                 ...
gi 222537776 325 FRE 327
Cdd:cd15173  266 FRK 268
7tmA_Angiotensin_R-like cd14985
angiotesin receptor family and its related G protein-coupled receptors, member of the class A ...
74-328 2.28e-52

angiotesin receptor family and its related G protein-coupled receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes the angiotensin receptors, the bradykinin receptors, apelin receptor as well as putative G-protein coupled receptors (GPR15 and GPR25). Angiotensin II (Ang II), the main effector in the renin-angiotensin system, plays a crucial role in the regulation of cardiovascular homeostasis through its type 1 (AT1) and type 2 (AT2) receptors. Ang II contributes to cardiovascular diseases such as hypertension and atherosclerosis via AT1R activation. Ang II increases blood pressure through Gq-mediated activation of phospholipase C, resulting in phosphoinositide (PI) hydrolysis and increased intracellular calcium levels. Through the AT2 receptor, Ang II counteracts the vasoconstrictor action of AT1R and thereby induces vasodilation, sodium excretion, and reduction of blood pressure. Bradykinins (BK) are pro-inflammatory peptides that mediate various vascular and pain responses to tissue injury through its B1 and B2 receptors. Apelin (APJ) receptor binds the endogenous peptide ligands, apelin and Toddler/Elabela. APJ is an adipocyte-derived hormone that is ubiquitously expressed throughout the human body, and Toddler/Elabela is a short secretory peptide that is required for normal cardiac development in zebrafish. Activation of APJ receptor plays key roles in diverse physiological processes including vasoconstriction and vasodilation, cardiac muscle contractility, angiogenesis, and regulation of water balance and food intake. Orphan receptors, GPR15 and GPR25, share strong sequence homology to the angiotensin II type AT1 and AT2 receptors.


Pssm-ID: 341320 [Multi-domain]  Cd Length: 284  Bit Score: 175.26  E-value: 2.28e-52
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776  74 VAAVLLSRRAALSSTDTFLLHLAVADTLLVLTLPLWAVDAAVQ--WVFGSGLCKVAGALFNINFYAGALLLACISFDRYL 151
Cdd:cd14985   21 VVWVFLFPRGPKRVADIFIANLAAADLVFVLTLPLWATYTANQydWPFGAFLCKVSSYVISVNMFASIFLLTCMSVDRYL 100
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 152 NIVHATQLYRRGPPARVTLTCLAVWGLCLLFALPDFIFLSAHHDERLNATHCQYNFPQVG-RTALRVLQLVAGFLLPLLV 230
Cdd:cd14985  101 AIVHPVASRRLRRRRQARVTCALIWVVACLLSLPTFLLRSLQAIENLNKTACIMLYPHEAwHFGLSLELNILGFVLPLLI 180
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 231 MAYCYAHILAVLLVSR------GQRRLRAMRLVVAVVVAFALCWTPYHLVVLVDILMDLGALaRNCGRESRVDVAKSVTS 304
Cdd:cd14985  181 ILTCYFHIARSLRKRYertgknGRKRRKSLKIIFALVVAFLVCWLPFHFFKFLDFLAQLGAI-RPCFWELFLDLGLPIAT 259
                        250       260
                 ....*....|....*....|....
gi 222537776 305 GLGYMHCCLNPLLYAFVGVKFRER 328
Cdd:cd14985  260 CLAFTNSCLNPFIYVFVDRRFRQK 283
7tmA_XCR1 cd15182
XC chemokine receptor 1, member of the class A family of seven-transmembrane G protein-coupled ...
88-326 4.55e-52

XC chemokine receptor 1, member of the class A family of seven-transmembrane G protein-coupled receptors; XCR1 is a chemokine receptor specific for XCL1 and XCL2 (previously called lymphotactin alpha/beta), which differ in only two amino acids. XCL1/2 is the only member of the C chemokine subfamily, which is unique as containing only two of the four cysteines that are found in other chemokine families. Human XCL1/2 has been shown to be secreted by activated CD8+ T cells and upon activation of the innate immune system. Chemokines are principal regulators for leukocyte trafficking, recruitment, and activation. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling.


Pssm-ID: 341337 [Multi-domain]  Cd Length: 271  Bit Score: 174.09  E-value: 4.55e-52
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776  88 TDTFLLHLAVADTLLVLTLPLWAVDAAVQWVFGSGLCKVAGALFNINFYAGALLLACISFDRYLNIVHATQLYRRGPPAR 167
Cdd:cd15182   35 TNIFILNLAISDLLFTFTLPFWASYHSSGWIFGEILCKAVTSIFYIGFYSSILFLTLMTIDRYLAVVHPLSALRSRKLRY 114
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 168 VTLTCLAVWGLCLLFALPDFIFLSAHHDERLNAThCQYNFPQvgRTALRVLQLVAGFLLPLLVMAYCYAHILAVLLVSRG 247
Cdd:cd15182  115 ASLVSVAVWVISILASLPELILSTVMKSDEDGSL-CEYSSIK--WKLGYYYQQNLFFLIPLGIIVYCYVRILQTLMRTRT 191
                        170       180       190       200       210       220       230
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 222537776 248 QRRLRAMRLVVAVVVAFALCWTPYHLVVLVDILMDLGALarNCGRESRVDVAKSVTSGLGYMHCCLNPLLYAFVGVKFR 326
Cdd:cd15182  192 MRKHRTVKLIFVIVLVFFLSWAPYNIVIFLRSLKDLTIP--ICECSKQLDYAFYICRNIAFSHCCLNPVFYVFVGVKFR 268
7tmA_purinoceptor-like cd14982
purinoceptor and its related proteins, member of the class A family of seven-transmembrane G ...
77-329 8.16e-51

purinoceptor and its related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; Members of this subfamily include lysophosphatidic acid receptor, P2 purinoceptor, protease-activated receptor, platelet-activating factor receptor, Epstein-Barr virus induced gene 2, proton-sensing G protein-coupled receptors, GPR35, and GPR55, among others. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 341318 [Multi-domain]  Cd Length: 283  Bit Score: 171.29  E-value: 8.16e-51
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776  77 VLLSRRAALSSTDTFLLHLAVADTLLVLTLPLWAVDAAVQ--WVFGSGLCKVAGALFNINFYAGALLLACISFDRYLNIV 154
Cdd:cd14982   24 VFLRKMKKRSPTTIYMINLALADLLFVLTLPFRIYYYLNGgwWPFGDFLCRLTGLLFYINMYGSILFLTCISVDRYLAVV 103
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 155 HATQLYRRGPPARVTLTCLAVWGLCLLFALPdFIFLSAHHDERLNATHCQYNFPQVGRTA--LRVLQLVAGFLLPLLVMA 232
Cdd:cd14982  104 HPLKSRRLRRKRYAVGVCAGVWILVLVASVP-LLLLRSTIAKENNSTTCFEFLSEWLASAapIVLIALVVGFLIPLLIIL 182
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 233 YCYAHILAVLLVSRGQ-----RRLRAMRLVVAVVVAFALCWTPYHLVVLVDILMDLGALArNCGRESRVDVAKSVTSGLG 307
Cdd:cd14982  183 VCYSLIIRALRRRSKQsqksvRKRKALRMILIVLAVFLVCFLPYHVTRILYLLVRLSFIA-DCSARNSLYKAYRITLCLA 261
                        250       260
                 ....*....|....*....|..
gi 222537776 308 YMHCCLNPLLYAFVGVKFRERM 329
Cdd:cd14982  262 SLNSCLDPLIYYFLSKTFRKRL 283
7tmA_CCR5_CCR2 cd15184
CC chemokine receptor types 5 and 2, member of the class A family of seven-transmembrane G ...
74-326 1.22e-48

CC chemokine receptor types 5 and 2, member of the class A family of seven-transmembrane G protein-coupled receptors; CCR2 and CCR5 share very high amino acid sequence identity. Both receptors play important roles in the trafficking of monocytes/macrophages and are implicated in the pathogenesis of immunologic diseases (rheumatoid arthritis, celiac disease, and transplant rejection) and cardiovascular diseases (atherosclerosis and autoimmune hepatitis). CCR2 is a receptor specific for members of the monocyte chemotactic protein family, including CCL2, CCL7, and CCL13. Conversely, CCR5 is a major co-receptor for HIV infection and binds many CC chemokine ligands, including CC chemokine ligands including CCL2, CCL3, CCL4, CCL5, CCL11, CCL13, CCL14, and CCL16. CCR2 is expressed primarily on blood monocytes and memory T cells, whereas CCR5 is expressed on antigen-presenting cells (macrophages and dendritic cells) and activated T effector cells. Chemokines are principal regulators for leukocyte trafficking, recruitment, and activation. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling. Currently, there are ten known receptors for CC chemokines, seven for CXC chemokines, and single receptors for the XC and CX3C chemokines.


Pssm-ID: 341338  Cd Length: 278  Bit Score: 165.31  E-value: 1.22e-48
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776  74 VAAVLLSRRAALSSTDTFLLHLAVADTLLVLTLPLWAVDAAVQWVFGSGLCKVAGALFNINFYAGALLLACISFDRYLNI 153
Cdd:cd15184   21 VVLILINCKKLKSMTDIYLLNLAISDLLFLLTLPFWAHYAANEWVFGNAMCKLLTGLYHIGFFSGIFFIILLTIDRYLAI 100
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 154 VHATQLYRRGPPARVTLTCLAVWGLCLLFALPDFIFLSAHHDErlNATHCQYNFPQVGRTALRVLQL----VAGFLLPLL 229
Cdd:cd15184  101 VHAVFALKARTVTFGVVTSVVTWVVAVFASLPGIIFTKSQKEG--SHYTCSPHFPPSQYQFWKNFQTlkmnILGLVLPLL 178
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 230 VMAYCYAHILAVLL-VSRGQRRLRAMRLVVAVVVAFALCWTPYHLVVLVDILMDLGALArNCGRESRVDVAKSVTSGLGY 308
Cdd:cd15184  179 VMIICYSGILKTLLrCRNEKKRHKAVRLIFTIMIVYFLFWAPYNIVLLLNTFQEFFGLN-NCSSSNRLDQAMQVTETLGM 257
                        250
                 ....*....|....*...
gi 222537776 309 MHCCLNPLLYAFVGVKFR 326
Cdd:cd15184  258 THCCINPVIYAFVGEKFR 275
7tmA_Apelin_R cd15190
apelin receptor, member of the class A family of seven-transmembrane G protein-coupled ...
77-328 1.55e-46

apelin receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; Apelin (APJ) receptor is a G protein-coupled receptor that binds the endogenous peptide ligands, apelin and Toddler/Elabela. APJ is an adipocyte-derived hormone that is ubiquitously expressed throughout the human body and Toddler/Elabela is a short secretory peptide that is required for normal cardiac development in zebrafish. Activation of APJ receptor plays key roles in diverse physiological processes including vasoconstriction and vasodilation, cardiac muscle contractility, angiogenesis, and regulation of water balance and food intake.


Pssm-ID: 341340  Cd Length: 304  Bit Score: 160.70  E-value: 1.55e-46
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776  77 VLLSRRAALSSTDTFLLHLAVADTLLVLTLPLWAVDAAV--QWVFGSGLCKVAGALFNINFYAGALLLACISFDRYLNIV 154
Cdd:cd15190   35 VFRSKRKRRRSADTFIANLALADLTFVVTLPLWAVYTALgyHWPFGSFLCKLSSYLVFVNMYASVFCLTGLSFDRYLAIV 114
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 155 HATQLYRRGPPARVTLTCLAVWGLCLLFALPDFIFLSAHHDERLNATHCQYNFPQVGRT--------ALRVLQLVAGFLL 226
Cdd:cd15190  115 RSLASAKLRSRTSGIVALGVIWLLAALLALPALILRTTSDLEGTNKVICDMDYSGVVSNesewawiaGLGLSSTVLGFLL 194
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 227 PLLVMAYCYAHI-------LAVLLVSRGQRRLRAMRLVVAVVVAFALCWTPYHLVVLVDILMDLGALARNCGRESRVDVA 299
Cdd:cd15190  195 PFLIMLTCYFFIgrtvarhFSKLRRKEDKKKRRLLKIIITLVVTFALCWLPFHLVKTLYALMYLGILPFSCGFDLFLMNA 274
                        250       260
                 ....*....|....*....|....*....
gi 222537776 300 KSVTSGLGYMHCCLNPLLYAFVGVKFRER 328
Cdd:cd15190  275 HPYATCLAYVNSCLNPFLYAFFDPRFRQQ 303
7tmA_CX3CR1 cd15186
CX3C chemokine receptor 1, member of the class A family of seven-transmembrane G ...
74-326 6.29e-46

CX3C chemokine receptor 1, member of the class A family of seven-transmembrane G protein-coupled receptors; CX3CR1 is an inflammatory receptor specific for CX3CL1 (also known as fractalkine in human), which is involved in the adhesion and migration of leukocytes. The CX3C chemokine subfamily is only represented by CX3CL1, which exists in both soluble and membrane-anchored forms. Membrane-anchored form promotes strong adhesion of receptor-bearing leukocytes to CX3CL1-expressing endothelial cells. On the other hand, soluble CX3CL1, which is released by the proteolytic cleavage of membrane-anchored CX3CL1, is a potent chemoattractant for CX3CR1-expressing T cells and monocytes. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling.


Pssm-ID: 320314 [Multi-domain]  Cd Length: 273  Bit Score: 158.07  E-value: 6.29e-46
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776  74 VAAVLLSRRAALSSTDTFLLHLAVADTLLVLTLPLWAVDAAVQWVFGSGLCKVAGALFNINFYAGALLLACISFDRYLNI 153
Cdd:cd15186   21 VVLALTNSGKSKSITDIYLLNLALSDLLFVATLPFWTHYLINEWGLHNAMCKLTTAFFFIGFFGGIFFITVISIDRYLAI 100
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 154 VHATQLYRRGPPARVTLTCLAVWGLCLLFALPDFIFLSAHHDErlnathCQYNFPQVGRTALRVLQLV----AGFLLPLL 229
Cdd:cd15186  101 VLAANSMNNRTVQHGVTISLGVWAAAILVAVPQFMFTKMKENE------CLGDYPEVLQEIWPVLRNVelnfLGFLLPLL 174
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 230 VMAYCYAHILAVLLVSRGQRRLRAMRLVVAVVVAFALCWTPYHLVVLVDILmDLGALARNCGRESRVDVAKSVTSGLGYM 309
Cdd:cd15186  175 IMSYCYFRIIQTLFSCKNHKKARAIKLILLVVIVFFLFWTPYNVMIFLETL-KLYDFFPSCDMKKDLRLALSVTETIAFS 253
                        250
                 ....*....|....*..
gi 222537776 310 HCCLNPLLYAFVGVKFR 326
Cdd:cd15186  254 HCCLNPLIYAFAGEKFR 270
7tmA_AT1R cd15192
type 1 angiotensin II receptor, member of the class A family of seven-transmembrane G ...
91-329 1.94e-45

type 1 angiotensin II receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; Angiotensin II (Ang II), the main effector in the renin-angiotensin system, plays a crucial role in the regulation of cardiovascular homeostasis through its type 1 (AT1) and type 2 (AT2) receptors. Ang II contributes to cardiovascular diseases such as hypertension and atherosclerosis via AT1R activation. Ang II increases blood pressure through Gq-mediated activation of phospholipase C, resulting in phosphoinositide (PI) hydrolysis and increased intracellular calcium levels. Through the AT2R, Ang II counteracts the vasoconstrictor action of AT1R and thereby induces vasodilation, sodium excretion, and reduction of blood pressure. Moreover, AT1R promotes cell proliferation, whereas AT2R inhibits proliferation and stimulates cell differentiation. The AT2R is highly expressed during fetal development, however it is scarcely present in adult tissues and is induced in pathological conditions. Generally, the AT1R mediates many actions of Ang II, while the AT2R is involved in the regulation of blood pressure and renal function.


Pssm-ID: 320320 [Multi-domain]  Cd Length: 285  Bit Score: 157.21  E-value: 1.94e-45
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776  91 FLLHLAVADTLLVLTLPLWAVDAAV--QWVFGSGLCKVAGALFNINFYAGALLLACISFDRYLNIVHATQLYRRGPPARV 168
Cdd:cd15192   38 FLLNLALADLCFLITLPLWAAYTAMeyHWPFGNFLCKIASALVSFNLYASVFLLTCLSIDRYLAIVHPMKSRLRRTLVVA 117
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 169 TLTCLAVWGLCLLFALPDFIFLSAHHDERLNATHCQYNFPQVGRTALRVLQLVA---GFLLPLLVMAYCYAHILAVLLVS 245
Cdd:cd15192  118 RVTCIVIWLLAGVASLPAIIHRDVFFIENTNITVCAFHYPSQNSTLLVGLGLMKnllGFLIPFLIILTCYTLIGKALKKA 197
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 246 RGQRRLR-----AMRLVVAVVVAFALCWTPYHLVVLVDILMDLGaLARNCGRESRVDVAKSVTSGLGYMHCCLNPLLYAF 320
Cdd:cd15192  198 YEIQRNKprndeIFKMIMAVVLFFFFCWIPHQIFTFLDVLIQLK-VIQDCHIADIVDTAMPFTICIAYFNSCLNPILYGF 276

                 ....*....
gi 222537776 321 VGVKFRERM 329
Cdd:cd15192  277 VGKNFRKKF 285
7tmA_AT2R cd15191
type 2 angiotensin II receptor, member of the class A family of seven-transmembrane G ...
74-329 7.09e-44

type 2 angiotensin II receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; Angiotensin II (Ang II), the main effector in the renin-angiotensin system, plays a crucial role in the regulation of cardiovascular homeostasis through its type 1 (AT1) and type 2 (AT2) receptors. Ang II contributes to cardiovascular diseases such as hypertension and atherosclerosis via AT1R activation. Ang II increases blood pressure through Gq-mediated activation of phospholipase C, resulting in phosphoinositide (PI) hydrolysis and increased intracellular calcium levels. Through the AT2R, Ang II counteracts the vasoconstrictor action of AT1R and thereby induces vasodilation, sodium excretion, and reduction of blood pressure. Moreover, AT1R promotes cell proliferation, whereas AT2R inhibits proliferation and stimulates cell differentiation. The AT2R is highly expressed during fetal development, however it is scarcely present in adult tissues and is induced in pathological conditions. Generally, the AT1R mediates many actions of Ang II, while the AT2R is involved in the regulation of blood pressure and renal function.


Pssm-ID: 341341 [Multi-domain]  Cd Length: 285  Bit Score: 152.98  E-value: 7.09e-44
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776  74 VAAVLLSRRAALSSTDTFLLHLAVADTLLVLTLPLWAVDAAV--QWVFGSGLCKVAGALFNINFYAGALLLACISFDRYL 151
Cdd:cd15191   21 VVCVFCHQSGPKTVASIYIFNLAVADLLFLATLPLWATYYSYgyNWLFGSVMCKICGSLLTLNLFASIFFITCMSVDRYL 100
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 152 NIVHATQLYRRGpPARVTLTCLAVWGLCLLFALPDFIFLSAHHDERLNATHCQYNFPQVGR----TALRVLQLVAGFLLP 227
Cdd:cd15191  101 AVVYPLRSQRRR-SWQARLVCLLVWVLACLSSLPTFYFRDTYYIEELGVNACIMAFPNEKYaqwsAGLALMKNTLGFLIP 179
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 228 LLVMAYCYAHILAVLLVSRG-----QRRLRAMRLVVAVVVAFALCWTPYHLVVLVDILMDLGALArNCGRESRVDVAKSV 302
Cdd:cd15191  180 LIVIATCYFGIGRHLLKTKGfgknkQRRDKVLKMVAAVVLAFLICWFPFHVLTFLDALARMGVIN-NCWVITVIDKALPF 258
                        250       260
                 ....*....|....*....|....*..
gi 222537776 303 TSGLGYMHCCLNPLLYAFVGVKFRERM 329
Cdd:cd15191  259 AICLGFSNSCINPFLYCFVGNHFREKL 285
7tmA_BK-2 cd15381
bradykinin receptor B2, member of the class A family of seven-transmembrane G protein-coupled ...
74-328 1.55e-41

bradykinin receptor B2, member of the class A family of seven-transmembrane G protein-coupled receptors; The bradykinin receptor family is a group of the seven transmembrane G-protein coupled receptors, whose endogenous ligand is the pro-inflammatory nonapeptide bradykinin that mediates various vascular and pain responses. Two major bradykinin receptor subtypes, B1 and B2, have been identified based on their pharmacological properties. The B1 receptor is rapidly induced by tissue injury and inflammation, whereas the B2 receptor is ubiquitously expressed on many tissue types. Both receptors contain three consensus sites for N-linked glycosylation in extracellular domains and couple to G(q) protein to activate phospholipase C, leading to phosphoinositide hydrolysis and intracellular calcium mobilization. They can also interact with G(i) protein to inhibit adenylate cyclase and activate the MAPK (mitogen-activated protein kinase) pathways.


Pssm-ID: 320503 [Multi-domain]  Cd Length: 284  Bit Score: 146.84  E-value: 1.55e-41
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776  74 VAAVLLSRRAALSSTDTFLLHLAVADTLLVLTLPLWAVDAA--VQWVFGSGLCKVAGALFNINFYAGALLLACISFDRYL 151
Cdd:cd15381   21 VLIVFCLHKSSCTVAEIYLGNLAAADLLLVCCLPFWAINISngFNWPFGEFLCKSVNAVIYMNLYSSIYFLMMVSIDRYL 100
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 152 NIVHATQLYRRGPPARVTLTCLAVWGLCLLFALPDFIFLSAHHDERLNATHCQYNFPQVG-RTALRVLQLVAGFLLPLLV 230
Cdd:cd15381  101 ALVKTMSSGRMRRPACAKLNCLIIWMFGLLMSTPMIVFRTVMYFPEYNITACVLDYPSEGwHVALNILLNVVGFLIPLSI 180
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 231 MAYCYAHILAVLLVSRGQR------RLRAMRLVVAVVVAFALCWTPYHLVVLVDILMDLGALArNCGRESRVDVAKSVTS 304
Cdd:cd15381  181 ITFCSTQIIQVLRNNKMQKfkeiqtERKATVLVLAVLLMFFICWLPFHIFTFLDTLHKLGLIS-GCRWEDILDIGTQIAT 259
                        250       260
                 ....*....|....*....|....
gi 222537776 305 GLGYMHCCLNPLLYAFVGVKFRER 328
Cdd:cd15381  260 FLAYSNSCLNPLLYVIVGKHFRKK 283
7tmA_CCR8 cd15187
CC chemokine receptor type 8, member of the class A family of seven-transmembrane G ...
74-329 1.66e-41

CC chemokine receptor type 8, member of the class A family of seven-transmembrane G protein-coupled receptors; CCR8, the receptor for the CC chemokines CCL1 and CC16, is highly expressed on allergen-specific T-helper type 2 cells, and is implicated in the pathogenesis of human asthma. CCL1- and CCR8-expressing CD4+ effector T lymphocytes are shown to have a critical role in lung mucosal inflammatory responses. CCR8 is also a functional receptor for CCL16, a liver-expressed CC chemokine that involved in attracting lymphocytes, dendritic cells, and monocytes. Chemokines are principal regulators for leukocyte trafficking, recruitment, and activation. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling. Currently, there are ten known receptors for CC chemokines, seven for CXC chemokines, and single receptors for the XC and CX3C chemokines.


Pssm-ID: 320315 [Multi-domain]  Cd Length: 276  Bit Score: 146.48  E-value: 1.66e-41
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776  74 VAAVLLSRRAALSSTDTFLLHLAVADTLLVLTLPLWAVDAAVQWVFGSGLCKVAGALFNINFYAGALLLACISFDRYLNI 153
Cdd:cd15187   21 VIWVLVACKKLRSMTDVYLLNLAASDLLFVFSLPFQAYYLLDQWVFGNAMCKIVSGAYYIGFYSSMFFITLMSIDRYLAI 100
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 154 VHATQLYRRGPPARVTLTCLAVWGLCLLFALPDFIFLSAHHDErlNATHCQYNFPQVGRTALRVLQL---VAGFLLPLLV 230
Cdd:cd15187  101 VHAVYALKVRTASHGTILSLALWLVAILASVPLLVFYQVASED--GRLQCIPFYPGQGNSWKVFTNFevnILGLLIPFSI 178
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 231 MAYCYAHILAVLLVSRGQRRLRAMRLVVAVVVAFALCWTPYHLVVLVDILMDLGALaRNCGRESRVDVAKSVTSGLGYMH 310
Cdd:cd15187  179 LIFCYHNILRNLRRCHNQNKTKAIKLVFIVVIVFFLFWTPFNVVLFLDSLHSLHII-DGCQNSQRLTLALHLTETISFTH 257
                        250
                 ....*....|....*....
gi 222537776 311 CCLNPLLYAFVGVKFRERM 329
Cdd:cd15187  258 CCLNPVIYAFVGEKFKKHL 276
7tmA_CCR3 cd15185
CC chemokine receptor type 3, member of the class A family of seven-transmembrane G ...
55-329 5.17e-41

CC chemokine receptor type 3, member of the class A family of seven-transmembrane G protein-coupled receptors; CCR3 is a highly promiscuous receptor that binds a variety of inflammatory CC-type chemokines, including CCL11 (eotaxin-1), CCL3L1, CCL5 (regulated on activation, normal T cell expressed and secreted; RANTES), CCL7 (monocyte-specific chemokine 3 or MCP-3), CCL8 (MCP-2), CCL11, CCL13 (MCP-4), CCL15, CCL24 (eotaxin-2), CCL26 (eotaxin-3), and CCL28. Among these, the eosinophil chemotactic chemokines (CCL11, CCL24, and CCL26) are the most potent and specific ligands. In addition to eosinophil, CCR3 is expressed on cells involved in allergic responses, such as basophils, Th2 lymphocytes, and mast cells. Chemokines are principal regulators for leukocyte trafficking, recruitment, and activation. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling. Currently, there are ten known receptors for CC chemokines, seven for CXC chemokines, and single receptors for the XC and CX3C chemokines.


Pssm-ID: 341339  Cd Length: 278  Bit Score: 145.36  E-value: 5.17e-41
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776  55 FLPALYSLLFLLGLLGNGAVAAVLLSRRAALSSTDTFLLHLAVADTLLVLTLPLWA-VDAAVQWVFGSGLCKVAGALFNI 133
Cdd:cd15185    2 FLPPLYSLVFIVGLLGNVVVVVILIKYRRLRIMTNIYLLNLAISDLLFLFTLPFWIhYVRWNNWVFGHGMCKLLSGFYYL 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 134 NFYAGALLLACISFDRYLNIVHATQLYRRGPPARVTLTCLAVWGLCLLFALPDFIFLSAHhdERLNATHCQYNFPQVGRT 213
Cdd:cd15185   82 GLYSEIFFIILLTIDRYLAIVHAVFALRARTVTFGIITSIITWGLAVLAALPEFIFYETQ--ELFEEFLCSPLYPEDTED 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 214 ALRVLQL----VAGFLLPLLVMAYCYAHILAVLLVSRGQRRLRAMRLVVAVVVAFALCWTPYHLVVLVDILmDLGALARN 289
Cdd:cd15185  160 SWKRFHAlrmnIFGLALPLLIMVICYTGIIKTLLRCPSKKKYKAIRLIFVIMVVFFIFWTPYNLVLLLSAF-QSIFFETD 238
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|
gi 222537776 290 CGRESRVDVAKSVTSGLGYMHCCLNPLLYAFVGVKFRERM 329
Cdd:cd15185  239 CERSKHLDLAMQVTEVIAYTHCCINPVIYAFVGERFRKYL 278
7tmA_Bradykinin_R cd15189
bradykinin receptors, member of the class A family of seven-transmembrane G protein-coupled ...
74-328 6.18e-41

bradykinin receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; The bradykinin receptor family is a group of the seven transmembrane G-protein coupled receptors, whose endogenous ligand is the pro-inflammatory nonapeptide bradykinin that mediates various vascular and pain responses. Two major bradykinin receptor subtypes, B1 and B2, have been identified based on their pharmacological properties. The B1 receptor is rapidly induced by tissue injury and inflammation, whereas the B2 receptor is ubiquitously expressed on many tissue types. Both receptors contain three consensus sites for N-linked glycosylation in extracellular domains and couple to G(q) protein to activate phospholipase C, leading to phosphoinositide hydrolysis and intracellular calcium mobilization. They can also interact with G(i) protein to inhibit adenylate cyclase and activate the MAPK (mitogen-activated protein kinase) pathways.


Pssm-ID: 320317  Cd Length: 284  Bit Score: 145.30  E-value: 6.18e-41
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776  74 VAAVLLSRRAALSSTDTFLLHLAVADTLLVLTLPLWAVDAAVQ--WVFGSGLCKVAGALFNINFYAGALLLACISFDRYL 151
Cdd:cd15189   21 VLLVFLLHRRRLTVAEIYLGNLAAADLVFVSGLPFWAMNILNQfnWPFGELLCRVVNGVIKVNLYTSIYLLVMISQDRYL 100
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 152 NIVHATQLYRRGPPARVTLTCLAVWGLCLLFALPDFIFLSAHHDERLNATHCQYNFPQVGRTALRVLQL-VAGFLLPLLV 230
Cdd:cd15189  101 ALVKTMAARRLRRRRYAKLICVLIWVVGLLLSIPTFLLRKIKAIPDLNITACVLLYPHEAWHFAHIVLLnIVGFLLPLLV 180
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 231 MAYCYAHILAVLLVSRGQRRL------RAMRLVVAVVVAFALCWTPYHLVVLVDILMDLGALaRNCGRESRVDVAKSVTS 304
Cdd:cd15189  181 ITFCNYNILQALRTREESTRCedrndsKATALVLAVTLLFLVCWGPYHFFTFLDFLFDVGVL-DECFWEHFIDIGLQLAV 259
                        250       260
                 ....*....|....*....|....
gi 222537776 305 GLGYMHCCLNPLLYAFVGVKFRER 328
Cdd:cd15189  260 FLAFSNSCLNPVLYVFVGRYFRRK 283
7tmA_Anaphylatoxin_R-like cd14974
anaphylatoxin receptors and related G protein-coupled chemokine receptors, member of the class ...
88-328 8.12e-41

anaphylatoxin receptors and related G protein-coupled chemokine receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; This subfamily of G-protein coupled receptors includes anaphylatoxin receptors, formyl peptide receptors (FPR), prostaglandin D2 receptor 2, GPR1, and related chemokine receptors. The anaphylatoxin receptors are a group of G-protein coupled receptors that bind anaphylatoxins. The members of this group include C3a and C5a receptors. The formyl peptide receptors (FPRs) are chemoattractant GPCRs that involved in mediating immune responses to infection. They are expressed mainly on polymorphonuclear and mononuclear phagocytes and bind N-formyl-methionyl peptides (FMLP), which are derived from the mitochondrial proteins of ruptured host cells or invading pathogens. Chemokine receptor-like 1 (also known as chemerin receptor 23) is a GPCR for the chemoattractant adipokine chemerin, also known as retinoic acid receptor responder protein 2 (RARRES2), and for the omega-3 fatty acid derived molecule resolvin E1. Interaction with chemerin induces activation of the MAPK and PI3K signaling pathways leading to downstream functional effects, such as a decrease in immune responses, stimulation of adipogenesis, and angiogenesis. On the other hand, resolvin E1 negatively regulates the cytokine production in macrophages by reducing the activation of MAPK1/3 and NF-kB pathways. Prostaglandin D2 receptor, also known as CRTH2, is a chemoattractant G-protein coupled receptor expressed on T helper type 2 cells that binds prostaglandin D2 (PGD2). PGD2 functions as a mast cell-derived mediator to trigger asthmatic responses and also causes vasodilation. PGD2 exerts its inflammatory effects by binding to two G-protein coupled receptors, the D-type prostanoid receptor (DP) and PD2R2 (CRTH2). PD2R2 couples to the G protein G(i/o) type which leads to a reduction in intracellular cAMP levels and an increase in intracellular calcium. GPR1 is an orphan receptor that can be activated by the leukocyte chemoattractant chemerin, thereby suggesting that some of the anti-inflammatory actions of chemerin may be mediated through GPR1.


Pssm-ID: 320105 [Multi-domain]  Cd Length: 274  Bit Score: 144.75  E-value: 8.12e-41
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776  88 TDTFLLHLAVADTLLVLTLPLWAVDAAV--QWVFGSGLCKVAGALFNINFYAGALLLACISFDRYLNIVHA--TQLYRRg 163
Cdd:cd14974   34 NTVWFLNLALADFLFCLFLPFLIVYIAMghHWPFGSVLCKLNSFVISLNMFASVFLLTAISLDRCLLVLHPvwAQNHRT- 112
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 164 pPARVTLTCLAVWGLCLLFALPDFIFLSAHHDE---RLNATHCQ-YNFPQVGRTALRVLQLVAGFLLPLLVMAYCYAHIL 239
Cdd:cd14974  113 -VRLASVVCVGIWILALVLSVPYFVFRDTVTHHngrSCNLTCVEdYDLRRSRHKALTVIRFLCGFLLPLLIIAICYSVIA 191
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 240 AVLLVSRGQRRLRAMRLVVAVVVAFALCWTPYHLVVLVDILMDLGALArncgresRVDVAKSVTSGLGYMHCCLNPLLYA 319
Cdd:cd14974  192 VKLRRKRLAKSSKPLRVLLAVVVAFFLCWLPYHVFALLELVAAAGLPE-------VVLLGLPLATGLAYFNSCLNPILYV 264

                 ....*....
gi 222537776 320 FVGVKFRER 328
Cdd:cd14974  265 FMGQDFRKR 273
7tmA_CCR1 cd15183
CC chemokine receptor type 1, member of the class A family of seven-transmembrane G ...
74-327 7.82e-40

CC chemokine receptor type 1, member of the class A family of seven-transmembrane G protein-coupled receptors; CCR1 is widely expressed on both hematopoietic and non-hematopoietic cells and binds to the inflammatory CC chemokines CCL3, CCL5, CCL6, CCL9, CCL15, and CCL23. CCR1 activates the typical chemokine signaling pathway through the G(i/o) type of G proteins, causing inhibition of adenylate cyclase and stimulation of phospholipase C, PKC, calcium flux, and PLA2. Chemokines are principal regulators for leukocyte trafficking, recruitment, and activation. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling. Currently, there are ten known receptors for CC chemokines, seven for CXC chemokines, and single receptors for the XC and CX3C chemokines.


Pssm-ID: 320311  Cd Length: 278  Bit Score: 142.32  E-value: 7.82e-40
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776  74 VAAVLLSRRAALSSTDTFLLHLAVADTLLVLTLPLWaVDAAVQ--WVFGSGLCKVAGALFNINFYAGALLLACISFDRYL 151
Cdd:cd15183   21 VVLVLIQHKRLRNMTSIYLFNLAISDLVFLFTLPFW-IDYKLKddWIFGDAMCKFLSGFYYLGLYSEIFFIILLTIDRYL 99
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 152 NIVHATQLYRRGPPARVTLTCLAVWGLCLLFALPDFIFLSAhhdeRLNATH--CQYNFPQVGRTALRVLQLVA----GFL 225
Cdd:cd15183  100 AIVHAVFALRARTVTFGIITSIITWALAILASMPCLYFFKS----QWEFTHhtCSAHFPRKSLIRWKRFQALKlnllGLI 175
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 226 LPLLVMAYCYAHILAVLLVSRGQRRLRAMRLVVAVVVAFALCWTPYHLVVLVDILMDLgALARNCGRESRVDVAKSVTSG 305
Cdd:cd15183  176 LPLLVMIICYTGIINILLRRPNEKKAKAVRLIFVITLLFFLLWTPYNLAAFVSAFQDV-LFTPSCEQSQQLDLALQVTEV 254
                        250       260
                 ....*....|....*....|..
gi 222537776 306 LGYMHCCLNPLLYAFVGVKFRE 327
Cdd:cd15183  255 IAYTHCCVNPVIYVFVGERFRK 276
7tm_classA_rhodopsin-like cd00637
rhodopsin receptor-like class A family of the seven-transmembrane G protein-coupled receptor ...
74-320 5.69e-39

rhodopsin receptor-like class A family of the seven-transmembrane G protein-coupled receptor superfamily; Class A rhodopsin-like receptors constitute about 90% of all GPCRs. The class A GPCRs include the light-sensitive rhodopsin as well as receptors for biogenic amines, lipids, nucleotides, odorants, peptide hormones, and a variety of other ligands. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes. Based on sequence similarity, GPCRs can be divided into six major classes: class A (rhodopsin-like family), class B (Methuselah-like, adhesion and secretin-like receptor family), class C (metabotropic glutamate receptor family), class D (fungal mating pheromone receptors), class E (cAMP receptor family), and class F (frizzled/smoothened receptor family). Nearly 800 human GPCR genes have been identified and are involved essentially in all major physiological processes. Approximately 40% of clinically marketed drugs mediate their effects through modulation of GPCR function for the treatment of a variety of human diseases including bacterial infections.


Pssm-ID: 410626 [Multi-domain]  Cd Length: 275  Bit Score: 139.73  E-value: 5.69e-39
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776  74 VAAVLLSRRAALSSTDTFLLHLAVADTL-LVLTLPLWAVDAAVQ-WVFGSGLCKVAGALFNINFYAGALLLACISFDRYL 151
Cdd:cd00637   19 VILVILRNRRLRTVTNYFILNLAVADLLvGLLVIPFSLVSLLLGrWWFGDALCKLLGFLQSVSLLASILTLTAISVDRYL 98
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 152 NIVHATQLYRRGPPARVTLTCLAVWGLCLLFALPDFIFLSaHHDERLNATHCQYNFPQVGRTALRVLQLVAGFLLPLLVM 231
Cdd:cd00637   99 AIVHPLRYRRRFTRRRAKLLIALIWLLSLLLALPPLLGWG-VYDYGGYCCCCLCWPDLTLSKAYTIFLFVLLFLLPLLVI 177
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 232 AYCYAHILAVLLVSRG---------------QRRLRAMRLVVAVVVAFALCWTPYHLVVLVDILMDLGALArncgresrV 296
Cdd:cd00637  178 IVCYVRIFRKLRRHRRrirssssnssrrrrrRRERKVTKTLLIVVVVFLLCWLPYFILLLLDVFGPDPSPL--------P 249
                        250       260
                 ....*....|....*....|....
gi 222537776 297 DVAKSVTSGLGYMHCCLNPLLYAF 320
Cdd:cd00637  250 RILYFLALLLAYLNSAINPIIYAF 273
7tmA_Opioid_R-like cd14970
opioid receptors and related proteins, member of the class A family of seven-transmembrane G ...
88-328 1.29e-38

opioid receptors and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes opioid receptors, somatostatin receptors, melanin-concentrating hormone receptors (MCHRs), and neuropeptides B/W receptors. Together they constitute the opioid receptor-like family, members of the class A G-protein coupled receptors. Opioid receptors are coupled to inhibitory G proteins of the G(i/o) family and are involved in regulating a variety of physiological functions such as pain, addiction, mood, stress, epileptic seizure, and obesity, among many others. G protein-coupled somatostatin receptors (SSTRs), which display strong sequence similarity with opioid receptors, binds somatostatin (somatotropin release inhibiting factor), a polypeptide hormone that regulates a wide variety of physiological functions such as neurotransmission, cell proliferation, contractility of smooth muscle cells, and endocrine signaling as well as inhibition of the release of many secondary hormones. MCHR binds melanin concentrating hormone and is presumably involved in the neuronal regulation of food intake. Despite strong homology with somatostatin receptors, MCHR does not appear to bind somatostatin. Neuropeptides B/W receptors are primarily expressed in the CNS and stimulate the cortisol secretion by activating the adenylate cyclase- and the phospholipase C-dependent signaling pathways.


Pssm-ID: 320101 [Multi-domain]  Cd Length: 282  Bit Score: 138.97  E-value: 1.29e-38
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776  88 TDTFLLHLAVADTLLVLTLPLWAVDAAVQ-WVFGSGLCKVAGALFNINFYAGALLLACISFDRYLNIVHATQLYRRGPPA 166
Cdd:cd14970   35 TNIYILNLAVADELFLLGLPFLATSYLLGyWPFGEVMCKIVLSVDAYNMFTSIFCLTVMSVDRYLAVVHPVKSLRFRTPR 114
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 167 RVTLTCLAVWGLCLLFALPDFIFLSAhHDERLNATHCQYNFP---QVGRTALRVLQLVAGFLLPLLVMAYCYAHIL---- 239
Cdd:cd14970  115 KAKLVSLCVWALSLVLGLPVIIFART-LQEEGGTISCNLQWPdppDYWGRVFTIYTFVLGFAVPLLVITVCYSLIIrrlr 193
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 240 -AVLLVSRGQRRLRAM-----RLVVAVVVAFALCWTPYHLVVLVDILMDLgalarncgRESRVDVAKS-VTSGLGYMHCC 312
Cdd:cd14970  194 sSRNLSTSGAREKRRArrkvtRLVLVVVAVFVVCWLPFHVFQIVRLLIDP--------PETLTVVGVFlFCIALSYANSC 265
                        250
                 ....*....|....*.
gi 222537776 313 LNPLLYAFVGVKFRER 328
Cdd:cd14970  266 LNPILYAFLDENFRKS 281
7tmA_GPR25 cd15193
G protein-coupled receptor 25, member of the class A family of seven-transmembrane G ...
74-328 6.36e-38

G protein-coupled receptor 25, member of the class A family of seven-transmembrane G protein-coupled receptors; GPR25 is an orphan G-protein coupled receptor that shares strong sequence homology to GPR15 and the angiotensin II receptors. These closely related receptors form a group within the class A G-protein coupled receptors (GPCRs). GPR15 controls homing of T cells, especially FOXP3(+) regulatory T cells, to the large intestine mucosa and thereby mediates local immune homeostasis. Moreover, GRP15-deficient mice were shown to be prone to develop more severe large intestine inflammation. Angiotensin II (Ang II), the main effector in the renin-angiotensin system, plays a crucial role in the regulation of cardiovascular homeostasis through its type 1 (AT1) and type 2 (AT2) receptors.


Pssm-ID: 320321 [Multi-domain]  Cd Length: 279  Bit Score: 137.19  E-value: 6.36e-38
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776  74 VAAVLLSRRAALSSTDTFLLHLAVADTLLVLTLPLWAVDAAV--QWVFGSGLCKVAGALFNINFYAGALLLACISFDRYL 151
Cdd:cd15193   21 VIALMSKRSTTKRLVDTFVLNLAVADLVFVLTLPFWAASTALggQWLFGEGLCKLSSFIIAVNRCSSILFLTGMSVDRYL 100
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 152 NIVHATQLYRRGPPARVTLTCLAVWGLCLLFALPDFIFlsahhDERLNATHCQYNFPQVGRTALRVLQLVAGFLLPLLVM 231
Cdd:cd15193  101 AVVKLLDSRPLRTRRCALITCCIIWAVSLVLGIPSLVY-----RNLINESVCVEDSSSRFFQGISLATLFLTFVLPLIVI 175
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 232 AYCYAHILAVL------LVSRGQRRLRAMRLVVAVVVAFALCWTPYHLVVLVDILMDLGALARNCGRESRVDVAKSVTSG 305
Cdd:cd15193  176 LFCYCSILVRLrrhfhgAKRTGRRRRNSLRIVFAIVTAFVLSWLPFNTLKAVRLLLELGGGVLPCHTTVAIRQGLTITAC 255
                        250       260
                 ....*....|....*....|...
gi 222537776 306 LGYMHCCLNPLLYAFVGVKFRER 328
Cdd:cd15193  256 LAFVNSCVNPLIYSLLDRHFRRR 278
7tmA_BK-1 cd15380
bradykinin receptor B1, member of the class A family of seven-transmembrane G protein-coupled ...
78-328 1.62e-37

bradykinin receptor B1, member of the class A family of seven-transmembrane G protein-coupled receptors; The bradykinin receptor family is a group of the seven transmembrane G-protein coupled receptors, whose endogenous ligand is the pro-inflammatory nonapeptide bradykinin that mediates various vascular and pain responses. Two major bradykinin receptor subtypes, B1 and B2, have been identified based on their pharmacological properties. The B1 receptor is rapidly induced by tissue injury and inflammation, whereas the B2 receptor is ubiquitously expressed on many tissue types. Both receptors contain three consensus sites for N-linked glycosylation in extracellular domains and couple to G(q) protein to activate phospholipase C, leading to phosphoinositide hydrolysis and intracellular calcium mobilization. They can also interact with G(i) protein to inhibit adenylate cyclase and activate the MAPK (mitogen-activated protein kinase) pathways.


Pssm-ID: 320502  Cd Length: 286  Bit Score: 136.47  E-value: 1.62e-37
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776  78 LLSRRAaLSSTDTFLLHLAVADTLLVLTLPLWAVDAAVQ--WVFGSGLCKVAGALFNINFYAGALLLACISFDRYLNIVH 155
Cdd:cd15380   26 LLPRRR-LTIAEIYLANLAASDLVFVLGLPFWAENIRNQfnWPFGNFLCRVISGVIKANLFISIFLVVAISQDRYRTLVH 104
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 156 --ATQLYRRGPPARVtlTCLAVWGLCLLFALPDFIFLSAHHDERLNATHCQYNFPQVGRTALRVLQL-VAGFLLPLLVMA 232
Cdd:cd15380  105 tmTSRRQRSRRQAQV--ICLLIWVFGGLLSIPTFLFRSVKHVPDLNISACILLFPHEAWHFARRVELnIVGFLLPLAAIV 182
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 233 YCYAHILAVLL----VSR----GQRRLRAMRLVVAVVVAFALCWTPYHLVVLVDILMDLGALaRNCGRESRVDVAKSVTS 304
Cdd:cd15380  183 FFNFHIIASLRerteESRkrcgGLKDTKATRLILTLVLMFLVCWTPYHFFAFLDFLFQVEVI-QGCFWEEFIDLGLQLAN 261
                        250       260
                 ....*....|....*....|....
gi 222537776 305 GLGYMHCCLNPLLYAFVGVKFRER 328
Cdd:cd15380  262 FFAFANSCLNPVIYVFAGKLFRTK 285
7tmA_P2Y1-like cd15168
P2Y purinoceptors 1, 2, 4, 6, 11 and similar proteins, member of the class A family of ...
81-328 1.85e-37

P2Y purinoceptors 1, 2, 4, 6, 11 and similar proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; The P2Y receptor family is composed of eight subtypes, which are activated by naturally occurring extracellular nucleotides such as ATP, ADP, UTP, UDP, and UDP-glucose. These eight receptors are ubiquitous in human tissues and can be further classified into two subfamilies based on sequence homology and second messenger coupling: a subfamily of five P2Y1-like receptors (P2Y1, P2Y2, P2Y4, P2Y6, and P2Y11Rs) that are coupled to G(q) protein to activate phospholipase C (PLC) and a second subfamily of three P2Y12-like receptors (P2Y12, P2YR13, and P2Y14Rs) that are coupled to G(i) protein to inhibit adenylate cyclase. Several cloned subtypes, such as P2Y3, P2Y5, and P2Y7-10, are not functional mammalian nucleotide receptors. The native agonists for P2Y receptors are: ATP (P2Y2, P2Y12), ADP (P2Y1, P2Y12, and P2Y13), UTP (P2Y2, P2Y4), UDP (P2Y6, P2Y14), and UDP-glucose (P2Y14). This cluster only includes P2Y1-like receptors as well as other closely related orphan receptors, such as GPR91 (a succinate receptor) and GPR80/GPR99 (an alpha-ketoglutarate receptor).


Pssm-ID: 341329 [Multi-domain]  Cd Length: 284  Bit Score: 136.29  E-value: 1.85e-37
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776  81 RRAALSSTDTFLLHLAVADTLLVLTLPLWAVDAAV--QWVFGSGLCKVAGALFNINFYAGALLLACISFDRYLNIVHATQ 158
Cdd:cd15168   28 HLKPWNSSAIYMFNLAVSDLLYLLSLPFLIYYYANgdHWIFGDFMCKLVRFLFYFNLYGSILFLTCISVHRYLGICHPLR 107
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 159 LYRRGPPARVTLTCLAVWGLCLLFALPDFIFlsAHHDERLNATHCqYNFPQVGRTALRVLQ----LVAGFLLPLLVMAYC 234
Cdd:cd15168  108 SLGKLKKRHAVAISVAVWILVLLQLLPILFF--ATTGRKNNRTTC-YDTTSPEELNDYVIYsmvlTGLGFLLPLLIILAC 184
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 235 YAHILAVLLVSRGQ-----RRLRAMRLVVAVVVAFALCWTPYHLVVLVDILMDLGALARNCGRESRVDVAKSVTSGLGYM 309
Cdd:cd15168  185 YGLIVRALIRKLGEgvtsaLRRKSIRLVIIVLALFAVCFLPFHVTRTINLAARLLSGTASCATLNGIYVAYKVTRPLASL 264
                        250
                 ....*....|....*....
gi 222537776 310 HCCLNPLLYAFVGVKFRER 328
Cdd:cd15168  265 NSCLNPLLYFLAGDKFRRR 283
7tmA_C5aR cd15114
complement component 5a anaphylatoxin chemotactic receptors, member of the class A family of ...
90-329 1.97e-37

complement component 5a anaphylatoxin chemotactic receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; The anaphylatoxin receptors are a group of G-protein coupled receptors which bind anaphylatoxins; members of this group include C3a receptors and C5a receptors. Anaphylatoxins are also known as complement peptides (C3a, C4a and C5a) that are produced from the activation of the complement system cascade. These complement anaphylatoxins can trigger degranulation of endothelial cells, mast cells, or phagocytes, which induce a local inflammatory response and stimulate smooth muscle cell contraction, histamine release, and increased vascular permeability. They are potent mediators involved in chemotaxis, inflammation, and generation of cytotoxic oxygen-derived free radicals. In humans, a single receptor for C3a (C3AR1) and two receptors for C5a (C5AR1 and C5AR2, also known as C5L2 or GPR77) have been identified, but there is no known receptor for C4a.


Pssm-ID: 320242 [Multi-domain]  Cd Length: 274  Bit Score: 135.61  E-value: 1.97e-37
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776  90 TFLLHLAVADTLLVLTLPLWAVDAAV--QWVFGSGLCKVAGALFNINFYAGALLLACISFDRYLNIVHAT--QLYRRGPP 165
Cdd:cd15114   36 VWFLNLAVADLLCCLSLPILAVPIAQdgHWPFGAAACKLLPSLILLNMYASVLLLTAISADRCLLVLRPVwcQNHRRARL 115
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 166 ARVTltCLAVWGLCLLFALPDFIFLSAHHDERLNATHCQYNFPQVGRTALRV--LQLVAGFLLPLLVMAYCYAHILAVLL 243
Cdd:cd15114  116 AWIA--CGAAWLLALLLTVPSFIYRRIHQEHFPEKTVCVVDYGGSTGVEWAVaiIRFLLGFLGPLVVIASCHGVLLVRTW 193
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 244 VSRGQRRLRAMRLVVAVVVAFALCWTPYHLVVLVdilmdLGALARNCGRESRVDVAKSVTSGLGYMHCCLNPLLYAFVGV 323
Cdd:cd15114  194 SRRRQKSRRTLKVVTAVVVGFFLCWTPYHVVGLI-----IAASAPNSRLLANALKADPLTVSLAYINSCLNPIIYVVAGR 268

                 ....*.
gi 222537776 324 KFRERM 329
Cdd:cd15114  269 GFRKSL 274
PHA03087 PHA03087
G protein-coupled chemokine receptor-like protein; Provisional
74-329 2.42e-37

G protein-coupled chemokine receptor-like protein; Provisional


Pssm-ID: 222976 [Multi-domain]  Cd Length: 335  Bit Score: 137.22  E-value: 2.42e-37
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776  74 VAAVLLSRRAALSSTDTFLLHLAVADTLLVLTLPLWAVDA-AVQWVFGSGLCKVAGALFNINFYAGALLLACISFDRYLN 152
Cdd:PHA03087  60 IVIYVLTKTKIKTPMDIYLLNLAVSDLLFVMTLPFQIYYYiLFQWSFGEFACKIVSGLYYIGFYNSMNFITVMSVDRYIA 139
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 153 IVHATQLYRRGPPARVTLTCLAVWGLCLLFALPDFIFLSAHHDERLNATHCQYNF-PQVGRTALRVLQLVAGFLLPLLVM 231
Cdd:PHA03087 140 IVHPVKSNKINTVKYGYIVSLVIWIISIIETTPILFVYTTKKDHETLICCMFYNNkTMNWKLFINFEINIIGMLIPLTIL 219
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 232 AYCYAHILAVL-LVSRGQRRLRAMRLVVAVVVAFALCWTPYHLVVLVDILMDLGALArNCGRESRVDVAKSVTSGLGYMH 310
Cdd:PHA03087 220 LYCYSKILITLkGINKSKKNKKAIKLVLIIVILFVIFWLPFNVSVFVYSLHILHFKS-GCKAVKYIQYALHVTEIISLSH 298
                        250
                 ....*....|....*....
gi 222537776 311 CCLNPLLYAFVGVKFRERM 329
Cdd:PHA03087 299 CCINPLIYAFVSEFFNKHK 317
7tmA_ACKR3_CXCR7 cd14987
CXC chemokine receptor 7, member of the class A family of seven-transmembrane G ...
88-329 3.07e-37

CXC chemokine receptor 7, member of the class A family of seven-transmembrane G protein-coupled receptors; ACKR3, also known as CXCR7, is an atypical chemokine receptor for CXCL12 and CXCR11. Unlike the classical chemokine receptors, ACKR3 contains a DRYLSIT-sequence instead of the conserved DRYLAIV motif in the second intracellular loop, which is required for G-protein coupling. Thus, ACKR3 does not activate classical GPCR signaling, instead induces beta-arrestin recruitment which is leading to ligand internalization and MAP-kinase activation. It is acting as a scavenger for CXCL12 and, to a lesser degree, for CXCL11. ACKR3 is highly expressed by blood vascular endothelial cells in brain, in numerous embryonic and neonatal tissues, in inflamed tissues and in a variety of cancers such as lymphomas, sarcomas, prostate and breast cancers, and gliomas. Five receptors have been identified for the ACKR family, including CC-Chemokine Receptors like 1 and 2 (CCRL1 and CCRL2), CXCR7, DARC, and D6. Both ACKR1 (DARC) and ACKR3 (CXCR7) show low sequence homology to the classic chemokine receptors.


Pssm-ID: 320118 [Multi-domain]  Cd Length: 282  Bit Score: 135.66  E-value: 3.07e-37
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776  88 TDTFLLHLAVADTLLVLTLPLWAVDAAV--QWVFGSGLCKVAGALFNINFYAGALLLACISFDRYLNIVHATQLYRRGPP 165
Cdd:cd14987   35 THLYILNLAIADLCVVATLPVWVVSLVQhnQWPMGEFTCKITHLIFSINLFGSIFFLTCMSVDRYLSVTLFGNTSSRRKK 114
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 166 ARVTLTCLAVWGLCLLFALPDFIFLSAHHDERLNATHCQYNFPQVG----RTALRVLQLVAGFLLPLLVMAYCYAHILAV 241
Cdd:cd14987  115 IVRRIICVLVWLLAFVASLPDTYFLKTVTSPSNNETYCRSFYPEESfkewLIGMELVSIVLGFVIPFPIIAVFYFLLARA 194
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 242 LLVSRGQRRLRAMRLVVAVVVAFALCWTPYHLVVLVDILMDLGALARNCGRESRVDVAKSVTSGLGYMHCCLNPLLYAFV 321
Cdd:cd14987  195 ISASSDQERKSSRKIIFSYVVVFLVCWLPYHTVVLLDILSFLHLIPFSCQLENFLYAALHVTQCFSLVHCCVNPILYSFI 274

                 ....*...
gi 222537776 322 GVKFRERM 329
Cdd:cd14987  275 NRNYRYEL 282
7tmA_RNL3R cd14976
relaxin-3 like peptide receptors, member of the class A family of seven-transmembrane G ...
81-327 7.61e-34

relaxin-3 like peptide receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; This G protein-coupled receptor subfamily is composed of the relaxin-3 like peptide receptors, RNL3R1 and RNL3R2, and similar proteins. The relaxin-3 like peptide family includes relaxin-1, -2, -3, as well as insulin-like (INSL) peptides 3 to 6. RNL3/relaxin-3 and INSL5 are the endogenous ligands for RNL3R1 and RNL3R2, respectively. RNL3R1, also called GPCR135 or RXFP3, is predominantly expressed in the brain and is implicated in stress, anxiety, feeding, and metabolism. Insulin-like peptide 5 (INSL5), the endogenous ligand for RNL3R2 (also called GPCR142 or RXFP4), plays a role in fat and glucose metabolism. INSL5 is highly expressed in human rectal and colon tissues. Both RNL3R1 and RNL3R2 signal through G(i) protein and inhibit adenylate cyclase, thereby inhibit cAMP accumulation. RNL3R1 is shown to activate Erk1/2 signaling pathway.


Pssm-ID: 320107 [Multi-domain]  Cd Length: 290  Bit Score: 126.85  E-value: 7.61e-34
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776  81 RRAALSSTDTFLLHLAVADTLLVLTLPLWAVDAAVQ--WVFGSGLCKVAGALFNINFYAGALLLACISFDRYLNIVHATQ 158
Cdd:cd14976   30 KLRQQSESNKFVFNLALTDLIFVLTLPFWAVEYALDfvWPFGTAMCKVVRYVTKLNMYSSIFFLTALSVTRYIAVARALK 109
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 159 LYRRGPPARVTLTCLAVWGLCLLFALPDFIFlSAHHDERLNATHCQYNFP-----QVGRTALRVLQL---VAGFLLPLLV 230
Cdd:cd14976  110 HGWIRKAFGAFATTIAIWAAAALAAIPEAIF-STDTWSSVNHTLCLLRFPknssvTRWYNWLGMYQLqkvVLGFFLPLGI 188
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 231 MAYCYAHILAVL---LVSRGQRRLRAMRLVVAVVVAFALCWTPYHLVVLVDILMDLGALARNCGRESRVDVAKSVTSGLG 307
Cdd:cd14976  189 ITLSYLLLLRFLqrkRGGSKRRKSRVTKSVFIVVLSFFICWLPNQALSLWSALIKFDDVPFSDAFFAFQTYAFPVAICLA 268
                        250       260
                 ....*....|....*....|
gi 222537776 308 YMHCCLNPLLYAFVGVKFRE 327
Cdd:cd14976  269 HSNSCLNPVLYCLVRREFRD 288
7tmA_FPR-like cd15117
N-formyl peptide receptors, member of the class A family of seven-transmembrane G ...
82-329 3.52e-33

N-formyl peptide receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; The formyl peptide receptors (FPRs) are chemoattractant GPCRs that involved in mediating immune responses to infection. They are expressed at elevated levels on polymorphonuclear and mononuclear phagocytes. FPRs bind N-formyl peptides, which are derived from the mitochondrial proteins of ruptured host cells or invading pathogens. Activation of FPRs by N-formyl peptides such as N-formyl-Met-Leu-Phe (FMLP) triggers a signaling cascade that stimulates neutrophil accumulation, phagocytosis and superoxide production. These responses are mediated through a pertussis toxin-sensitive G(i) protein that activates a PLC-IP3-calcium signaling pathway. While FPRs are involved in host defense responses to bacterial infection, they can also suppress the immune system under certain conditions. Yet, the physiological role of the FPR family is not fully understood.


Pssm-ID: 320245  Cd Length: 288  Bit Score: 124.85  E-value: 3.52e-33
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776  82 RAALSSTDTFLLHLAVADTLLVLTLPLWAVDAAV--QWVFGSGLCKVAGALFNINFYAGALLLACISFDRYLNIVHATQL 159
Cdd:cd15117   28 RMTRTVTTVCFLNLAVADFAFCLFLPFSVVYTALgfHWPFGWFLCKLYSTLVVFNLFASVFLLTLISLDRCVSVLWPVWA 107
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 160 YRRGPPARVTLTCLAVWGLCLLFALPDFIFLSAHHDERLnaTHCQYNFPQVGRT----------------ALRVLQLVAG 223
Cdd:cd15117  108 RNHRTPARAALVAVGAWLLALALSGPHLVFRDTRKENGC--THCYLNFDPWNETaedpvlwletvvqrlsAQVITRFVLG 185
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 224 FLLPLLVMAYCYAHILAVLLVSRGQRRLRAMRLVVAVVVAFALCWTPYHLVVLVDILMdlgALARNCGRESRVDVAKSVT 303
Cdd:cd15117  186 FLVPLVIIGGCYGLIAARLWREGWVHSSRPFRVLTAVVAAFFLCWFPFHLVSLLELVV---ILNQKEDLNPLLILLLPLS 262
                        250       260
                 ....*....|....*....|....*.
gi 222537776 304 SGLGYMHCCLNPLLYAFVGVKFRERM 329
Cdd:cd15117  263 SSLACVNSCLNPLLYVFVGRDFRERL 288
7tmA_CMKLR1 cd15116
chemokine-like receptor 1, member of the class A family of seven-transmembrane G ...
91-327 1.81e-31

chemokine-like receptor 1, member of the class A family of seven-transmembrane G protein-coupled receptors; Chemokine receptor-like 1 (also known as Chemerin receptor 23) is a GPCR for the chemoattractant adipokine chemerin, also known as retinoic acid receptor responder protein 2 (RARRES2), and for the omega-3 fatty acid derived molecule resolvin E1. Interaction with chemerin induces activation of the MAPK and PI3K signaling pathways leading to downstream functional effects, such as a decrease in immune responses, stimulation of adipogenesis, and angiogenesis. On the other hand, resolvin E1 negatively regulates the cytokine production in macrophages by reducing the activation of MAPK1/3 and NF-kB pathways. CMKLR1 is prominently expressed in dendritic cells and macrophages.


Pssm-ID: 320244 [Multi-domain]  Cd Length: 284  Bit Score: 120.25  E-value: 1.81e-31
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776  91 FLLHLAVADTLLVLTLPLWAVDAAV--QWVFGSGLCKVAGALFNINFYAGALLLACISFDRYLNIVHATQLYRRGPPARV 168
Cdd:cd15116   37 WFLNLAVADFLFTFFLPFSIAYTAMdfHWPFGRFMCKLNSFLLFLNMFTSVFLLTVISIDRCISVVFPVWSQNHRSVRLA 116
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 169 TLTCLAVWGLCLLFALPDFIFLSAHHDERLNATHCQYNF-----------PQVGRTALRVLQL---VAGFLLPLLVMAYC 234
Cdd:cd15116  117 SLVSLAVWVVAFFLSSPSFIFRDTAPSQNNNKIICFNNFslsgdnsspevNQLRNMRHQVMTItrfLLGFLIPFTIIICC 196
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 235 YAHILAVLLVSRGQRRLRAMRLVVAVVVAFALCWTPYHLVVLVDILMDLGAlarncgrESRVDVAKSVTSGLGYMHCCLN 314
Cdd:cd15116  197 YAAIVLKLKRNRLAKSSKPFKIIAAVIVTFFLCWAPYHILNLLEMEATRSP-------ASVFKIGLPITSSLAFINSCLN 269
                        250
                 ....*....|...
gi 222537776 315 PLLYAFVGVKFRE 327
Cdd:cd15116  270 PILYVFMGQDFKK 282
7tmA_P2Y1-like cd15967
P2Y purinoceptor 1-like; P2Y1-like is an uncharacterized group that is phylogenetically ...
78-329 4.07e-31

P2Y purinoceptor 1-like; P2Y1-like is an uncharacterized group that is phylogenetically related to a family of purinergic G protein-coupled receptors. The P2Y receptor family is composed of eight subtypes, which are activated by naturally occurring extracellular nucleotides such as ATP, ADP, UTP, UDP, and UDP-glucose. These eight receptors are ubiquitous in human tissues and can be further classified into two subfamilies based on sequence homology and second messenger coupling: a subfamily of five P2Y1-like receptors (P2Y1, P2Y2, P2Y4, P2Y6, and P2Y11Rs) that are coupled to G(q) protein to activate phospholipase C (PLC) and a second subfamily of three P2Y12-like receptors (P2Y12, P2YR13, and P2Y14Rs) that are coupled to G(i) protein to inhibit adenylate cyclase. Several cloned subtypes, such as P2Y3, P2Y5, and P2Y7-10, are not functional mammalian nucleotide receptors. The native agonists for P2Y receptors are: ATP (P2Y2, P2Y12), ADP (P2Y1, P2Y12, and P2Y13), UTP (P2Y2, P2Y4), UDP (P2Y6, P2Y14), and UDP-glucose (P2Y14).


Pssm-ID: 320633 [Multi-domain]  Cd Length: 281  Bit Score: 119.03  E-value: 4.07e-31
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776  78 LLSRRAALSSTDTFLLHLAVADTLLVLTLPLWAV--DAAVQWVFGSGLCKVAGALFNINFYAGALLLACISFDRYLNIVH 155
Cdd:cd15967   25 LLANWKKLGNINVFVLNLGLADLLYLLTLPFLVVyyLKGRKWIFGQVFCKITRFCFNLNLYGSIGFLTCISVYRYLAIVH 104
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 156 ATQLYRRGPPARVTLTCLAVWGLCLLFALPDFIFL------SAHHDERLNATHCQYNFPQVGRTalrvlqlVAGFLLPLL 229
Cdd:cd15967  105 PMRVMGRITTTHSVVISALVWLLVVIQSLPDLFFSktnsngTKCFDTTFNDYLESYLTYSLGWT-------VTGFVIPLL 177
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 230 VMAYCYAHILAVLL----VSRGQRRlRAMRLVVAVVVAFALCWTPYHLVVLVDILMDLGALARNCGRESR-VDVAKSVTS 304
Cdd:cd15967  178 IILGCYGHVVVVLCrnnnVDKGLKQ-RCLKLVIILIVLFSVCYIPYHVFRNLNLLSRILQKQGSCTQWFRgIYIAHQVSR 256
                        250       260
                 ....*....|....*....|....*
gi 222537776 305 GLGYMHCCLNPLLYAFVGVKFRERM 329
Cdd:cd15967  257 GLVCLNSALNPLVYLMGSEDILSRI 281
7tmA_Proton-sensing_R cd15160
proton-sensing G protein-coupled receptors, member of the class A family of ...
91-329 3.15e-30

proton-sensing G protein-coupled receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Proton/pH-sensing G-protein coupled receptors sense pH of 7.6 to 6.0. They mediate a variety of biological activities in neutral and mildly acidic pH conditions, whereas the acid-sensing ionotropic ion channels typically sense strong acidic pH. The proton/pH-sensing receptor family includes the G2 accumulation receptor (G2A, also known as GPR132), the T cell death associated gene-8 (TDAG8, GPR65) receptor, ovarian cancer G-protein receptor 1 (OGR-1, GPR68), and G-protein-coupled receptor 4 (GPR4).


Pssm-ID: 320288 [Multi-domain]  Cd Length: 280  Bit Score: 116.72  E-value: 3.15e-30
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776  91 FLLHLAVADTLLVLTLPLWAVDAAVQ--WVFGSGLCKVAGALFNINFYAGALLLACISFDRYLNIVHATQLYRRGPPARV 168
Cdd:cd15160   38 YLLNLSLSDLLYILTLPLWIDYTANHhnWTFGPLSCKVVGFFFYTNIYASIGFLCCIAVDRYLAVVHPLRFRGLRTRRFA 117
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 169 TLTCLAVWGLCLLFALPdFIFLSAHHDERLNATHCQYNFPQVGRTA-LRVLQLVAGFLLPLLVMAYCYAHILAVLLVSRG 247
Cdd:cd15160  118 LKVSASIWVLELGTHSV-FLGHDELFRDEPNHTLCYEKYPMEGWQAsYNYARFLVGFLIPLSLILFFYRRVLRAVRQSPS 196
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 248 ---QRRLRAMRLVVAVVVAFALCWTPYHLVVLVDILMDLGAlARNCGRESRVDVAKSVTSGLGYMHCCLNPLLYAFVGVK 324
Cdd:cd15160  197 lerEEKRKIIGLLLSIVVIFLLCFLPYHVVLLVRSVIELVQ-NGLCGFEKRVFTAYQISLCLTSLNCVADPILYIFVTED 275

                 ....*
gi 222537776 325 FRERM 329
Cdd:cd15160  276 VRQDL 280
7tmA_MCHR-like cd15088
melanin concentrating hormone receptor, member of the class A family of seven-transmembrane G ...
74-329 5.12e-30

melanin concentrating hormone receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; Melanin-concentrating hormone receptor (MCHR) binds melanin concentrating hormone and is presumably involved in the neuronal regulation of food intake and energy homeostasis. Despite strong homology with somatostatin receptors, MCHR does not appear to bind somatostatin. Two MCHRs have been characterized in vertebrates, MCHR1 and MCHR2. MCHR1 is expressed in all mammals, whereas MCHR2 is only expressed in the higher order mammals, such as humans, primates, and dogs, and is not found in rodents. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320216 [Multi-domain]  Cd Length: 278  Bit Score: 116.01  E-value: 5.12e-30
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776  74 VAAVLLSRRAALSSTDTFLLHLAVADTLLVLTLPL----WAVDAavQWVFGSGLCKVAGALFNINFYAGALLLACISFDR 149
Cdd:cd15088   21 VLYVLVRCSKLRTAPDIFIFNLAVADLLFMLGMPFlihqFAIDG--QWYFGEVMCKIITALDANNQFTSTYILTAMSVDR 98
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 150 YLNIVHATQLYRRGPPARVTLTCLAVWGLCLLFALPDFIFLSAHHDeRLNATHCQYNFPQ-VGRTALRVLQLVAGFLLPL 228
Cdd:cd15088   99 YLAVVHPIRSTKYRTRFVAKLVNVGLWAASFLSILPVWVYSSLIYF-PDGTTFCYVSLPSpDDLYWFTIYHFILGFAVPL 177
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 229 LVMAYCYAHILAVLL-------VSRGQRRL-RAMRLVVAVVVAFALCWTPYHLVVLVDILMDLGALArncgresrVDVAK 300
Cdd:cd15088  178 VVITVCYILILHRLArgvapgnQSHGSSRTkRVTKMVILIVVVFIVCWLPFHVVQLVNLAMNRPTLA--------FEVAY 249
                        250       260
                 ....*....|....*....|....*....
gi 222537776 301 SVTSGLGYMHCCLNPLLYAFVGVKFRERM 329
Cdd:cd15088  250 FLSICLGYANSCLNPFVYILVSENFRKRL 278
PHA02834 PHA02834
chemokine receptor-like protein; Provisional
74-327 8.34e-30

chemokine receptor-like protein; Provisional


Pssm-ID: 165177  Cd Length: 323  Bit Score: 116.54  E-value: 8.34e-30
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776  74 VAAVLLSRRAaLSSTDTFLLHLAVADTLLVLTLPLWAVDAAVQWVFGSGLCKVAGALFNINFYAGALLLACISFDRYLNI 153
Cdd:PHA02834  49 VIAVLIVKRF-MFVVDVYLFNIAMSDLMLVFSFPFIIHNDLNEWIFGEFMCKLVLGVYFVGFFSNMFFVTLISIDRYILV 127
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 154 VHATQLYRRGPPARVTLTcLAVWGLCLLFALPDFIFLsaHHDERLNATHCQYNFPQVGRTALRVLQL---VAGFLLPLLV 230
Cdd:PHA02834 128 VNATKIKNKSISLSVLLS-VAAWVCSVILSMPAMVLY--YVDNTDNLKQCIFNDYHENFSWSAFFNFeinIFGIVIPLII 204
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 231 MAYCYAHILAVLLVSRGQRRLRAMRLVVAVVVAFALCWTPYHLVVLVDILMDLGALARNCGRESRVDVAKSVTSGLGYMH 310
Cdd:PHA02834 205 LIYCYSKILYTLKNCKNKNKTRSIKIILTVVTFTVVFWVPFNIVLFINSLQSVGLIDIGCYHFKKIVYSIDIAELISFVH 284
                        250
                 ....*....|....*..
gi 222537776 311 CCLNPLLYAFVGVKFRE 327
Cdd:PHA02834 285 CCVNPIIYAFVGKNFKK 301
7tmA_LTB4R2 cd15122
leukotriene B4 receptor subtype 2 (LTB4R2 or BLT2), member of the class A family of ...
86-325 1.05e-29

leukotriene B4 receptor subtype 2 (LTB4R2 or BLT2), member of the class A family of seven-transmembrane G protein-coupled receptors; Leukotriene B4 (LTB4), a metabolite of arachidonic acid, is a powerful chemotactic activator for granulocytes and macrophages. Two receptors for LTB4 have been identified: a high-affinity receptor (LTB4R1 or BLT1) and a low-affinity receptor (TB4R2 or BLT2). Both BLT1 and BLT2 receptors belong to the rhodopsin-like G-protein coupled receptor superfamily and primarily couple to G(i) proteins, which lead to chemotaxis, calcium mobilization, and inhibition of adenylate cyclase. In some cells, they can also couple to the Gq-like protein, G16, and activate phospholipase C. LTB4 is involved in mediating inflammatory processes, immune responses, and host defense against infection. Studies have shown that LTB4 stimulates leukocyte extravasation, neutrophil degranulation, lysozyme release, and reactive oxygen species generation.


Pssm-ID: 320250 [Multi-domain]  Cd Length: 281  Bit Score: 115.29  E-value: 1.05e-29
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776  86 SSTDTFLLHLAVADTLLVLTLPLWAVDAAVQ-WVFGSGLCKVAGALFNINFYAGALLLACISFDRYLNIVHATQLYRRGP 164
Cdd:cd15122   35 SVTCILILNLAVADGAVLLLTPFFITFLTRKtWPFGQAVCKAVYYLCCLSMYASIFIIGLMSLDRCLAVTRPYLAQSLRK 114
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 165 PARVTLTCLAVWGLCLLFALPDFIFLSAHHDERLNATHCQYNFPQVGRTALR-VLQLVAGFLLPLLVMAYCYAHILAVLL 243
Cdd:cd15122  115 KALVRKILLAIWLLALLLALPAFVYRHVWKDEGMNDRICEPCHASRGHAIFHyTFETLVAFVLPFGVILFSYSVILVRLK 194
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 244 VSRGQRRLRAMRLVVAVVVAFALCWTPYHlvvLVDILMDLGALARNCGRESRVDVAKSVTSG---LGYMHCCLNPLLYAF 320
Cdd:cd15122  195 GARFRRRARVEKLIAAIVVAFALLWVPYH---VVNLLQVVANLAPGEVLEKLGGAAKAARAGataLAFFSSSVNPLLYVF 271

                 ....*
gi 222537776 321 VGVKF 325
Cdd:cd15122  272 AAGDL 276
7tmA_EBI2 cd15159
Epstein-Barr virus (EBV)-induced gene 2, member of the class A family of seven-transmembrane G ...
77-329 1.25e-29

Epstein-Barr virus (EBV)-induced gene 2, member of the class A family of seven-transmembrane G protein-coupled receptors; Epstein-Barr virus-induced G-protein coupled receptor 2 (EBI2), also called GPR183, is activated by 7alpha, 25-dihydroxyxcholesterol (7alpha, 25-OHC), an oxysterol. EBI2 was originally identified as one of major genes induced in the Burkitt's lymphoma cell line BL41by EBV infection. EBI2 is involved in regulating B cell migration and responses, and is also implicated in human diseases such as type I diabetes, multiple sclerosis, and cancers.


Pssm-ID: 320287  Cd Length: 286  Bit Score: 115.14  E-value: 1.25e-29
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776  77 VLLSRRAALSSTDTFLLHLAVADTLLVLTLPLWAVDAAV--QWVFGSGLCKVAGALFNINFYAGALLLACISFDRYLNIV 154
Cdd:cd15159   24 VICQKRKKINSTTLYLINLAVSDILFTLALPGRIAYYALgfDWPFGDWLCRLTALLFYINTYAGVNFMTCLSVDRYIAVV 103
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 155 HATQLYRRGPPARVTLTCLAVWGLCLLFALPD-FIFLSAHHDERLnaTHCQY-NFPQVGRTALRVL-QLVAGFLLPLLVM 231
Cdd:cd15159  104 HPLRRHRLRKVKVVRYICVFVWVLVFLQTLPLlFMPMTKEMGGRI--TCMEYpNFEKIKRLPLILLgACVIGFGVPVGII 181
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 232 AYCYAHILAVL--------LVSRGQRRLRAMRLVVAVVVAFALCWTPYHLVVLVDILMDLGALArNCGRESRVDVAKSVT 303
Cdd:cd15159  182 LFCYSQITLKLcrtakenpLTEKSGHHKKACNVILLVLLVFVVCFSPYHLNIIQFMIRKLLYQP-SCSELKAFKISLQIT 260
                        250       260
                 ....*....|....*....|....*.
gi 222537776 304 SGLGYMHCCLNPLLYAFVGVKFRERM 329
Cdd:cd15159  261 VCLMNLNCCLDPFIYFFACKGYKKKV 286
7tmA_C3aR cd15115
complement component 3a anaphylatoxin chemotactic receptors, member of the class A family of ...
93-329 1.29e-29

complement component 3a anaphylatoxin chemotactic receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; The anaphylatoxin receptors are a group of G-protein coupled receptors which bind anaphylatoxins; members of this group include C3a receptors and C5a receptors. Anaphylatoxins are also known as complement peptides (C3a, C4a and C5a) that are produced from the activation of the complement system cascade. These complement anaphylatoxins can trigger degranulation of endothelial cells, mast cells, or phagocytes, which induce a local inflammatory response and stimulate smooth muscle cell contraction, histamine release, and increased vascular permeability. They are potent mediators involved in chemotaxis, inflammation, and generation of cytotoxic oxygen-derived free radicals. In humans, a single receptor for C3a (C3AR1) and two receptors for C5a (C5AR1 and C5AR2, also known as C5L2 or GPR77) have been identified, but there is no known receptor for C4a.


Pssm-ID: 320243 [Multi-domain]  Cd Length: 265  Bit Score: 114.87  E-value: 1.29e-29
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776  93 LHLAVADTLLVLTLPLWAVDAAV--QWVFGSGLCKVAGALFNINFYAGALLLACISFDRYLNIVHATQLYRRGPPARVTL 170
Cdd:cd15115   39 LNLAVADLLCCLSLPFSIAHLLLngHWPYGRFLCKLLPSIIVLNMFASVFTLTAISLDRFLLVIKPVWAQNHRSVLLACL 118
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 171 TCLAVWGLCLLFALPDFIFLSAHHDerLNATHCQYNFpqvgRTALRVLQLVAGFLLPLLVMAYCYAHILAVLLVSRGQRR 250
Cdd:cd15115  119 LCGCIWILALLLCLPVFIYRTTVTD--GNHTRCGYDF----LVAITITRAVFGFLLPLLIIAACYSFIAFRMQRGRFAKS 192
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 251 L-RAMRLVVAVVVAFALCWTPYHLVvlvdilmdlgALARNCGRESRVDVAKS---VTSGLGYMHCCLNPLLYAFVGVKFR 326
Cdd:cd15115  193 QsKTFRVIIAVVVAFFVCWAPYHII----------GILSLYGDPPLSKVLMSwdhLSIALAYANSCLNPVLYVFMGKDFK 262

                 ...
gi 222537776 327 ERM 329
Cdd:cd15115  263 KKA 265
7tmA_GPR17 cd15161
G protein-coupled receptor 17, member of the class A family of seven-transmembrane G ...
81-329 3.13e-29

G protein-coupled receptor 17, member of the class A family of seven-transmembrane G protein-coupled receptors; GPR17 is a Forkhead box protein O1 (FOXO1) target and abundantly expressed in agouti-related peptide (AGRP) neurons. FOXO1 is a transcription factor that plays key roles in regulation of gluconeogenesis and glycogenolysis by insulin signaling. For instance, food intake and body weight increase when hypothalamic FOXO1 is activated, whereas they both decrease when FOXO1 is inhibited. However, a recent study has been reported that GPR17 deficiency in mice did not affect food intake or glucose homeostasis. Thus, GPR17 may not play a role in the control of food intake, body weight, or glycemic control. GPR17 is phylogenetically closely related to purinergic P2Y and cysteinyl-leukotriene receptors.


Pssm-ID: 320289 [Multi-domain]  Cd Length: 277  Bit Score: 114.03  E-value: 3.13e-29
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776  81 RRAALSSTDTFLLHLAVADTLLVLTLPLWAVD--AAVQWVFGSGLCKVAGALFNINFYAGALLLACISFDRYLNIVHATQ 158
Cdd:cd15161   28 DRKSGTPSNVFLMHLAVADLSYVLILPMRLVYhlSGNHWPFGEVPCRLAGFLFYLNMYASLYFLACISVDRFLAIVHPVK 107
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 159 LYRRGPPARVTLTCLAVWGLCLLFALPdfIFLSAHHDERLNATHC-QYNFPQVGRTALrvLQLVAGFLLPLLVMAYCYAH 237
Cdd:cd15161  108 SMKIRKPLYAHVVCGFLWVIVTVAMAP--LLVSPQTVEVNNTTVClQLYREKASRGAL--VSLAVAFTIPFVTTVTCYLL 183
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 238 ILAVL-LVSRGQRRL--RAMRLVVAVVVAFALCWTPYHLVVLVDILMDLGALARNCGRESrVDVAKSVTSGLGYMHCCLN 314
Cdd:cd15161  184 IIRSLrTGKREEKPLkdKAIKMIILVLTIFLICFVPYHISRYIYILSHNGAGASCSSRRG-LALANRITSCLTCLNGALD 262
                        250
                 ....*....|....*
gi 222537776 315 PLLYAFVGVKFRERM 329
Cdd:cd15161  263 PVMYFFVAEKFRETL 277
7tmA_SSTR cd15093
somatostatin receptors, member of the class A family of seven-transmembrane G protein-coupled ...
74-327 3.73e-29

somatostatin receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; G protein-coupled somatostatin receptors (SSTRs) are composed of five distinct subtypes (SSTR1-5) that display strong sequence similarity with opioid receptors. All five receptor subtypes bind the natural somatostatin (somatotropin release inhibiting factor), a polypeptide hormone that regulates a wide variety of physiological functions such as neurotransmission, cell proliferation, contractility of smooth muscle cells, and endocrine signaling as well as inhibition of the release of many secondary hormones. They share common signaling cascades such as inhibition of adenylyl cyclase, activation of phosphotyrosine phosphatase activity, and G-protein-dependent regulation of MAPKs.


Pssm-ID: 320221 [Multi-domain]  Cd Length: 280  Bit Score: 113.71  E-value: 3.73e-29
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776  74 VAAVLLSRRAALSSTDTFLLHLAVADTLLVLTLPLWAVDAAVQ-WVFGSGLCKVAGALFNINFYAGALLLACISFDRYLN 152
Cdd:cd15093   21 VIYVVLRYAKMKTVTNIYILNLAIADELFMLGLPFLAASNALRhWPFGSVLCRLVLSVDGINMFTSIFCLTVMSVDRYLA 100
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 153 IVHATQL--YRRGPPARVtlTCLAVWGLCLLFALPDFIFLSAHHDERlNATHCQYNFP---QVGRTALRVLQLVAGFLLP 227
Cdd:cd15093  101 VVHPIKSarWRRPRVAKV--VNLAVWVASLLVILPVVVFAGTRENQD-GSSACNMQWPepaAAWSAGFIIYTFVLGFLLP 177
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 228 LLVMAYCYAHIL-----AVLLVSRGQRRL---RAMRLVVAVVVAFALCWTPYHLVVLVDILMDLgalarncgRESRVDVA 299
Cdd:cd15093  178 LLIICLCYLLIVikvksAGLRAGWQQRKRserKVTRMVVMVVVVFVICWLPFYVLQLVNVFVQL--------PETPALVG 249
                        250       260
                 ....*....|....*....|....*....
gi 222537776 300 KS-VTSGLGYMHCCLNPLLYAFVGVKFRE 327
Cdd:cd15093  250 VYhFVVILSYANSCANPILYGFLSDNFKK 278
7tmA_LTB4R cd14975
leukotriene B4 receptors, member of the class A family of seven-transmembrane G ...
78-322 4.15e-29

leukotriene B4 receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Leukotriene B4 (LTB4), a metabolite of arachidonic acid, is a powerful chemotactic activator for granulocytes and macrophages. Two receptors for LTB4 have been identified: a high-affinity receptor (LTB4R1 or BLT1) and a low-affinity receptor (TB4R2 or BLT2). Both BLT1 and BLT2 receptors belong to the rhodopsin-like G-protein coupled receptor superfamily and primarily couple to G(i) proteins, which lead to chemotaxis, calcium mobilization, and inhibition of adenylate cyclase. In some cells, they can also couple to the G(q)-like protein, G16, and activate phospholipase C. LTB4 is involved in mediating inflammatory processes, immune responses, and host defense against infection. Studies have shown that LTB4 stimulates leukocyte extravasation, neutrophil degranulation, lysozyme release, and reactive oxygen species generation.


Pssm-ID: 320106 [Multi-domain]  Cd Length: 278  Bit Score: 113.73  E-value: 4.15e-29
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776  78 LLSRRAALSSTDTFLLHLAVADTLLVLTLPLWAVD-AAVQWVFGSGLCKVAGALFNINFYAGALLLACISFDRYLNIVHA 156
Cdd:cd14975   25 ILIKVKQRSVTMLLVLNLALADLAVLLTLPVWIYFlATGTWDFGLAACKGCVYVCAVSMYASVFLITLMSLERFLAVSRP 104
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 222537776 157 TQLYRRGPPARVTLTCLAVWGLCLLFALPDFIFlsAHHDERLNATHCQYNFPQVGRTALRV-LQLVAGFLLPLLVMAY