NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|27477127|ref|NP_149022|]
View 

Protein Classification

type II keratin (domain architecture ID 12177255)

type II keratin is an intermediate filament-forming protein that provides mechanical support and fulfills a variety of additional functions in epithelial cells

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Filament pfam00038
Intermediate filament protein;
120-430 3.69e-132

Intermediate filament protein;


:

Pssm-ID: 365827 [Multi-domain]  Cd Length: 313  Bit Score: 385.81  E-value: 3.69e-132
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27477127   120 EKEQIKCLNNRFASFINKVRFLEQKNKLLETKWNFMQQQRCCQ-TNIEPIFEGYISALRRQLDCVSGDRVRLESELCSLQ 198
Cdd:pfam00038   2 EKEQLQELNDRLASYIDKVRFLEQQNKDLETKISELRQKKGAEpSRLYSLYEREIRDLRRQLDQLTVERARLQLEIDNLR 81
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27477127   199 AALEGYKKKYEEELSLRPCVENEFVALKKDVDTAFLMKADLETNAEALVQEIDFLKSLYEEEICLLQSQISETSVIVKMD 278
Cdd:pfam00038  82 LAAEDFRQKYEDELNLRQSAEADLVGLRKDLDEATLARVDLEMKVESLQEELAFLKKNHEEEVRELQSQVQDTQVNVEMD 161
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27477127   279 NSRELDVDGIIAEIKAQYDDIASRSKAEAEAWYQCRYEELRVTAGNHCDNLRNRKNEILEMNKLIQRLQQETENVKAQRC 358
Cdd:pfam00038 162 AARKLDLTSALAEIRAQYEEIAAKNREEAEEWYQSKLEELQQAAARNGDALRSAKEEITELRRQIQSLEIELQSLKKQKA 241
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 27477127   359 KLEGAIAEAEQQGEAALNDAKCKLAGLEEALQKAKQDMACLLKEYQEVMNSKLGLDIEIATYRRLLEGEEHR 430
Cdd:pfam00038 242 SLERQLAETEERYELQLADYQDLISELEAELQQIRQEMARQLREYQELLNVKLALDIEIATYRKLLEGEECR 313
Keratin_2_head pfam16208
Keratin type II head;
61-116 5.82e-11

Keratin type II head;


:

Pssm-ID: 406589  Cd Length: 160  Bit Score: 60.82  E-value: 5.82e-11
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....*..
gi 27477127    61 GFGRPRVASRCGGTLPGFGY-RLGATCGPSACITPVTINESLLVPLALEIDPTVQRV 116
Cdd:pfam16208 104 GFGGGGGFGGGGFGGGGFGGgGFGGPPCPPGGIQEVTVNQSLLQPLNLEIDPEIQRV 160
 
Name Accession Description Interval E-value
Filament pfam00038
Intermediate filament protein;
120-430 3.69e-132

Intermediate filament protein;


Pssm-ID: 365827 [Multi-domain]  Cd Length: 313  Bit Score: 385.81  E-value: 3.69e-132
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27477127   120 EKEQIKCLNNRFASFINKVRFLEQKNKLLETKWNFMQQQRCCQ-TNIEPIFEGYISALRRQLDCVSGDRVRLESELCSLQ 198
Cdd:pfam00038   2 EKEQLQELNDRLASYIDKVRFLEQQNKDLETKISELRQKKGAEpSRLYSLYEREIRDLRRQLDQLTVERARLQLEIDNLR 81
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27477127   199 AALEGYKKKYEEELSLRPCVENEFVALKKDVDTAFLMKADLETNAEALVQEIDFLKSLYEEEICLLQSQISETSVIVKMD 278
Cdd:pfam00038  82 LAAEDFRQKYEDELNLRQSAEADLVGLRKDLDEATLARVDLEMKVESLQEELAFLKKNHEEEVRELQSQVQDTQVNVEMD 161
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27477127   279 NSRELDVDGIIAEIKAQYDDIASRSKAEAEAWYQCRYEELRVTAGNHCDNLRNRKNEILEMNKLIQRLQQETENVKAQRC 358
Cdd:pfam00038 162 AARKLDLTSALAEIRAQYEEIAAKNREEAEEWYQSKLEELQQAAARNGDALRSAKEEITELRRQIQSLEIELQSLKKQKA 241
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 27477127   359 KLEGAIAEAEQQGEAALNDAKCKLAGLEEALQKAKQDMACLLKEYQEVMNSKLGLDIEIATYRRLLEGEEHR 430
Cdd:pfam00038 242 SLERQLAETEERYELQLADYQDLISELEAELQQIRQEMARQLREYQELLNVKLALDIEIATYRKLLEGEECR 313
Keratin_2_head pfam16208
Keratin type II head;
61-116 5.82e-11

Keratin type II head;


Pssm-ID: 406589  Cd Length: 160  Bit Score: 60.82  E-value: 5.82e-11
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....*..
gi 27477127    61 GFGRPRVASRCGGTLPGFGY-RLGATCGPSACITPVTINESLLVPLALEIDPTVQRV 116
Cdd:pfam16208 104 GFGGGGGFGGGGFGGGGFGGgGFGGPPCPPGGIQEVTVNQSLLQPLNLEIDPEIQRV 160
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
173-425 3.40e-10

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 62.81  E-value: 3.40e-10
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27477127  173 ISALRRQLDCVSGDRVRLESELCSLQAALEGYKKKYEEELSLRPCVENEFVALKKDVDTAFLMKADLETNAEALVQEIDF 252
Cdd:COG1196  234 LKELRKELEELEEELSRLEEELEELQEELEEAEKEIEELKSELEELREELEELQEELLELKEEIEELEGEISLLRERLEE 313
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27477127  253 LKS---LYEEEICLLQSQISETSVIVKMDNSRELDVDGIIAEIKAQYDDIASRSKAEAEAWYQcRYEELR---VTAGNHC 326
Cdd:COG1196  314 LENeleELEERLEELKEKIEALKEELEERETLLEELEQLLAELEEAKEELEEKLSALLEELEE-LFEALReelAELEAEL 392
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27477127  327 DNLRNRKNEI-LEMNKLIQRLQQETENVKAQRCKLEGAIAEAEQQgEAALNDAKCKLAGLEEALQKAKQDMACLLKEYQE 405
Cdd:COG1196  393 AEIRNELEELkREIESLEERLERLSERLEDLKEELKELEAELEEL-QTELEELNEELEELEEQLEELRDRLKELERELAE 471
                        250       260
                 ....*....|....*....|
gi 27477127  406 VMNSKLGLDIEIATYRRLLE 425
Cdd:COG1196  472 LQEELQRLEKELSSLEARLD 491
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
175-425 1.07e-06

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274008 [Multi-domain]  Cd Length: 1179  Bit Score: 51.60  E-value: 1.07e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27477127    175 ALRRQLDCVSGDRVRLESELCSLQAALEGYKKKYEEELSLRPCVENEFVALKKDVDTAFLMKADLETNAEALVQEIDFLK 254
Cdd:TIGR02168  236 ELREELEELQEELKEAEEELEELTAELQELEEKLEELRLEVSELEEEIEELQKELYALANEISRLEQQKQILRERLANLE 315
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27477127    255 S---LYEEEICLLQSQISETSVIVKmdnsrelDVDGIIAEIKAQYDDIASRSKAEAEAWYQcrYEELRVTAGNHCDNLRN 331
Cdd:TIGR02168  316 RqleELEAQLEELESKLDELAEELA-------ELEEKLEELKEELESLEAELEELEAELEE--LESRLEELEEQLETLRS 386
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27477127    332 R-----------KNEILEMNKLIQRLQQETENVKAQRCKLEGAIAEAEQQG--------EAALNDAKCKLAGLEEALQKA 392
Cdd:TIGR02168  387 KvaqlelqiaslNNEIERLEARLERLEDRRERLQQEIEELLKKLEEAELKElqaeleelEEELEELQEELERLEEALEEL 466
                          250       260       270
                   ....*....|....*....|....*....|...
gi 27477127    393 KQDMACLLKEYQEVMNSKLGLDIEIATYRRLLE 425
Cdd:TIGR02168  467 REELEEAEQALDAAERELAQLQARLDSLERLQE 499
PRK03918 PRK03918
DNA double-strand break repair ATPase Rad50;
121-428 3.18e-05

DNA double-strand break repair ATPase Rad50;


Pssm-ID: 235175 [Multi-domain]  Cd Length: 880  Bit Score: 46.60  E-value: 3.18e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27477127  121 KEQIKCLNNRFASFINKVRFLEQKNKLLETKWNFMQQQRccqTNIEPIFEgYISALRRQLDCVSGDRVRLESELCSLQAA 200
Cdd:PRK03918 192 EELIKEKEKELEEVLREINEISSELPELREELEKLEKEV---KELEELKE-EIEELEKELESLEGSKRKLEEKIRELEER 267
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27477127  201 LEGYKKKYEEelsLRPCVEnEFVALKKDVDTAFLMKADLETNAEALvQEIDFLKSLYEEEICLLQSQISETSvivkMDNS 280
Cdd:PRK03918 268 IEELKKEIEE---LEEKVK-ELKELKEKAEEYIKLSEFYEEYLDEL-REIEKRLSRLEEEINGIEERIKELE----EKEE 338
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27477127  281 RELDVDGIIAEIKAQYDDIASRSKAeaeawyqcrYEELRVTAGNhCDNLRNRK--NEILEMNKLIQRLQQETENVKAQRC 358
Cdd:PRK03918 339 RLEELKKKLKELEKRLEELEERHEL---------YEEAKAKKEE-LERLKKRLtgLTPEKLEKELEELEKAKEEIEEEIS 408
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27477127  359 KLEGAIAEAEQQGE---AALND-----AKCKLAGLE-------EALQKAKQDMACLLKEYQEVMNSKLGLDIEIATYRRL 423
Cdd:PRK03918 409 KITARIGELKKEIKelkKAIEElkkakGKCPVCGRElteehrkELLEEYTAELKRIEKELKEIEEKERKLRKELRELEKV 488

                 ....*
gi 27477127  424 LEGEE 428
Cdd:PRK03918 489 LKKES 493
 
Name Accession Description Interval E-value
Filament pfam00038
Intermediate filament protein;
120-430 3.69e-132

Intermediate filament protein;


Pssm-ID: 365827 [Multi-domain]  Cd Length: 313  Bit Score: 385.81  E-value: 3.69e-132
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27477127   120 EKEQIKCLNNRFASFINKVRFLEQKNKLLETKWNFMQQQRCCQ-TNIEPIFEGYISALRRQLDCVSGDRVRLESELCSLQ 198
Cdd:pfam00038   2 EKEQLQELNDRLASYIDKVRFLEQQNKDLETKISELRQKKGAEpSRLYSLYEREIRDLRRQLDQLTVERARLQLEIDNLR 81
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27477127   199 AALEGYKKKYEEELSLRPCVENEFVALKKDVDTAFLMKADLETNAEALVQEIDFLKSLYEEEICLLQSQISETSVIVKMD 278
Cdd:pfam00038  82 LAAEDFRQKYEDELNLRQSAEADLVGLRKDLDEATLARVDLEMKVESLQEELAFLKKNHEEEVRELQSQVQDTQVNVEMD 161
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27477127   279 NSRELDVDGIIAEIKAQYDDIASRSKAEAEAWYQCRYEELRVTAGNHCDNLRNRKNEILEMNKLIQRLQQETENVKAQRC 358
Cdd:pfam00038 162 AARKLDLTSALAEIRAQYEEIAAKNREEAEEWYQSKLEELQQAAARNGDALRSAKEEITELRRQIQSLEIELQSLKKQKA 241
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 27477127   359 KLEGAIAEAEQQGEAALNDAKCKLAGLEEALQKAKQDMACLLKEYQEVMNSKLGLDIEIATYRRLLEGEEHR 430
Cdd:pfam00038 242 SLERQLAETEERYELQLADYQDLISELEAELQQIRQEMARQLREYQELLNVKLALDIEIATYRKLLEGEECR 313
Keratin_2_head pfam16208
Keratin type II head;
61-116 5.82e-11

Keratin type II head;


Pssm-ID: 406589  Cd Length: 160  Bit Score: 60.82  E-value: 5.82e-11
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....*..
gi 27477127    61 GFGRPRVASRCGGTLPGFGY-RLGATCGPSACITPVTINESLLVPLALEIDPTVQRV 116
Cdd:pfam16208 104 GFGGGGGFGGGGFGGGGFGGgGFGGPPCPPGGIQEVTVNQSLLQPLNLEIDPEIQRV 160
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
173-425 3.40e-10

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 62.81  E-value: 3.40e-10
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27477127  173 ISALRRQLDCVSGDRVRLESELCSLQAALEGYKKKYEEELSLRPCVENEFVALKKDVDTAFLMKADLETNAEALVQEIDF 252
Cdd:COG1196  234 LKELRKELEELEEELSRLEEELEELQEELEEAEKEIEELKSELEELREELEELQEELLELKEEIEELEGEISLLRERLEE 313
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27477127  253 LKS---LYEEEICLLQSQISETSVIVKMDNSRELDVDGIIAEIKAQYDDIASRSKAEAEAWYQcRYEELR---VTAGNHC 326
Cdd:COG1196  314 LENeleELEERLEELKEKIEALKEELEERETLLEELEQLLAELEEAKEELEEKLSALLEELEE-LFEALReelAELEAEL 392
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27477127  327 DNLRNRKNEI-LEMNKLIQRLQQETENVKAQRCKLEGAIAEAEQQgEAALNDAKCKLAGLEEALQKAKQDMACLLKEYQE 405
Cdd:COG1196  393 AEIRNELEELkREIESLEERLERLSERLEDLKEELKELEAELEEL-QTELEELNEELEELEEQLEELRDRLKELERELAE 471
                        250       260
                 ....*....|....*....|
gi 27477127  406 VMNSKLGLDIEIATYRRLLE 425
Cdd:COG1196  472 LQEELQRLEKELSSLEARLD 491
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
173-428 2.25e-08

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 57.03  E-value: 2.25e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27477127  173 ISALRRQLDCVSGDRVRLESELCSLQAALEGYKKKYEEELSLRPCVENEFVALKKDVDTAFLMKADLETNAEALVQEIDF 252
Cdd:COG1196  669 LKELEEELAELEAQLEKLEEELKSLKNELRSLEDLLEELRRQLEELERQLEELKRELAALEEELEQLQSRLEELEEELEE 748
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27477127  253 LKS---LYEEEICLLQSQISETSVIVKMDNSRELDVDGIIAEIKAQYDDIAsrskaEAEAWYQCRYEELRVTAGNHCDNL 329
Cdd:COG1196  749 LEEeleELQERLEELEEELESLEEALAKLKEEIEELEEKRQALQEELEELE-----EELEEAERRLDALERELESLEQRR 823
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27477127  330 RNRKNEILEMNKLIQRLQQETENVKAQRCKLEGAIAEAEQQGEAALNdakcKLAGLEEALQKAKQDMACLLKEYQEVMNS 409
Cdd:COG1196  824 ERLEQEIEELEEEIEELEEKLDELEEELEELEKELEELKEELEELEA----EKEELEDELKELEEEKEELEEELRELESE 899
                        250
                 ....*....|....*....
gi 27477127  410 KLGLDIEIATYRRLLEGEE 428
Cdd:COG1196  900 LAELKEEIEKLRERLEELE 918
SCP-1 pfam05483
Synaptonemal complex protein 1 (SCP-1); Synaptonemal complex protein 1 (SCP-1) is the major ...
98-410 1.35e-07

Synaptonemal complex protein 1 (SCP-1); Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex. Synaptonemal complexes are structures that are formed between homologous chromosomes during meiotic prophase.


Pssm-ID: 114219 [Multi-domain]  Cd Length: 787  Bit Score: 54.34  E-value: 1.35e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27477127    98 NESLLVPLALEIdptvQRVKRDEKEQIKCLNNRFASFINKVRFLEQKNKLLETKWNFMQQQRCCQTNiEPIFEGYISALR 177
Cdd:pfam05483 375 NEDQLKIITMEL----QKKSSELEEMTKFKNNKEVELEELKKILAEDEKLLDEKKQFEKIAEELKGK-EQELIFLLQARE 449
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27477127   178 RQLDcvsgdrvRLESELCSLQAALEGYKKKYEEelsLRPCVENEfvALKKDVDTAFLMKADLETnaEALVQEI-DFLKSL 256
Cdd:pfam05483 450 KEIH-------DLEIQLTAIKTSEEHYLKEVED---LKTELEKE--KLKNIELTAHCDKLLLEN--KELTQEAsDMTLEL 515
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27477127   257 YEEEICLLQSQISETSVIVKMDNSRELD------VDGIIAEIKAQYDDIASRSKAEAEAWYQCRYEELRVTAG-----NH 325
Cdd:pfam05483 516 KKHQEDIINCKKQEERMLKQIENLEEKEmnlrdeLESVREEFIQKGDEVKCKLDKSEENARSIEYEVLKKEKQmkileNK 595
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27477127   326 CDNLRNrknEILEMNKLIQRLQQETENVKAQrcklegAIAEAEQqgeaaLNDAKCKLAGLEEALQKAKQDMACLLKEYQE 405
Cdd:pfam05483 596 CNNLKK---QIENKNKNIEELHQENKALKKK------GSAENKQ-----LNAYEIKVNKLELELASAKQKFEEIIDNYQK 661

                  ....*
gi 27477127   406 VMNSK 410
Cdd:pfam05483 662 EIEDK 666
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
175-425 1.07e-06

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274008 [Multi-domain]  Cd Length: 1179  Bit Score: 51.60  E-value: 1.07e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27477127    175 ALRRQLDCVSGDRVRLESELCSLQAALEGYKKKYEEELSLRPCVENEFVALKKDVDTAFLMKADLETNAEALVQEIDFLK 254
Cdd:TIGR02168  236 ELREELEELQEELKEAEEELEELTAELQELEEKLEELRLEVSELEEEIEELQKELYALANEISRLEQQKQILRERLANLE 315
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27477127    255 S---LYEEEICLLQSQISETSVIVKmdnsrelDVDGIIAEIKAQYDDIASRSKAEAEAWYQcrYEELRVTAGNHCDNLRN 331
Cdd:TIGR02168  316 RqleELEAQLEELESKLDELAEELA-------ELEEKLEELKEELESLEAELEELEAELEE--LESRLEELEEQLETLRS 386
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27477127    332 R-----------KNEILEMNKLIQRLQQETENVKAQRCKLEGAIAEAEQQG--------EAALNDAKCKLAGLEEALQKA 392
Cdd:TIGR02168  387 KvaqlelqiaslNNEIERLEARLERLEDRRERLQQEIEELLKKLEEAELKElqaeleelEEELEELQEELERLEEALEEL 466
                          250       260       270
                   ....*....|....*....|....*....|...
gi 27477127    393 KQDMACLLKEYQEVMNSKLGLDIEIATYRRLLE 425
Cdd:TIGR02168  467 REELEEAEQALDAAERELAQLQARLDSLERLQE 499
SMC_prok_A TIGR02169
chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of ...
112-357 2.39e-06

chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274009 [Multi-domain]  Cd Length: 1164  Bit Score: 50.45  E-value: 2.39e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27477127    112 TVQRVKRDEKEQIKCLNNRFASfinKVRFLEQKNKLLETKWNfmQQQRCCQTNIEPI------FEGYISALRRQLDCVSG 185
Cdd:TIGR02169  248 SLEEELEKLTEEISELEKRLEE---IEQLLEELNKKIKDLGE--EEQLRVKEKIGELeaeiasLERSIAEKERELEDAEE 322
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27477127    186 DRVRLESELCSLQAALEGYKKKYEEELSLRPCVENEFVALKKDVDTAFLMKADLETNAEALVQEidfLKSlYEEEICLLQ 265
Cdd:TIGR02169  323 RLAKLEAEIDKLLAEIEELEREIEEERKRRDKLTEEYAELKEELEDLRAELEEVDKEFAETRDE---LKD-YREKLEKLK 398
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27477127    266 SQISE--TSVIVKMDNSRELDVDGI-----IAEIKAQYDDIASRSKAEAEAWYQCRY--EELRVTAGNHCDNLRNRKNEI 336
Cdd:TIGR02169  399 REINElkRELDRLQEELQRLSEELAdlnaaIAGIEAKINELEEEKEDKALEIKKQEWklEQLAADLSKYEQELYDLKEEY 478
                          250       260
                   ....*....|....*....|.
gi 27477127    337 LEMNKLIQRLQQETENVKAQR 357
Cdd:TIGR02169  479 DRVEKELSKLQRELAEAEAQA 499
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
99-442 3.44e-06

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 49.71  E-value: 3.44e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27477127   99 ESLLVPLALEIDpTVQRVKRDEKEQIKCLNNRFASFINKVRFLEQKNKLLETKWNFMQQQRCCQTNIEPIFEGYISALRR 178
Cdd:COG1196  666 KRELKELEEELA-ELEAQLEKLEEELKSLKNELRSLEDLLEELRRQLEELERQLEELKRELAALEEELEQLQSRLEELEE 744
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27477127  179 QLDCVSGDRV-------RLESELCSLQAALEGYKKKYEEelslrpcvenefvalkkdvdtaflmkadLETNAEALVQEID 251
Cdd:COG1196  745 ELEELEEELEelqerleELEEELESLEEALAKLKEEIEE----------------------------LEEKRQALQEELE 796
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27477127  252 FLkslyEEEICLLQSQISETSVIVKMDNSRELDVDGIIAEIKAQYDDIASR--SKAEAEAWYQCRYEELRvtagnhcDNL 329
Cdd:COG1196  797 EL----EEELEEAERRLDALERELESLEQRRERLEQEIEELEEEIEELEEKldELEEELEELEKELEELK-------EEL 865
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27477127  330 RNRKNEILEMNKLIQRLQQETENVKAQRCKLEGAIAEAEQQGEAALNDAkcklagleEALQKAKQDMACLLKEYQEVMNS 409
Cdd:COG1196  866 EELEAEKEELEDELKELEEEKEELEEELRELESELAELKEEIEKLRERL--------EELEAKLERLEVELPELEEELEE 937
                        330       340       350
                 ....*....|....*....|....*....|...
gi 27477127  410 KLGLDIEIATYRRLLEGEEhrLCEGIGPVNISV 442
Cdd:COG1196  938 EYEDTLETELEREIERLEE--EIEALGPVNLRA 968
COG4372 COG4372
Uncharacterized conserved protein, contains DUF3084 domain [Function unknown];
173-421 9.23e-06

Uncharacterized conserved protein, contains DUF3084 domain [Function unknown];


Pssm-ID: 226809 [Multi-domain]  Cd Length: 499  Bit Score: 48.10  E-value: 9.23e-06
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27477127 173 ISALRRQLDCVSGDRVRLESELCSLQAALEgyKKKYEEELslrpcVENEFVALKKDVDTAFLMKADLETNAEALVQEIDF 252
Cdd:COG4372  83 LRALRTELGTAQGEKRAAETEREAARSELQ--KARQEREA-----VRQELAAARQNLAKAQQELARLTKQAQDLQTRLKT 155
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27477127 253 LKSLYEEEICLLQSQISETSvivkmdnsrelDVDGIIAEIKAQYDDIASRS-KAEAEAwyqcryeelrvtagnhcDNLRN 331
Cdd:COG4372 156 LAEQRRQLEAQAQSLQASQK-----------QLQASATQLKSQVLDLKLRSaQIEQEA-----------------QNLAT 207
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27477127 332 RKNEILEMNKLIQRLQQETENVKAQRCKLEGAIAEAEQQGEAALNDAKC---KLAGLEEALQKAKQDMACLLKEYQEVMN 408
Cdd:COG4372 208 RANAAQARTEELARRAAAAQQTAQAIQQRDAQISQKAQQIAARAEQIRErerQLQRLETAQARLEQEVAQLEAYYQAYVR 287
                       250
                ....*....|...
gi 27477127 409 SKLGldiEIATYR 421
Cdd:COG4372 288 LRQQ---AAATQR 297
PRK03918 PRK03918
DNA double-strand break repair ATPase Rad50;
121-428 3.18e-05

DNA double-strand break repair ATPase Rad50;


Pssm-ID: 235175 [Multi-domain]  Cd Length: 880  Bit Score: 46.60  E-value: 3.18e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27477127  121 KEQIKCLNNRFASFINKVRFLEQKNKLLETKWNFMQQQRccqTNIEPIFEgYISALRRQLDCVSGDRVRLESELCSLQAA 200
Cdd:PRK03918 192 EELIKEKEKELEEVLREINEISSELPELREELEKLEKEV---KELEELKE-EIEELEKELESLEGSKRKLEEKIRELEER 267
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27477127  201 LEGYKKKYEEelsLRPCVEnEFVALKKDVDTAFLMKADLETNAEALvQEIDFLKSLYEEEICLLQSQISETSvivkMDNS 280
Cdd:PRK03918 268 IEELKKEIEE---LEEKVK-ELKELKEKAEEYIKLSEFYEEYLDEL-REIEKRLSRLEEEINGIEERIKELE----EKEE 338
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27477127  281 RELDVDGIIAEIKAQYDDIASRSKAeaeawyqcrYEELRVTAGNhCDNLRNRK--NEILEMNKLIQRLQQETENVKAQRC 358
Cdd:PRK03918 339 RLEELKKKLKELEKRLEELEERHEL---------YEEAKAKKEE-LERLKKRLtgLTPEKLEKELEELEKAKEEIEEEIS 408
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27477127  359 KLEGAIAEAEQQGE---AALND-----AKCKLAGLE-------EALQKAKQDMACLLKEYQEVMNSKLGLDIEIATYRRL 423
Cdd:PRK03918 409 KITARIGELKKEIKelkKAIEElkkakGKCPVCGRElteehrkELLEEYTAELKRIEKELKEIEEKERKLRKELRELEKV 488

                 ....*
gi 27477127  424 LEGEE 428
Cdd:PRK03918 489 LKKES 493
PRK01156 PRK01156
chromosome segregation protein; Provisional
108-428 3.33e-05

chromosome segregation protein; Provisional


Pssm-ID: 100796 [Multi-domain]  Cd Length: 895  Bit Score: 46.43  E-value: 3.33e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27477127  108 EIDPTVQRVKRDE-KEQIKCLNNRFASFINKVRFLEQKNKLLETKWNFMQQQRCC--------QTNIEPIFEGY---ISA 175
Cdd:PRK01156 401 EIDPDAIKKELNEiNVKLQDISSKVSSLNQRIRALRENLDELSRNMEMLNGQSVCpvcgttlgEEKSNHIINHYnekKSR 480
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27477127  176 LRRQLDCVSGDRVRLESE---LCSLQAALEGYK-KKYEEELSLRPCVENEFVALKKDVDTAflmkADLETNAEALVQE-- 249
Cdd:PRK01156 481 LEEKIREIEIEVKDIDEKivdLKKRKEYLESEEiNKSINEYNKIESARADLEDIKIKINEL----KDKHDKYEEIKNRyk 556
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27477127  250 ---IDFLKSLYEEEICLLqSQISetsvIVKMDNSRELDvdgiiAEIKAQYDDIASRSK------AEAEAWYQCRYEELRv 320
Cdd:PRK01156 557 slkLEDLDSKRTSWLNAL-AVIS----LIDIETNRSRS-----NEIKKQLNDLESRLQeieigfPDDKSYIDKSIREIE- 625
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27477127  321 tagNHCDNLRNRKNEILEMNKLIQRLQQETENVKAQRCKLEGaIAEAEQQGEAALNDAKCKLAGLEEALQKAKQDMAcLL 400
Cdd:PRK01156 626 ---NEANNLNNKYNEIQENKILIEKLRGKIDNYKKQIAEIDS-IIPDLKEITSRINDIEDNLKKSRKALDDAKANRA-RL 700
                        330       340
                 ....*....|....*....|....*....
gi 27477127  401 KEYQEVMNSKLG-LDIEIATYRRLLEGEE 428
Cdd:PRK01156 701 ESTIEILRTRINeLSDRINDINETLESMK 729
Myosin_tail_1 pfam01576
Myosin tail; The myosin molecule is a multi-subunit complex made up of two heavy chains and ...
175-430 5.06e-05

Myosin tail; The myosin molecule is a multi-subunit complex made up of two heavy chains and four light chains it is a fundamental contractile protein found in all eukaryote cell types. This family consists of the coiled-coil myosin heavy chain tail region. The coiled-coil is composed of the tail from two molecules of myosin. These can then assemble into the macromolecular thick filament. The coiled-coil region provides the structural backbone the thick filament.


Pssm-ID: 396244 [Multi-domain]  Cd Length: 1081  Bit Score: 45.94  E-value: 5.06e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27477127    175 ALRRQLDCVSGDRVRLESELCSLQAALEGYKKKYEEELSLRPCVENEFVALKKDVDTAflmKADLETNAEAlVQEIDFLK 254
Cdd:pfam01576  500 SLQEQLEEEEEAKRNVERQLSTLQAQLSEMKKKLEEDAGAVEALEEAKKRLQRELEAL---TQRLEEKAAA-YDKLEKTK 575
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27477127    255 SLYEEEIcllqsqiseTSVIVKMDNSREL---------DVDGIIAE---IKAQYDDiaSRSKAEAEAwyqcRYEELRVTA 322
Cdd:pfam01576  576 NRLQQEL---------DDLLVDLDHQRQLvsnlekkqkKFDQMLAEekaISARYAE--ERDRAEAEA----REKETRALS 640
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27477127    323 GNH-CDNLRNRKNEILEMNKLiqrlqqetenvkaQRCKLEGAIAEAEQQGEAALNDAKCKLAgLEEALQKAKQDMACLLK 401
Cdd:pfam01576  641 LSRaLEEALEAKEELERQNKQ-------------LRAEMEDLVSSKDDVGKNVHELERSKRA-LEQQVEEMKTQLEELED 706
                          250       260       270
                   ....*....|....*....|....*....|....*...
gi 27477127    402 EYQEVMNSKLGLDIEI----ATYRRLLE-----GEEHR 430
Cdd:pfam01576  707 ELQATEDAKLRLEVNMqalkAQFERDLQardeqGEEKR 744
SerS COG0172
Seryl-tRNA synthetase [Translation, ribosomal structure and biogenesis];
328-396 9.43e-05

Seryl-tRNA synthetase [Translation, ribosomal structure and biogenesis];


Pssm-ID: 223250 [Multi-domain]  Cd Length: 429  Bit Score: 44.90  E-value: 9.43e-05
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27477127 328 NLRNRKN------EILEMNKLIQRLQQETENVKAQRCKLEGAIAEAEQQGE-------AALNDAKCKLAGLEEALQKAKQ 394
Cdd:COG0172  17 KLKKRGGdaldvdKLLELDEERRKLLRELEELQAERNELSKEIGRALKRGEddaeeliAEVKELKEKLKELEAALDELEA 96

                ..
gi 27477127 395 DM 396
Cdd:COG0172  97 EL 98
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
177-431 4.41e-04

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 43.16  E-value: 4.41e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27477127  177 RRQLDCVSGDRVRLESELCSLQAALEGYKKKYEEELSLRPCVENEFVALKKDVdtaflmkADLETNAEALVQEIDFLKSL 256
Cdd:COG1196  224 ELELALLLAKLKELRKELEELEEELSRLEEELEELQEELEEAEKEIEELKSEL-------EELREELEELQEELLELKEE 296
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27477127  257 YEEeicllqsqisetsvivkmdnsreldVDGIIAEIKAQYDDIASRSKAEAEAwyqcryeelrvtagnhcdnLRNRKNEI 336
Cdd:COG1196  297 IEE-------------------------LEGEISLLRERLEELENELEELEER-------------------LEELKEKI 332
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27477127  337 LEMNKLIQRLQQETENVKAQRCKLEGAIAEAEQQGEAALNDakcklagLEEALQKAKQDMACLLKEYQEVMNSKLGLDIE 416
Cdd:COG1196  333 EALKEELEERETLLEELEQLLAELEEAKEELEEKLSALLEE-------LEELFEALREELAELEAELAEIRNELEELKRE 405
                        250
                 ....*....|....*
gi 27477127  417 IATYRRLLEGEEHRL 431
Cdd:COG1196  406 IESLEERLERLSERL 420
fliH PRK06669
flagellar assembly protein H; Validated
252-408 6.70e-04

flagellar assembly protein H; Validated


Pssm-ID: 235850 [Multi-domain]  Cd Length: 281  Bit Score: 41.54  E-value: 6.70e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27477127  252 FLKSLYEEEICLLQSQISETSVIVKMDNSREldVDGIIAEIKAQYDDIASRSKAEAEAwyqcryEELRVTAgnhcdnlrn 331
Cdd:PRK06669  26 RFKVLSIKEKERLREEEEEQVEQLREEANDE--AKEIIEEAEEDAFEIVEAAEEEAKE------ELLKKTD--------- 88
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 27477127  332 rkneilEMNKLIQRLQQETENvkaqrcklegAIAEAEQQGEAALNDAKCKlaGLEEALQKAKQDMaclLKEYQEVMN 408
Cdd:PRK06669  89 ------EASSIIEKLQMQIER----------EQEEWEEELERLIEEAKAE--GYEEGYEKGREEG---LEEVRELIE 144
SbcC COG0419
DNA repair exonuclease SbcCD ATPase subunit [Replication, recombination and repair];
189-433 8.13e-04

DNA repair exonuclease SbcCD ATPase subunit [Replication, recombination and repair];


Pssm-ID: 223496 [Multi-domain]  Cd Length: 908  Bit Score: 42.05  E-value: 8.13e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27477127 189 RLESELCSLQAALEGYKKKYEEELSLrpcVENEFVALKKdvdtafLMKADLETNAEALVQEIDFLKSLYEEEICLLQSQI 268
Cdd:COG0419 182 EAKAKIEELEGQLSELLEDIEDLLEA---LEEELKELKK------LEEIQEEQEEEELEQEIEALEERLAELEEEKERLE 252
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27477127 269 SETSVIVKMdNSRELDVDGI----IAEIKAQYDDIASRSKAEAEAwyQCRYEELRVTAGNHCDNLRNRKNEILEMNKLIQ 344
Cdd:COG0419 253 ELKARLLEI-ESLELEALKIreeeLRELERLLEELEEKIERLEEL--EREIEELEEELEGLRALLEELEELLEKLKSLEE 329
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27477127 345 RLQQETENVKAQRCKLEGAIAEAEQQG-----------------EAALNDAKCKLAGLEEALQKAKQDMACLLKEYQEVM 407
Cdd:COG0419 330 RLEKLEEKLEKLESELEELAEEKNELAklleerlkeleerleelEKELEKALERLKQLEEAIQELKEELAELSAALEEIQ 409
                       250       260
                ....*....|....*....|....*.
gi 27477127 408 NSKLGLDIEIATYRRLLEGEEHRLCE 433
Cdd:COG0419 410 EELEELEKELEELERELEELEEEIKK 435
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
331-430 1.75e-03

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274008 [Multi-domain]  Cd Length: 1179  Bit Score: 41.20  E-value: 1.75e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27477127    331 NRKNEILEMNKLIQRLQQETENVKAQRCKLEGAIAEAEQQGEAA----------LNDAKCKLAGLEEALQKAKQDMACLL 400
Cdd:TIGR02168  674 ERRREIEELEEKIEELEEKIAELEKALAELRKELEELEEELEQLrkeleelsrqISALRKDLARLEAEVEQLEERIAQLS 753
                           90       100       110
                   ....*....|....*....|....*....|.
gi 27477127    401 KEYQEVMNSKLGLDIEIATYR-RLLEGEEHR 430
Cdd:TIGR02168  754 KELTELEAEIEELEERLEEAEeELAEAEAEI 784
SbcC COG0419
DNA repair exonuclease SbcCD ATPase subunit [Replication, recombination and repair];
119-425 2.52e-03

DNA repair exonuclease SbcCD ATPase subunit [Replication, recombination and repair];


Pssm-ID: 223496 [Multi-domain]  Cd Length: 908  Bit Score: 40.51  E-value: 2.52e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27477127 119 DEKEQIKCLNNRFASFINK-VRFLEQKNKLLETKWNFMQQ----QRCC-----------QTNIEPIFEGYISALRRQLDC 182
Cdd:COG0419 413 EELEKELEELERELEELEEeIKKLEEQINQLESKELMIAElagaGEKCpvcgqelpeehEKELLELYELELEELEEELSR 492
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27477127 183 VSgDRVRLESELCSLQAALEGYKKKYEEELSLRPCVENEFVALKKDVDT--AFLMKADLETNAEALVQEIDFLKSLYEEE 260
Cdd:COG0419 493 EK-EEAELREEIEELEKELRELEEELIELLELEEALKEELEEKLEKLENllEELEELKEKLQLQQLKEELRQLEDRLQEL 571
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27477127 261 ICLLQSQISETSVIVKMDNSRELdvdgiIAEIKAQYDDIASRSKAEAEAWYQCRYEELRVTAGNHCDNLRNRKNEILEMN 340
Cdd:COG0419 572 KELLEELRLLRTRKEELEELRER-----LKELKKKLKELEERLSQLEELLQSLELSEAENELEEAEEELESELEKLNLQA 646
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27477127 341 KLIQRLQQETENVKAQRCKLEGAIAEAEQQGEAALNDAKCK--LAGLEEALQKAKQDMACLLKEYQEVMNSKLGLDIEIA 418
Cdd:COG0419 647 ELEELLQAALEELEEKVEELEAEIRRELQRIENEEQLEEKLeeLEQLEEELEQLREELEELLKKLGEIEQLIEELESRKA 726

                ....*..
gi 27477127 419 TYRRLLE 425
Cdd:COG0419 727 ELEELKK 733
COG1579 COG1579
Predicted nucleic acid-binding protein, contains Zn-ribbon domain [General function ...
316-428 3.33e-03

Predicted nucleic acid-binding protein, contains Zn-ribbon domain [General function prediction only];


Pssm-ID: 224495 [Multi-domain]  Cd Length: 239  Bit Score: 39.27  E-value: 3.33e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27477127 316 EELRVTAGNHCDNLRNRKNEILEMNKLIQRLQQETENVKAQRCKLEGAIAEAEQQGE------AALNDAKcKLAGLEEAL 389
Cdd:COG1579  20 DRLEPRIKEIRKALKKAKAELEALNKALEALEIELEDLENQVSQLESEIQEIRERIKraeeklSAVKDER-ELRALNIEI 98
                        90       100       110
                ....*....|....*....|....*....|....*....
gi 27477127 390 QKAKQDMACLLKEYQEVMNSKLGLDIEIATYRRLLEGEE 428
Cdd:COG1579  99 QIAKERINSLEDELAELMEEIEKLEKEIEDLKERLERLE 137
TMCO5 pfam14992
TMCO5 family; The TMCO5 family includes human transmembrane and coiled-coil domain-containing ...
291-427 4.14e-03

TMCO5 family; The TMCO5 family includes human transmembrane and coiled-coil domain-containing proteins 5A and 5B.


Pssm-ID: 405651 [Multi-domain]  Cd Length: 281  Bit Score: 39.28  E-value: 4.14e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27477127   291 EIKAQYDDIA-SRSKAEAEAWyqcryEELRVTAGNHCDNLRN---------RKNEIL--EMNKLIQRLQQETENVKAQRC 358
Cdd:pfam14992  32 EIQSLEREITlTRSLAEDEER-----EELNCTIMEKEDALKEleletakleKKNEILskSVMELQEKLSRKSKNDGLEKE 106
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 27477127   359 KLEGAIAEAE---QQGEAALNDAKCKLAGLEEALQKAKQ---DMACLLKEYQEVMNSklgldIEIATYRRLLEGE 427
Cdd:pfam14992 107 TLKQMLEELKvklQQSEESCAEQEKELAKVESDYQSVHQlceDQALCIKKYQEILRK-----MEEEKETRLLEKE 176
PRK03918 PRK03918
DNA double-strand break repair ATPase Rad50;
117-405 7.24e-03

DNA double-strand break repair ATPase Rad50;


Pssm-ID: 235175 [Multi-domain]  Cd Length: 880  Bit Score: 38.89  E-value: 7.24e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27477127  117 KRDEKEQIKCLNNRFASFINKVRFLEQKNKLL-ETKW---------NFMQQQRCCQTNIEPIFEGY---ISALRRQLDCV 183
Cdd:PRK03918 254 KRKLEEKIRELEERIEELKKEIEELEEKVKELkELKEkaeeyiklsEFYEEYLDELREIEKRLSRLeeeINGIEERIKEL 333
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27477127  184 SGDRVRLE------SELCSLQAALEGYKKKYEEELSLrpcvENEFVALKKDvdtaflmKADLET-NAEALVQEIDFLKSL 256
Cdd:PRK03918 334 EEKEERLEelkkklKELEKRLEELEERHELYEEAKAK----KEELERLKKR-------LTGLTPeKLEKELEELEKAKEE 402
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27477127  257 YEEEICLLQSQISETSVIVKMDNS----------------RELDVD---GIIAEIKAQYDDIASRSKAEAEAWYQCRYEE 317
Cdd:PRK03918 403 IEEEISKITARIGELKKEIKELKKaieelkkakgkcpvcgRELTEEhrkELLEEYTAELKRIEKELKEIEEKERKLRKEL 482
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27477127  318 LRVtagnhcDNLRNRKNEILEMNKLIQRLQ------------------QETENVKAQRCKLEGAIAEAEQQGEAaLNDAK 379
Cdd:PRK03918 483 REL------EKVLKKESELIKLKELAEQLKeleeklkkynleelekkaEEYEKLKEKLIKLKGEIKSLKKELEK-LEELK 555
                        330       340
                 ....*....|....*....|....*.
gi 27477127  380 CKLAGLEEALQKAKQDMACLLKEYQE 405
Cdd:PRK03918 556 KKLAELEKKLDELEEELAELLKELEE 581
PRK12704 PRK12704
phosphodiesterase; Provisional
331-405 8.09e-03

phosphodiesterase; Provisional


Pssm-ID: 237177 [Multi-domain]  Cd Length: 520  Bit Score: 38.61  E-value: 8.09e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27477127  331 NRKNEILE-----MNKLIQRLQQETENVKAQRCKLEGAIAEAEQQGE--AALN--DAKCKLagLEEALQKAKQDMACLLK 401
Cdd:PRK12704  99 DRKLELLEkreeeLEKKEKELEQKQQELEKKEEELEELIEEQLQELEriSGLTaeEAKEIL--LEKVEEEARHEAAVLIK 176

                 ....
gi 27477127  402 EYQE 405
Cdd:PRK12704 177 EIEE 180
PRK05431 PRK05431
seryl-tRNA synthetase; Provisional
327-396 9.70e-03

seryl-tRNA synthetase; Provisional


Pssm-ID: 235461 [Multi-domain]  Cd Length: 425  Bit Score: 38.51  E-value: 9.70e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27477127  327 DNLRNRK-----NEILEMNKLIQRLQQETENVKAQRCKLEGAIAEAEQQGE------AALNDAKCKLAGLEEALQKAKQD 395
Cdd:PRK05431  16 EALAKRGfpldvDELLELDEERRELQTELEELQAERNALSKEIGQAKRKGEdaealiAEVKELKEEIKALEAELDELEAE 95

                 .
gi 27477127  396 M 396
Cdd:PRK05431  96 L 96
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
335-431 9.77e-03

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274008 [Multi-domain]  Cd Length: 1179  Bit Score: 38.88  E-value: 9.77e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27477127    335 EILEMNKLIQRLQQETENVKAQRCKLEGAIAEAEQQGEAALNDAKCKLAGLEEALQK---AKQDMACLLKEYQEVMNSKL 411
Cdd:TIGR02168  275 EVSELEEEIEELQKELYALANEISRLEQQKQILRERLANLERQLEELEAQLEELESKldeLAEELAELEEKLEELKEELE 354
                           90       100
                   ....*....|....*....|
gi 27477127    412 GLDIEIATYRRLLEGEEHRL 431
Cdd:TIGR02168  355 SLEAELEELEAELEELESRL 374
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH