NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|2392496]
View 

Protein Classification

lipocalin/fatty-acid binding family protein (domain architecture ID 10441691)

lipocalin/fatty-acid binding family protein such as lipocalins, which are transporters for small hydrophobic molecules, including lipids, steroid hormones, bilins, and retinoids

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Lipocalin pfam00061
Lipocalin / cytosolic fatty-acid binding protein family; Lipocalins are transporters for small ...
14-153 9.47e-19

Lipocalin / cytosolic fatty-acid binding protein family; Lipocalins are transporters for small hydrophobic molecules, such as lipids, steroid hormones, bilins, and retinoids. The family also encompasses the enzyme prostaglandin D synthase (EC:5.3.99.2). Alignment subsumes both the lipocalin and fatty acid binding protein signatures from PROSITE. This is supported on structural and functional grounds. The structure is an eight-stranded beta barrel.


:

Pssm-ID: 333807  Cd Length: 143  Bit Score: 77.08  E-value: 9.47e-19
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2392496     14 SGPWRTVYIGSTNpEKIQENGPFRTYFRELVFDdEKGTVDFYFSVKRDGKWKNVHVKATKQDD----GTYVADYEGQNVF 89
Cdd:pfam00061   1 SGKWYLIASANFN-ELEEEMKPLGVGFATIKVL-ENGNLPVTFITKEGGKCKTTSLTFKKTEEpgklGVEFDEYAGGRKV 78
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 2392496     90 KIVSLSRTHLVAHNINVDKHGQKTELTGLFVK-LNVEDEDLEKFWKLTEDKGIDKKNVVNFLENE 153
Cdd:pfam00061  79 KVLTTDYDNYLIFYQKGDKDGKTTIVRELYGRdPELSPELLEKFKKFLKELGIDEENIVRLYQRD 143
 
Name Accession Description Interval E-value
Lipocalin pfam00061
Lipocalin / cytosolic fatty-acid binding protein family; Lipocalins are transporters for small ...
14-153 9.47e-19

Lipocalin / cytosolic fatty-acid binding protein family; Lipocalins are transporters for small hydrophobic molecules, such as lipids, steroid hormones, bilins, and retinoids. The family also encompasses the enzyme prostaglandin D synthase (EC:5.3.99.2). Alignment subsumes both the lipocalin and fatty acid binding protein signatures from PROSITE. This is supported on structural and functional grounds. The structure is an eight-stranded beta barrel.


Pssm-ID: 333807  Cd Length: 143  Bit Score: 77.08  E-value: 9.47e-19
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2392496     14 SGPWRTVYIGSTNpEKIQENGPFRTYFRELVFDdEKGTVDFYFSVKRDGKWKNVHVKATKQDD----GTYVADYEGQNVF 89
Cdd:pfam00061   1 SGKWYLIASANFN-ELEEEMKPLGVGFATIKVL-ENGNLPVTFITKEGGKCKTTSLTFKKTEEpgklGVEFDEYAGGRKV 78
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 2392496     90 KIVSLSRTHLVAHNINVDKHGQKTELTGLFVK-LNVEDEDLEKFWKLTEDKGIDKKNVVNFLENE 153
Cdd:pfam00061  79 KVLTTDYDNYLIFYQKGDKDGKTTIVRELYGRdPELSPELLEKFKKFLKELGIDEENIVRLYQRD 143
 
Name Accession Description Interval E-value
Lipocalin pfam00061
Lipocalin / cytosolic fatty-acid binding protein family; Lipocalins are transporters for small ...
14-153 9.47e-19

Lipocalin / cytosolic fatty-acid binding protein family; Lipocalins are transporters for small hydrophobic molecules, such as lipids, steroid hormones, bilins, and retinoids. The family also encompasses the enzyme prostaglandin D synthase (EC:5.3.99.2). Alignment subsumes both the lipocalin and fatty acid binding protein signatures from PROSITE. This is supported on structural and functional grounds. The structure is an eight-stranded beta barrel.


Pssm-ID: 333807  Cd Length: 143  Bit Score: 77.08  E-value: 9.47e-19
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2392496     14 SGPWRTVYIGSTNpEKIQENGPFRTYFRELVFDdEKGTVDFYFSVKRDGKWKNVHVKATKQDD----GTYVADYEGQNVF 89
Cdd:pfam00061   1 SGKWYLIASANFN-ELEEEMKPLGVGFATIKVL-ENGNLPVTFITKEGGKCKTTSLTFKKTEEpgklGVEFDEYAGGRKV 78
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 2392496     90 KIVSLSRTHLVAHNINVDKHGQKTELTGLFVK-LNVEDEDLEKFWKLTEDKGIDKKNVVNFLENE 153
Cdd:pfam00061  79 KVLTTDYDNYLIFYQKGDKDGKTTIVRELYGRdPELSPELLEKFKKFLKELGIDEENIVRLYQRD 143
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.17
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH