NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|2781296]
View 

Protein Classification

Thrombin_light domain-containing protein (domain architecture ID 10559391)

Thrombin_light domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Thrombin_light pfam09396
Thrombin light chain; Thrombin is an enzyme that cleaves bonds after Arg and Lys, converts ...
3-49 4.81e-24

Thrombin light chain; Thrombin is an enzyme that cleaves bonds after Arg and Lys, converts fibrinogen to fibrin and activates factors V, VII, VIII. Prothrombin is activated on the surface of a phospholipid membrane where factor Xa removes the activation peptide and cleaves the remaining part into light and heavy chains. This domain corresponds to the light chain of thrombin.


:

Pssm-ID: 312783  Cd Length: 47  Bit Score: 83.50  E-value: 4.81e-24
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|....*..
gi 2781296     3 EDHFQPFFNEKTFGAGEADCGLRPLFEKKQVQDQTEKELFESYIEGR 49
Cdd:pfam09396  1 TEEFQTFFNPRTFGAGEADCGLRPLFEKKSKKDKTEKELLESYIGGR 47
 
Name Accession Description Interval E-value
Thrombin_light pfam09396
Thrombin light chain; Thrombin is an enzyme that cleaves bonds after Arg and Lys, converts ...
3-49 4.81e-24

Thrombin light chain; Thrombin is an enzyme that cleaves bonds after Arg and Lys, converts fibrinogen to fibrin and activates factors V, VII, VIII. Prothrombin is activated on the surface of a phospholipid membrane where factor Xa removes the activation peptide and cleaves the remaining part into light and heavy chains. This domain corresponds to the light chain of thrombin.


Pssm-ID: 312783  Cd Length: 47  Bit Score: 83.50  E-value: 4.81e-24
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|....*..
gi 2781296     3 EDHFQPFFNEKTFGAGEADCGLRPLFEKKQVQDQTEKELFESYIEGR 49
Cdd:pfam09396  1 TEEFQTFFNPRTFGAGEADCGLRPLFEKKSKKDKTEKELLESYIGGR 47
 
Name Accession Description Interval E-value
Thrombin_light pfam09396
Thrombin light chain; Thrombin is an enzyme that cleaves bonds after Arg and Lys, converts ...
3-49 4.81e-24

Thrombin light chain; Thrombin is an enzyme that cleaves bonds after Arg and Lys, converts fibrinogen to fibrin and activates factors V, VII, VIII. Prothrombin is activated on the surface of a phospholipid membrane where factor Xa removes the activation peptide and cleaves the remaining part into light and heavy chains. This domain corresponds to the light chain of thrombin.


Pssm-ID: 312783  Cd Length: 47  Bit Score: 83.50  E-value: 4.81e-24
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|....*..
gi 2781296     3 EDHFQPFFNEKTFGAGEADCGLRPLFEKKQVQDQTEKELFESYIEGR 49
Cdd:pfam09396  1 TEEFQTFFNPRTFGAGEADCGLRPLFEKKSKKDKTEKELLESYIGGR 47
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.17
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH