NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|315113433]
View 

Protein Classification

cytochrome P450 (domain architecture ID 10005343)

cytochrome P450 catalyzes the oxidation of organic species by molecular oxygen, by the oxidative addition of atomic oxygen into an unactivated C-H or C-C bond

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
p450 pfam00067
Cytochrome P450. Cytochrome P450s are haem-thiolate proteins involved in the oxidative ...
14-472 2.97e-149

Cytochrome P450. Cytochrome P450s are haem-thiolate proteins involved in the oxidative degradation of various compounds. They are particularly well known for their role in the degradation of environmental toxins and mutagens. They can be divided into 4 classes, according to the method by which electrons from NAD(P)H are delivered to the catalytic site. Sequence conservation is relatively low within the family - there are only 3 absolutely conserved residues - but their general topography and structural fold are highly conserved. The conserved core is composed of a coil termed the 'meander', a four-helix bundle, helices J and K, and two sets of beta-sheets. These constitute the haem-binding loop (with an absolutely conserved cysteine that serves as the 5th ligand for the haem iron), the proton-transfer groove and the absolutely conserved EXXR motif in helix K. While prokaryotic P450s are soluble proteins, most eukaryotic P450s are associated with microsomal membranes. their general enzymatic function is to catalyze regiospecific and stereospecific oxidation of non-activated hydrocarbons at physiological temperatures.


:

Pssm-ID: 365848  Cd Length: 458  Bit Score: 433.62  E-value: 2.97e-149
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433   14 PSPGDNGWLNLYHFWREKGsQRIHFRHIENFQKYGPIYREKLGNLESVYIIHPEDVAHLFKFEGSYPERYDIPPWLAYHR 93
Cdd:pfam00067   1 PPGPPPLPLFGNLLQLGRG-GNLHSVFTKLQKKYGPIFRLYLGPKPTVVLSGPEAVKEVLIKKGEEFSGRPDEPWFATSR 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433   94 YYQKPIGVLFKKSGTWKKDRVVLNTEVMAPEAIKnFIPLLNPVSQDFVSLLHKRIKQQGsgkfVGDIKEDLFHFAFESIT 173
Cdd:pfam00067  80 GPFLGKGILFANGPRWRQLRRFLTPTFRSFGKLK-FEPRVQEEARDLVEKLRKTAGQPG----VIDITFLLFRAALNVIC 154
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433  174 NVMFGERLGMLEETVNPEAQKFIDAVYKMFHTSVPLLNVPPELYRLFRTKTWRDHVAAWDTIFNKAEKYTEIFYQDLRRK 253
Cdd:pfam00067 155 SILFGERFGSLEDPKFLELVKAVQELFSLLSSPSPQLLDLFPILKYFPGKHGRKLKRARKKLKDLLDKLIEERRETLDSA 234
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433  254 TefRNYPGILYCLLKSE----KMLLEDVKANITEMLAGGVNTTSMTLQWHLYEMARSLNVQEMLREEVLNARRQAEGDIS 329
Cdd:pfam00067 235 G--SPRDFLDALLLAKEkdgeKLTDEELRATVLDLFFAGTDTTSSTLSWALYELAKNPEVQEKLREEIDEVIGDKRSPTY 312
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433  330 KMLQMVPLLKASIKETLRLHPISVT-LQRYPESDLVLQDYLIPAKTLVQVAIYAMGRDPAFFSSPDKFDPTRWLSKDKDL 408
Cdd:pfam00067 313 DDLQNMPYLDAVIKETLRLHPVVPLlLPREVTKDTVIPGYLIPKGTLVIVNLYALHRDPKVFPNPEEFDPERFLDENGNF 392
                         410       420       430       440       450       460
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 315113433  409 IH-FRNLGFGWGVRQCVGRRIAELEMTLFLIHILENFKVEMQHIGDVDTIFNL-ILTPDKPIFLVF 472
Cdd:pfam00067 393 RKsFAFLPFGAGPRNCLGERLARMEMKLFLATLLQNFEVELPPGVDPPDIDETpLLLPPKPYKLKF 458
 
Name Accession Description Interval E-value
p450 pfam00067
Cytochrome P450. Cytochrome P450s are haem-thiolate proteins involved in the oxidative ...
14-472 2.97e-149

Cytochrome P450. Cytochrome P450s are haem-thiolate proteins involved in the oxidative degradation of various compounds. They are particularly well known for their role in the degradation of environmental toxins and mutagens. They can be divided into 4 classes, according to the method by which electrons from NAD(P)H are delivered to the catalytic site. Sequence conservation is relatively low within the family - there are only 3 absolutely conserved residues - but their general topography and structural fold are highly conserved. The conserved core is composed of a coil termed the 'meander', a four-helix bundle, helices J and K, and two sets of beta-sheets. These constitute the haem-binding loop (with an absolutely conserved cysteine that serves as the 5th ligand for the haem iron), the proton-transfer groove and the absolutely conserved EXXR motif in helix K. While prokaryotic P450s are soluble proteins, most eukaryotic P450s are associated with microsomal membranes. their general enzymatic function is to catalyze regiospecific and stereospecific oxidation of non-activated hydrocarbons at physiological temperatures.


Pssm-ID: 365848  Cd Length: 458  Bit Score: 433.62  E-value: 2.97e-149
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433   14 PSPGDNGWLNLYHFWREKGsQRIHFRHIENFQKYGPIYREKLGNLESVYIIHPEDVAHLFKFEGSYPERYDIPPWLAYHR 93
Cdd:pfam00067   1 PPGPPPLPLFGNLLQLGRG-GNLHSVFTKLQKKYGPIFRLYLGPKPTVVLSGPEAVKEVLIKKGEEFSGRPDEPWFATSR 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433   94 YYQKPIGVLFKKSGTWKKDRVVLNTEVMAPEAIKnFIPLLNPVSQDFVSLLHKRIKQQGsgkfVGDIKEDLFHFAFESIT 173
Cdd:pfam00067  80 GPFLGKGILFANGPRWRQLRRFLTPTFRSFGKLK-FEPRVQEEARDLVEKLRKTAGQPG----VIDITFLLFRAALNVIC 154
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433  174 NVMFGERLGMLEETVNPEAQKFIDAVYKMFHTSVPLLNVPPELYRLFRTKTWRDHVAAWDTIFNKAEKYTEIFYQDLRRK 253
Cdd:pfam00067 155 SILFGERFGSLEDPKFLELVKAVQELFSLLSSPSPQLLDLFPILKYFPGKHGRKLKRARKKLKDLLDKLIEERRETLDSA 234
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433  254 TefRNYPGILYCLLKSE----KMLLEDVKANITEMLAGGVNTTSMTLQWHLYEMARSLNVQEMLREEVLNARRQAEGDIS 329
Cdd:pfam00067 235 G--SPRDFLDALLLAKEkdgeKLTDEELRATVLDLFFAGTDTTSSTLSWALYELAKNPEVQEKLREEIDEVIGDKRSPTY 312
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433  330 KMLQMVPLLKASIKETLRLHPISVT-LQRYPESDLVLQDYLIPAKTLVQVAIYAMGRDPAFFSSPDKFDPTRWLSKDKDL 408
Cdd:pfam00067 313 DDLQNMPYLDAVIKETLRLHPVVPLlLPREVTKDTVIPGYLIPKGTLVIVNLYALHRDPKVFPNPEEFDPERFLDENGNF 392
                         410       420       430       440       450       460
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 315113433  409 IH-FRNLGFGWGVRQCVGRRIAELEMTLFLIHILENFKVEMQHIGDVDTIFNL-ILTPDKPIFLVF 472
Cdd:pfam00067 393 RKsFAFLPFGAGPRNCLGERLARMEMKLFLATLLQNFEVELPPGVDPPDIDETpLLLPPKPYKLKF 458
CypX COG2124
Cytochrome P450 [Secondary metabolites biosynthesis, transport and catabolism, Defense ...
61-474 5.54e-30

Cytochrome P450 [Secondary metabolites biosynthesis, transport and catabolism, Defense mechanisms];


Pssm-ID: 225035 [Multi-domain]  Cd Length: 411  Bit Score: 121.00  E-value: 5.54e-30
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433  61 VYIIHPEDVAHLFKFEGSYPERYDIPPWLAYHRYYQKPIGVLFKKSGTWKKDRVVLNtEVMAPEAIKNFIPLL-NPVSQD 139
Cdd:COG2124   51 WVVSRPADVREVLRDPRFFSSALGAGLRPRLLRPVLGDGSLLTLDGPEHTRLRKLLA-PAFTPRALRGYRPLIrEIADRL 129
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433 140 FVSLLHKRIkqqgsgkfvgdikEDLFHFAFE---SITNVMFGERLGmleetvnpEAQKFIDAVYKMFHTSVPLLNVPPEl 216
Cdd:COG2124  130 LDDLWQGGA-------------DLVLDFAAEltlRVIAELLGVPLE--------DRPQLLRWSDALLLRLDPDLGPEEP- 187
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433 217 yrlfrtktWRDHVAAWDTIFnkaekyteifyQDLRRK-TEFRNYPG--ILYCLLKSE-----KMLLEDVKANITEMLAGG 288
Cdd:COG2124  188 --------WRRARAARRELD-----------AYLRALiAERRAAPRddLLSLLLSAEddgggRLSDDEIRDELITLLVAG 248
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433 289 VNTTSMTLQWHLYEMARSLNVQEMLREEvlnarrqaegdiskmlQMVPLLKASIKETLRLHPISVTLQRYPESDLVLQDY 368
Cdd:COG2124  249 HETTANALAWALYALLRHPDQLAKLRAE----------------PDRPLLEAVVEETLRLYPPVPLARRVATEDVELGGY 312
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433 369 LIPAKTLVQVAIYAMGRDPAFFSSPDKFDPTRWLSkdkdlihfRNLGFGWGVRQCVGRRIAELEMTLFLIHILENFKVeM 448
Cdd:COG2124  313 RIPAGTVVLLSIGAANRDPEVFPDPDEFDPERFNN--------AHLPFGGGPHRCLGAALARLELKVALAELLRRFPL-L 383
                        410       420
                 ....*....|....*....|....*.
gi 315113433 449 QHIGDVDTIFNLILTPDKPIFLVFRP 474
Cdd:COG2124  384 LLAEPPPLVRRPTLVPRGGERLPVRR 409
PTZ00404 PTZ00404
cytochrome P450; Provisional
45-466 2.78e-26

cytochrome P450; Provisional


Pssm-ID: 173595  Cd Length: 482  Bit Score: 111.35  E-value: 2.78e-26
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433  45 QKYGPIYREKLGNLESVYIIHPEDVAHLF--KFEgSYPERYDIPPwLAYHRYYQkpiGVLFKKSGTWKKDRVVLNtEVMA 122
Cdd:PTZ00404  59 KKYGGIFRIWFADLYTVVLSDPILIREMFvdNFD-NFSDRPKIPS-IKHGTFYH---GIVTSSGEYWKRNREIVG-KAMR 132
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433 123 PEAIKNFIPLLNpvsqDFVSLLHKRIKQ-QGSGKfVGDIKEDLFHFAFESITNVMFGERLGMLEETVNPEAQKFIDAVYK 201
Cdd:PTZ00404 133 KTNLKHIYDLLD----DQVDVLIESMKKiESSGE-TFEPRYYLTKFTMSAMFKYIFNEDISFDEDIHNGKLAELMGPMEQ 207
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433 202 MFHT-----SVPLLNVPPELYRLFRTKTwrdhvaawDTIFNKAEKYTEIFYQDLRRKTEFRNYPGILYCLLKS------E 270
Cdd:PTZ00404 208 VFKDlgsgsLFDVIEITQPLYYQYLEHT--------DKNFKKIKKFIKEKYHEHLKTIDPEVPRDLLDLLIKEygtntdD 279
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433 271 KMLleDVKANITEMLAGGVNTTSMTLQWHLYEMARSLNVQEMLREEVlnarRQAEGDISKML----QMVPLLKASIKETL 346
Cdd:PTZ00404 280 DIL--SILATILDFFLAGVDTSATSLEWMVLMLCNYPEIQEKAYNEI----KSTVNGRNKVLlsdrQSTPYTVAIIKETL 353
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433 347 RLHPISV-TLQRYPESDLVLQD-YLIPAKTLVQVAIYAMGRDPAFFSSPDKFDPTRWLSKDKDLIHFRnlgFGWGVRQCV 424
Cdd:PTZ00404 354 RYKPVSPfGLPRSTSNDIIIGGgHFIPKDAQILINYYSLGRNEKYFENPEQFDPSRFLNPDSNDAFMP---FSIGPRNCV 430
                        410       420       430       440
                 ....*....|....*....|....*....|....*....|....*
gi 315113433 425 GRRIAELEMTLFLIHILENFK---VEMQHIGDVDtIFNLILTPDK 466
Cdd:PTZ00404 431 GQQFAQDELYLAFSNIILNFKlksIDGKKIDETE-EYGLTLKPNK 474
P450_cycloAA_1 TIGR04538
cytochrome P450, cyclodipeptide synthase-associated; Members of this subfamily are cytochrome ...
209-451 8.62e-14

cytochrome P450, cyclodipeptide synthase-associated; Members of this subfamily are cytochrome P450 enzymes that occur next to tRNA-dependent cyclodipeptide synthases. This group does NOT include CYP121 (Rv2275) from Mycobacterium tuberculosis, adjacent to the cyclodityrosine synthetase Rv2276.


Pssm-ID: 275331  Cd Length: 395  Bit Score: 72.83  E-value: 8.62e-14
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433  209 LLNVPPELYRLFRTktWRDHVAAWDTIFNKAEkyTEIFYQ---------------DLRRKTEFRNYPGILyCLLKSEKML 273
Cdd:TIGR04538 135 LLGLDKRDHEKIRE--WHSGIAKFITSLNQSP--EERMHSlecseklreylmpiiEERRKNPGSDLISIL-CTSEDEGNA 209
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433  274 LED--VKANITEMLAGGVNTTSMTLQWHLYEMarsLNVQEMLrEEVLNARRqaegdiskmlqmvpLLKASIKETLRLHPI 351
Cdd:TIGR04538 210 MSDteILALILNILLAATEPADKTLAYMIYHL---LNNPEQL-NDVLDDRK--------------LLRRAIAETLRLHSP 271
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433  352 SVTLQRYPESDLVLQDYLIPAKTLVQVAIYAMGRDPAFFSSPDKFDPTR--WLSKDKDLIHFRNLGFGWGVRQCVGRRIA 429
Cdd:TIGR04538 272 VQLIPRQLSQDVTISGKEIKKGDTVFCMIGAANRDPEAFEDPDEFNIHRkdLVNKSAFTGAARHLAFGSGVHNCVGAAFA 351
                         250       260
                  ....*....|....*....|....*
gi 315113433  430 --ELEMTL-FLIHILENFKVEMQHI 451
Cdd:TIGR04538 352 krQLEIVAnILLDLLKNIRLEEDFS 376
 
Name Accession Description Interval E-value
p450 pfam00067
Cytochrome P450. Cytochrome P450s are haem-thiolate proteins involved in the oxidative ...
14-472 2.97e-149

Cytochrome P450. Cytochrome P450s are haem-thiolate proteins involved in the oxidative degradation of various compounds. They are particularly well known for their role in the degradation of environmental toxins and mutagens. They can be divided into 4 classes, according to the method by which electrons from NAD(P)H are delivered to the catalytic site. Sequence conservation is relatively low within the family - there are only 3 absolutely conserved residues - but their general topography and structural fold are highly conserved. The conserved core is composed of a coil termed the 'meander', a four-helix bundle, helices J and K, and two sets of beta-sheets. These constitute the haem-binding loop (with an absolutely conserved cysteine that serves as the 5th ligand for the haem iron), the proton-transfer groove and the absolutely conserved EXXR motif in helix K. While prokaryotic P450s are soluble proteins, most eukaryotic P450s are associated with microsomal membranes. their general enzymatic function is to catalyze regiospecific and stereospecific oxidation of non-activated hydrocarbons at physiological temperatures.


Pssm-ID: 365848  Cd Length: 458  Bit Score: 433.62  E-value: 2.97e-149
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433   14 PSPGDNGWLNLYHFWREKGsQRIHFRHIENFQKYGPIYREKLGNLESVYIIHPEDVAHLFKFEGSYPERYDIPPWLAYHR 93
Cdd:pfam00067   1 PPGPPPLPLFGNLLQLGRG-GNLHSVFTKLQKKYGPIFRLYLGPKPTVVLSGPEAVKEVLIKKGEEFSGRPDEPWFATSR 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433   94 YYQKPIGVLFKKSGTWKKDRVVLNTEVMAPEAIKnFIPLLNPVSQDFVSLLHKRIKQQGsgkfVGDIKEDLFHFAFESIT 173
Cdd:pfam00067  80 GPFLGKGILFANGPRWRQLRRFLTPTFRSFGKLK-FEPRVQEEARDLVEKLRKTAGQPG----VIDITFLLFRAALNVIC 154
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433  174 NVMFGERLGMLEETVNPEAQKFIDAVYKMFHTSVPLLNVPPELYRLFRTKTWRDHVAAWDTIFNKAEKYTEIFYQDLRRK 253
Cdd:pfam00067 155 SILFGERFGSLEDPKFLELVKAVQELFSLLSSPSPQLLDLFPILKYFPGKHGRKLKRARKKLKDLLDKLIEERRETLDSA 234
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433  254 TefRNYPGILYCLLKSE----KMLLEDVKANITEMLAGGVNTTSMTLQWHLYEMARSLNVQEMLREEVLNARRQAEGDIS 329
Cdd:pfam00067 235 G--SPRDFLDALLLAKEkdgeKLTDEELRATVLDLFFAGTDTTSSTLSWALYELAKNPEVQEKLREEIDEVIGDKRSPTY 312
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433  330 KMLQMVPLLKASIKETLRLHPISVT-LQRYPESDLVLQDYLIPAKTLVQVAIYAMGRDPAFFSSPDKFDPTRWLSKDKDL 408
Cdd:pfam00067 313 DDLQNMPYLDAVIKETLRLHPVVPLlLPREVTKDTVIPGYLIPKGTLVIVNLYALHRDPKVFPNPEEFDPERFLDENGNF 392
                         410       420       430       440       450       460
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 315113433  409 IH-FRNLGFGWGVRQCVGRRIAELEMTLFLIHILENFKVEMQHIGDVDTIFNL-ILTPDKPIFLVF 472
Cdd:pfam00067 393 RKsFAFLPFGAGPRNCLGERLARMEMKLFLATLLQNFEVELPPGVDPPDIDETpLLLPPKPYKLKF 458
CypX COG2124
Cytochrome P450 [Secondary metabolites biosynthesis, transport and catabolism, Defense ...
61-474 5.54e-30

Cytochrome P450 [Secondary metabolites biosynthesis, transport and catabolism, Defense mechanisms];


Pssm-ID: 225035 [Multi-domain]  Cd Length: 411  Bit Score: 121.00  E-value: 5.54e-30
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433  61 VYIIHPEDVAHLFKFEGSYPERYDIPPWLAYHRYYQKPIGVLFKKSGTWKKDRVVLNtEVMAPEAIKNFIPLL-NPVSQD 139
Cdd:COG2124   51 WVVSRPADVREVLRDPRFFSSALGAGLRPRLLRPVLGDGSLLTLDGPEHTRLRKLLA-PAFTPRALRGYRPLIrEIADRL 129
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433 140 FVSLLHKRIkqqgsgkfvgdikEDLFHFAFE---SITNVMFGERLGmleetvnpEAQKFIDAVYKMFHTSVPLLNVPPEl 216
Cdd:COG2124  130 LDDLWQGGA-------------DLVLDFAAEltlRVIAELLGVPLE--------DRPQLLRWSDALLLRLDPDLGPEEP- 187
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433 217 yrlfrtktWRDHVAAWDTIFnkaekyteifyQDLRRK-TEFRNYPG--ILYCLLKSE-----KMLLEDVKANITEMLAGG 288
Cdd:COG2124  188 --------WRRARAARRELD-----------AYLRALiAERRAAPRddLLSLLLSAEddgggRLSDDEIRDELITLLVAG 248
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433 289 VNTTSMTLQWHLYEMARSLNVQEMLREEvlnarrqaegdiskmlQMVPLLKASIKETLRLHPISVTLQRYPESDLVLQDY 368
Cdd:COG2124  249 HETTANALAWALYALLRHPDQLAKLRAE----------------PDRPLLEAVVEETLRLYPPVPLARRVATEDVELGGY 312
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433 369 LIPAKTLVQVAIYAMGRDPAFFSSPDKFDPTRWLSkdkdlihfRNLGFGWGVRQCVGRRIAELEMTLFLIHILENFKVeM 448
Cdd:COG2124  313 RIPAGTVVLLSIGAANRDPEVFPDPDEFDPERFNN--------AHLPFGGGPHRCLGAALARLELKVALAELLRRFPL-L 383
                        410       420
                 ....*....|....*....|....*.
gi 315113433 449 QHIGDVDTIFNLILTPDKPIFLVFRP 474
Cdd:COG2124  384 LLAEPPPLVRRPTLVPRGGERLPVRR 409
PTZ00404 PTZ00404
cytochrome P450; Provisional
45-466 2.78e-26

cytochrome P450; Provisional


Pssm-ID: 173595  Cd Length: 482  Bit Score: 111.35  E-value: 2.78e-26
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433  45 QKYGPIYREKLGNLESVYIIHPEDVAHLF--KFEgSYPERYDIPPwLAYHRYYQkpiGVLFKKSGTWKKDRVVLNtEVMA 122
Cdd:PTZ00404  59 KKYGGIFRIWFADLYTVVLSDPILIREMFvdNFD-NFSDRPKIPS-IKHGTFYH---GIVTSSGEYWKRNREIVG-KAMR 132
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433 123 PEAIKNFIPLLNpvsqDFVSLLHKRIKQ-QGSGKfVGDIKEDLFHFAFESITNVMFGERLGMLEETVNPEAQKFIDAVYK 201
Cdd:PTZ00404 133 KTNLKHIYDLLD----DQVDVLIESMKKiESSGE-TFEPRYYLTKFTMSAMFKYIFNEDISFDEDIHNGKLAELMGPMEQ 207
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433 202 MFHT-----SVPLLNVPPELYRLFRTKTwrdhvaawDTIFNKAEKYTEIFYQDLRRKTEFRNYPGILYCLLKS------E 270
Cdd:PTZ00404 208 VFKDlgsgsLFDVIEITQPLYYQYLEHT--------DKNFKKIKKFIKEKYHEHLKTIDPEVPRDLLDLLIKEygtntdD 279
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433 271 KMLleDVKANITEMLAGGVNTTSMTLQWHLYEMARSLNVQEMLREEVlnarRQAEGDISKML----QMVPLLKASIKETL 346
Cdd:PTZ00404 280 DIL--SILATILDFFLAGVDTSATSLEWMVLMLCNYPEIQEKAYNEI----KSTVNGRNKVLlsdrQSTPYTVAIIKETL 353
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433 347 RLHPISV-TLQRYPESDLVLQD-YLIPAKTLVQVAIYAMGRDPAFFSSPDKFDPTRWLSKDKDLIHFRnlgFGWGVRQCV 424
Cdd:PTZ00404 354 RYKPVSPfGLPRSTSNDIIIGGgHFIPKDAQILINYYSLGRNEKYFENPEQFDPSRFLNPDSNDAFMP---FSIGPRNCV 430
                        410       420       430       440
                 ....*....|....*....|....*....|....*....|....*
gi 315113433 425 GRRIAELEMTLFLIHILENFK---VEMQHIGDVDtIFNLILTPDK 466
Cdd:PTZ00404 431 GQQFAQDELYLAFSNIILNFKlksIDGKKIDETE-EYGLTLKPNK 474
PLN02183 PLN02183
ferulate 5-hydroxylase
266-450 3.85e-23

ferulate 5-hydroxylase


Pssm-ID: 165828  Cd Length: 516  Bit Score: 102.24  E-value: 3.85e-23
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433 266 LLKSEKMLLEDVKANITEMLAGGVNTTSMTLQWHLYEMARSLN----VQEMLREEVLNARRQAEGDISKMLqmvpLLKAS 341
Cdd:PLN02183 294 LQNSIKLTRDNIKAIIMDVMFGGTETVASAIEWAMAELMKSPEdlkrVQQELADVVGLNRRVEESDLEKLT----YLKCT 369
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433 342 IKETLRLH-PISVTLQRYPEsDLVLQDYLIPAKTLVQVAIYAMGRDPAFFSSPDKFDPTRWLSK---DKDLIHFRNLGFG 417
Cdd:PLN02183 370 LKETLRLHpPIPLLLHETAE-DAEVAGYFIPKRSRVMINAWAIGRDKNSWEDPDTFKPSRFLKPgvpDFKGSHFEFIPFG 448
                        170       180       190
                 ....*....|....*....|....*....|...
gi 315113433 418 WGVRQCVGRRIAELEMTLFLIHILENFKVEMQH 450
Cdd:PLN02183 449 SGRRSCPGMQLGLYALDLAVAHLLHCFTWELPD 481
PLN03112 PLN03112
cytochrome P450 family protein; Provisional
46-474 3.09e-21

cytochrome P450 family protein; Provisional


Pssm-ID: 215583  Cd Length: 514  Bit Score: 96.43  E-value: 3.09e-21
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433  46 KYGPIYREKLGNLESVYIIHPEDVAHLFKFE----GSYPeRYDIPPWLAY--HRYYQKPIGvlfkksGTWKKDRVVLNTE 119
Cdd:PLN03112  63 KYGPLVYLRLGSVDAITTDDPELIREILLRQddvfASRP-RTLAAVHLAYgcGDVALAPLG------PHWKRMRRICMEH 135
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433 120 VMAPEAIKNFIpllNPVSQDFVSLLHKRIKQQGSGKFVgDIKEDLFHFAFESITNVMFGERLGMLEETVNPEAQKFidav 199
Cdd:PLN03112 136 LLTTKRLESFA---KHRAEEARHLIQDVWEAAQTGKPV-NLREVLGAFSMNNVTRMLLGKQYFGAESAGPKEAMEF---- 207
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433 200 ykmfhtsvplLNVPPELYRLFRTKTWRDHVAAWDTI--------FNKAEKYTEIFYQ-------DLRRKTEFRNYPGILY 264
Cdd:PLN03112 208 ----------MHITHELFRLLGVIYLGDYLPAWRWLdpygcekkMREVEKRVDEFHDkiidehrRARSGKLPGGKDMDFV 277
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433 265 CLLKS-------EKMLLEDVKANITEMLAGGVNTTSMTLQWHLYEMARSLNVQEMLREEVLNA----RRQAEGDISKMlq 333
Cdd:PLN03112 278 DVLLSlpgengkEHMDDVEIKALMQDMIAAATDTSAVTNEWAMAEVIKNPRVLRKIQEELDSVvgrnRMVQESDLVHL-- 355
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433 334 mvPLLKASIKETLRLHPISVTL-QRYPESDLVLQDYLIPAKTLVQVAIYAMGRDPAFFSSPDKFDPTRWLSKDK---DLI 409
Cdd:PLN03112 356 --NYLRCVVRETFRMHPAGPFLiPHESLRATTINGYYIPAKTRVFINTHGLGRNTKIWDDVEEFRPERHWPAEGsrvEIS 433
                        410       420       430       440       450       460       470
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 315113433 410 H---FRNLGFGWGVRQCVGRRIAELEMTLFLIHILENFK------VEMQHIgDVDTIFNLILTPDKPIFLVFRP 474
Cdd:PLN03112 434 HgpdFKILPFSAGKRKCPGAPLGVTMVLMALARLFHCFDwsppdgLRPEDI-DTQEVYGMTMPKAKPLRAVATP 506
PLN00110 PLN00110
flavonoid 3',5'-hydroxylase (F3'5'H); Provisional
270-474 3.28e-20

flavonoid 3',5'-hydroxylase (F3'5'H); Provisional


Pssm-ID: 177725  Cd Length: 504  Bit Score: 92.99  E-value: 3.28e-20
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433 270 EKMLLEDVKANITEMLAGGVNTTSMTLQWHLYEMARSLNVQEMLREE----VLNARRQAEGDISKMlqmvPLLKASIKET 345
Cdd:PLN00110 283 EKLTLTNIKALLLNLFTAGTDTSSSVIEWSLAEMLKNPSILKRAHEEmdqvIGRNRRLVESDLPKL----PYLQAICKES 358
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433 346 LRLHP-ISVTLQRYPESDLVLQDYLIPAKTLVQVAIYAMGRDPAFFSSPDKFDPTRWLSKDKDLIH-----FRNLGFGWG 419
Cdd:PLN00110 359 FRKHPsTPLNLPRVSTQACEVNGYYIPKNTRLSVNIWAIGRDPDVWENPEEFRPERFLSEKNAKIDprgndFELIPFGAG 438
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|....*..
gi 315113433 420 VRQCVGRRIAELEMTLFLIHILENFKVEMQHIGDV--DTIFNLILTPDKPIFLVFRP 474
Cdd:PLN00110 439 RRICAGTRMGIVLVEYILGTLVHSFDWKLPDGVELnmDEAFGLALQKAVPLSAMVTP 495
PLN02655 PLN02655
ent-kaurene oxidase
225-425 4.76e-20

ent-kaurene oxidase


Pssm-ID: 215354  Cd Length: 466  Bit Score: 92.50  E-value: 4.76e-20
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433 225 WRDHVAAWDTIFNKAEKyTEIFYQDLRRKT---------EFRNYPG---ILYC--LLKSEKMLLED-VKANITEMLAGGV 289
Cdd:PLN02655 197 WRDFFPYLSWIPNKSFE-TRVQTTEFRRTAvmkalikqqKKRIARGeerDCYLdfLLSEATHLTDEqLMMLVWEPIIEAA 275
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433 290 NTTSMTLQWHLYEMARSLNVQEMLREEVLNA---RRQAEGDISKMlqmvPLLKASIKETLRLH-PISVTLQRYPESDLVL 365
Cdd:PLN02655 276 DTTLVTTEWAMYELAKNPDKQERLYREIREVcgdERVTEEDLPNL----PYLNAVFHETLRKYsPVPLLPPRFVHEDTTL 351
                        170       180       190       200       210       220
                 ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 315113433 366 QDYLIPAKTLVQVAIYAMGRDPAFFSSPDKFDPTRWLSKDKDLIH-FRNLGFGWGVRQCVG 425
Cdd:PLN02655 352 GGYDIPAGTQIAINIYGCNMDKKRWENPEEWDPERFLGEKYESADmYKTMAFGAGKRVCAG 412
PLN03234 PLN03234
cytochrome P450 83B1; Provisional
47-423 8.07e-19

cytochrome P450 83B1; Provisional


Pssm-ID: 178773  Cd Length: 499  Bit Score: 88.98  E-value: 8.07e-19
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433  47 YGPIYREKLGNLESVYIIHPEDVAHLFKFEGSypeRYDIPPWLAYHR---YYQKPIGvLFKKSGTWKKDRVVLNTEVMAP 123
Cdd:PLN03234  61 YGPIFTMKIGGRRLAVISSAELAKELLKTQDL---NFTARPLLKGQQtmsYQGRELG-FGQYTAYYREMRKMCMVNLFSP 136
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433 124 EAIKNFIPLLNPVSQDFVSLLHKRIKQQGSGkfvgDIKEDLFHFAFESITNVMFGERLgmleETVNPEAQKFIDAVYKMF 203
Cdd:PLN03234 137 NRVASFRPVREEECQRMMDKIYKAADQSGTV----DLSELLLSFTNCVVCRQAFGKRY----NEYGTEMKRFIDILYETQ 208
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433 204 HTSVPLLnvppeLYRLFRTKTWRDHVAAWDTIFNKAEKYTEIFYQDL--------RRKTEFRNYPGILYCLLKSE----K 271
Cdd:PLN03234 209 ALLGTLF-----FSDLFPYFGFLDNLTGLSARLKKAFKELDTYLQELldetldpnRPKQETESFIDLLMQIYKDQpfsiK 283
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433 272 MLLEDVKANITEMLAGGVNTTSMTLQW---HLYEMARSLN-VQEMLREEVLNARRQAEGDISKMlqmvPLLKASIKETLR 347
Cdd:PLN03234 284 FTHENVKAMILDIVVPGTDTAAAVVVWamtYLIKYPEAMKkAQDEVRNVIGDKGYVSEEDIPNL----PYLKAVIKESLR 359
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433 348 LHP-ISVTLQRYPESDLVLQDYLIPAKTLVQVAIYAMGRDPAFF-SSPDKFDPTRWLSKDKDL----IHFRNLGFGWGVR 421
Cdd:PLN03234 360 LEPvIPILLHRETIADAKIGGYDIPAKTIIQVNAWAVSRDTAAWgDNPNEFIPERFMKEHKGVdfkgQDFELLPFGSGRR 439

                 ..
gi 315113433 422 QC 423
Cdd:PLN03234 440 MC 441
PLN00168 PLN00168
Cytochrome P450; Provisional
13-445 1.92e-18

Cytochrome P450; Provisional


Pssm-ID: 215086  Cd Length: 519  Bit Score: 87.70  E-value: 1.92e-18
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433  13 IPSPGDNGWLNLYHFWREKGSQRIHFRhienfqkYGPIYREKLGNLESVYIIhPEDVAHLFKFEGSypERYDIPPWLAYH 92
Cdd:PLN00168  43 VPLLGSLVWLTNSSADVEPLLRRLIAR-------YGPVVSLRVGSRLSVFVA-DRRLAHAALVERG--AALADRPAVASS 112
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433  93 RYYQKPIGVLFKKS--GTWKKDRVVLNTEVMAPEAIKNFIPLLNPVSQDFVSLLHKRIKQQGSGKFVgdikeDLFHFA-F 169
Cdd:PLN00168 113 RLLGESDNTITRSSygPVWRLLRRNLVAETLHPSRVRLFAPARAWVRRVLVDKLRREAEDAAAPRVV-----ETFQYAmF 187
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433 170 ESITNVMFGERLGmlEETVNPEAQKFIDAVYKMFHTSVPLLNVPPELYRLFRTKTwrdhvaawDTIFNKAEKYTEIFYQD 249
Cdd:PLN00168 188 CLLVLMCFGERLD--EPAVRAIAAAQRDWLLYVSKKMSVFAFFPAVTKHLFRGRL--------QKALALRRRQKELFVPL 257
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433 250 LRRKTEFRNYPGILYCLLKSEKML-------LEDVKAN---------------ITEMLAGGVNTTSMTLQWHLYEMARSL 307
Cdd:PLN00168 258 IDARREYKNHLGQGGEPPKKETTFehsyvdtLLDIRLPedgdraltddeivnlCSEFLNAGTDTTSTALQWIMAELVKNP 337
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433 308 NVQEMLREEVLNA-----RRQAEGDISKMlqmvPLLKASIKETLRLHPIS-VTLQRYPESDLVLQDYLIPAKTLVQVAIY 381
Cdd:PLN00168 338 SIQSKLHDEIKAKtgddqEEVSEEDVHKM----PYLKAVVLEGLRKHPPAhFVLPHKAAEDMEVGGYLIPKGATVNFMVA 413
                        410       420       430       440       450       460       470
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 315113433 382 AMGRDPAFFSSPDKFDPTRWLS----KDKDLI---HFRNLGFGWGVRQCVGRRIAELEMTLFLIHILENFK 445
Cdd:PLN00168 414 EMGRDEREWERPMEFVPERFLAggdgEGVDVTgsrEIRMMPFGVGRRICAGLGIAMLHLEYFVANMVREFE 484
PLN02687 PLN02687
flavonoid 3'-monooxygenase
276-442 2.39e-16

flavonoid 3'-monooxygenase


Pssm-ID: 215371  Cd Length: 517  Bit Score: 81.40  E-value: 2.39e-16
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433 276 DVKANITEMLAGGVNTTSMTLQWHLYEMARSLNV----QEMLREEVLNARRQAEGDISKMlqmvPLLKASIKETLRLHPI 351
Cdd:PLN02687 297 EIKALLLNLFTAGTDTTSSTVEWAIAELIRHPDIlkkaQEELDAVVGRDRLVSESDLPQL----TYLQAVIKETFRLHPS 372
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433 352 S-VTLQRYPESDLVLQDYLIPAKTLVQVAIYAMGRDPAFFSSPDKFDPTRWLS---------KDKDlihFRNLGFGWGVR 421
Cdd:PLN02687 373 TpLSLPRMAAEECEINGYHIPKGATLLVNVWAIARDPEQWPDPLEFRPDRFLPggehagvdvKGSD---FELIPFGAGRR 449
                        170       180
                 ....*....|....*....|....*
gi 315113433 422 QCVGR----RIAELeMTLFLIHILE 442
Cdd:PLN02687 450 ICAGLswglRMVTL-LTATLVHAFD 473
PLN02196 PLN02196
abscisic acid 8'-hydroxylase
2-449 8.87e-16

abscisic acid 8'-hydroxylase


Pssm-ID: 177847  Cd Length: 463  Bit Score: 79.21  E-value: 8.87e-16
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433   2 ASTKTPRPyseipsPGDNGW------LNLYhfwrekgSQRIHFRHIENFQKYGPIYREKLGNLESVYIIHPEDV------ 69
Cdd:PLN02196  30 SSTKLPLP------PGTMGWpyvgetFQLY-------SQDPNVFFASKQKRYGSVFKTHVLGCPCVMISSPEAAkfvlvt 96
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433  70 -AHLFKfegsyperydiPPWLAYHRYYQKPIGVLFKKSGTWKKDRVVLNTEVMaPEAIKNFIPLLNPVSQDFVsllhkri 148
Cdd:PLN02196  97 kSHLFK-----------PTFPASKERMLGKQAIFFHQGDYHAKLRKLVLRAFM-PDAIRNMVPDIESIAQESL------- 157
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433 149 kQQGSGKFVG---DIKEDLFHFAFESItnvmFGErlgmlEETVNPEAQKFIDAVYKMFHTSVPLlNVPpelyrlfrtktw 225
Cdd:PLN02196 158 -NSWEGTQINtyqEMKTYTFNVALLSI----FGK-----DEVLYREDLKRCYYILEKGYNSMPI-NLP------------ 214
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433 226 rdhvaawDTIFNKAEKYTEIFYQDLRRK-TEFRNYPGILYCLLKS-----EKMLLEDVKANITEMLAGGVNTTSMTLQWH 299
Cdd:PLN02196 215 -------GTLFHKSMKARKELAQILAKIlSKRRQNGSSHNDLLGSfmgdkEGLTDEQIADNIIGVIFAARDTTASVLTWI 287
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433 300 LYEMARSLNVQEMLREEVLNARRQAE-------GDISKMlqmvPLLKASIKETLRLHPI-SVTLQRYPEsDLVLQDYLIP 371
Cdd:PLN02196 288 LKYLAENPSVLEAVTEEQMAIRKDKEegesltwEDTKKM----PLTSRVIQETLRVASIlSFTFREAVE-DVEYEGYLIP 362
                        410       420       430       440       450       460       470
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 315113433 372 AKTLVQVAIYAMGRDPAFFSSPDKFDPTRWLSKDKDLIHfrnLGFGWGVRQCVGRRIAELEMTLFLIHILENFKVEMQ 449
Cdd:PLN02196 363 KGWKVLPLFRNIHHSADIFSDPGKFDPSRFEVAPKPNTF---MPFGNGTHSCPGNELAKLEISVLIHHLTTKYRWSIV 437
PLN02394 PLN02394
trans-cinnamate 4-monooxygenase
289-444 4.93e-15

trans-cinnamate 4-monooxygenase


Pssm-ID: 215221  Cd Length: 503  Bit Score: 77.08  E-value: 4.93e-15
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433 289 VNTTSMTLQWHLYEMARSLNVQEMLREE---VLNARRQ-AEGDISKMlqmvPLLKASIKETLRLH-PISVTLQRYPESDL 363
Cdd:PLN02394 306 IETTLWSIEWGIAELVNHPEIQKKLRDEldtVLGPGNQvTEPDTHKL----PYLQAVVKETLRLHmAIPLLVPHMNLEDA 381
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433 364 VLQDYLIPAKTLVQVAIYAMGRDPAFFSSPDKFDPTRWLSKDKDL----IHFRNLGFGWGVRQCVGRRIAELEMTLFLIH 439
Cdd:PLN02394 382 KLGGYDIPAESKILVNAWWLANNPELWKNPEEFRPERFLEEEAKVeangNDFRFLPFGVGRRSCPGIILALPILGIVLGR 461

                 ....*
gi 315113433 440 ILENF 444
Cdd:PLN02394 462 LVQNF 466
P450_cycloAA_1 TIGR04538
cytochrome P450, cyclodipeptide synthase-associated; Members of this subfamily are cytochrome ...
209-451 8.62e-14

cytochrome P450, cyclodipeptide synthase-associated; Members of this subfamily are cytochrome P450 enzymes that occur next to tRNA-dependent cyclodipeptide synthases. This group does NOT include CYP121 (Rv2275) from Mycobacterium tuberculosis, adjacent to the cyclodityrosine synthetase Rv2276.


Pssm-ID: 275331  Cd Length: 395  Bit Score: 72.83  E-value: 8.62e-14
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433  209 LLNVPPELYRLFRTktWRDHVAAWDTIFNKAEkyTEIFYQ---------------DLRRKTEFRNYPGILyCLLKSEKML 273
Cdd:TIGR04538 135 LLGLDKRDHEKIRE--WHSGIAKFITSLNQSP--EERMHSlecseklreylmpiiEERRKNPGSDLISIL-CTSEDEGNA 209
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433  274 LED--VKANITEMLAGGVNTTSMTLQWHLYEMarsLNVQEMLrEEVLNARRqaegdiskmlqmvpLLKASIKETLRLHPI 351
Cdd:TIGR04538 210 MSDteILALILNILLAATEPADKTLAYMIYHL---LNNPEQL-NDVLDDRK--------------LLRRAIAETLRLHSP 271
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433  352 SVTLQRYPESDLVLQDYLIPAKTLVQVAIYAMGRDPAFFSSPDKFDPTR--WLSKDKDLIHFRNLGFGWGVRQCVGRRIA 429
Cdd:TIGR04538 272 VQLIPRQLSQDVTISGKEIKKGDTVFCMIGAANRDPEAFEDPDEFNIHRkdLVNKSAFTGAARHLAFGSGVHNCVGAAFA 351
                         250       260
                  ....*....|....*....|....*
gi 315113433  430 --ELEMTL-FLIHILENFKVEMQHI 451
Cdd:TIGR04538 352 krQLEIVAnILLDLLKNIRLEEDFS 376
PLN02936 PLN02936
epsilon-ring hydroxylase
260-448 1.96e-13

epsilon-ring hydroxylase


Pssm-ID: 178524  Cd Length: 489  Bit Score: 72.13  E-value: 1.96e-13
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433 260 PGILYCLLKS-EKMLLEDVKANITEMLAGGVNTTSMTLQWHLYEMARSLNVQEMLREE---VLNARRQAEGDISKMlqmv 335
Cdd:PLN02936 261 PSVLRFLLASrEEVSSVQLRDDLLSMLVAGHETTGSVLTWTLYLLSKNPEALRKAQEEldrVLQGRPPTYEDIKEL---- 336
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433 336 PLLKASIKETLRLHP-ISVTLQRYPESDLVLQDYLIPAKTLVQVAIYAMGRDPAFFSSPDKFDPTRW---------LSKD 405
Cdd:PLN02936 337 KYLTRCINESMRLYPhPPVLIRRAQVEDVLPGGYKVNAGQDIMISVYNIHRSPEVWERAEEFVPERFdldgpvpneTNTD 416
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|...
gi 315113433 406 kdlihFRNLGFGWGVRQCVGRRIAELEMTLFLIHILENFKVEM 448
Cdd:PLN02936 417 -----FRYIPFSGGPRKCVGDQFALLEAIVALAVLLQRLDLEL 454
PLN02500 PLN02500
cytochrome P450 90B1
234-448 1.21e-12

cytochrome P450 90B1


Pssm-ID: 215276  Cd Length: 490  Bit Score: 69.51  E-value: 1.21e-12
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433 234 TIFNKAEKYTEIFYQDLRRKTEFRNYPGILYCLLKSEKMLLEDVKANITEMLAGGVNTTSMTLQWHLYEMARSLNVQEML 313
Cdd:PLN02500 237 TILKFIERKMEERIEKLKEEDESVEEDDLLGWVLKHSNLSTEQILDLILSLLFAGHETSSVAIALAIFFLQGCPKAVQEL 316
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433 314 REEVLN-ARRQAEGDISKM----LQMVPLLKASIKETLRLHPISVTLQRYPESDLVLQDYLIPAKTLVQVAIYAMGRDPA 388
Cdd:PLN02500 317 REEHLEiARAKKQSGESELnwedYKKMEFTQCVINETLRLGNVVRFLHRKALKDVRYKGYDIPSGWKVLPVIAAVHLDSS 396
                        170       180       190       200       210       220       230
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433 389 FFSSPDKFDPTRWL----------SKDKDLIHFrnLGFGWGVRQCVGRRIAELEMTLFLIHILENFKVEM 448
Cdd:PLN02500 397 LYDQPQLFNPWRWQqnnnrggssgSSSATTNNF--MPFGGGPRLCAGSELAKLEMAVFIHHLVLNFNWEL 464
PLN02302 PLN02302
ent-kaurenoic acid oxidase
327-447 1.47e-12

ent-kaurenoic acid oxidase


Pssm-ID: 215171  Cd Length: 490  Bit Score: 69.36  E-value: 1.47e-12
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433 327 DISKMlqmvPLLKASIKETLRLHPISVTLQRYPESDLVLQDYLIPAKTLVQVAIYAMGRDPAFFSSPDKFDPTRWlsKDK 406
Cdd:PLN02302 346 DVRKM----EYLSQVIDETLRLINISLTVFREAKTDVEVNGYTIPKGWKVLAWFRQVHMDPEVYPNPKEFDPSRW--DNY 419
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|.
gi 315113433 407 DLIHFRNLGFGWGVRQCVGRRIAELEMTLFLIHILENFKVE 447
Cdd:PLN02302 420 TPKAGTFLPFGLGSRLCPGNDLAKLEISIFLHHFLLGYRLE 460
PLN02738 PLN02738
carotene beta-ring hydroxylase
248-448 1.59e-12

carotene beta-ring hydroxylase


Pssm-ID: 215393 [Multi-domain]  Cd Length: 633  Bit Score: 69.56  E-value: 1.59e-12
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433 248 QDLRRKTEFRNY--PGILYCLLK-----SEKMLLEDvkanITEMLAGGVNTTSMTLQWHLYEMARSLNVQEMLREEVlna 320
Cdd:PLN02738 360 EELQFHEEYMNErdPSILHFLLAsgddvSSKQLRDD----LMTMLIAGHETSAAVLTWTFYLLSKEPSVVAKLQEEV--- 432
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433 321 rRQAEGDISKMLQMVPLLKAS---IKETLRLHPIS-VTLQRYPESDlVLQDYLIPAKTLVQVAIYAMGRDPAFFSSPDKF 396
Cdd:PLN02738 433 -DSVLGDRFPTIEDMKKLKYTtrvINESLRLYPQPpVLIRRSLEND-MLGGYPIKRGEDIFISVWNLHRSPKHWDDAEKF 510
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|....*.
gi 315113433 397 DPTRW----LSKDKDLIHFRNLGFGWGVRQCVGRRIAELEMTLFLIHILENFKVEM 448
Cdd:PLN02738 511 NPERWpldgPNPNETNQNFSYLPFGGGPRKCVGDMFASFENVVATAMLVRRFDFQL 566
PLN02966 PLN02966
cytochrome P450 83A1
45-448 2.50e-12

cytochrome P450 83A1


Pssm-ID: 178550  Cd Length: 502  Bit Score: 68.62  E-value: 2.50e-12
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433  45 QKYGPIYREKLGNLESVYIIHPEDVAHLFKFEG-SYPERydiPPWLAyHRY--YQKPIGVLFKKSGTWKKDRVVLNTEVM 121
Cdd:PLN02966  60 KKYGPILSYRIGSRTMVVISSAELAKELLKTQDvNFADR---PPHRG-HEFisYGRRDMALNHYTPYYREIRKMGMNHLF 135
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433 122 APEAIKNFipllNPVSQDFVSLLHKRIKQQGSGKFVGDIKEDLFHFAFESITNVMFGERLGMLEEtvnpEAQKFIDAVYK 201
Cdd:PLN02966 136 SPTRVATF----KHVREEEARRMMDKINKAADKSEVVDISELMLTFTNSVVCRQAFGKKYNEDGE----EMKRFIKILYG 207
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433 202 mfhTSVPLLNVppELYRLFRTKTWRDHVAAWDTIFNKAEKYTEIFYQDL--------RRKTEFRNYPGILYCLLKSE--- 270
Cdd:PLN02966 208 ---TQSVLGKI--FFSDFFPYCGFLDDLSGLTAYMKECFERQDTYIQEVvnetldpkRVKPETESMIDLLMEIYKEQpfa 282
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433 271 -KMLLEDVKANITEMLAGGVNTTSMTLQWHLYEMARSLNVQEMLREEVLNARRQ------AEGDISKMlqmvPLLKASIK 343
Cdd:PLN02966 283 sEFTVDNVKAVILDIVVAGTDTAAAAVVWGMTYLMKYPQVLKKAQAEVREYMKEkgstfvTEDDVKNL----PYFRALVK 358
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433 344 ETLRLHP-ISVTLQRYPESDLVLQDYLIPAKTLVQVAIYAMGRDPAFFS-SPDKFDPTRWLSKDKDL--IHFRNLGFGWG 419
Cdd:PLN02966 359 ETLRIEPvIPLLIPRACIQDTKIAGYDIPAGTTVNVNAWAVSRDEKEWGpNPDEFRPERFLEKEVDFkgTDYEFIPFGSG 438
                        410       420
                 ....*....|....*....|....*....
gi 315113433 420 VRQCVGRRIAELEMTLFLIHILENFKVEM 448
Cdd:PLN02966 439 RRMCPGMRLGAAMLEVPYANLLLNFNFKL 467
PLN02971 PLN02971
tryptophan N-hydroxylase
275-445 3.93e-12

tryptophan N-hydroxylase


Pssm-ID: 166612  Cd Length: 543  Bit Score: 68.14  E-value: 3.93e-12
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433 275 EDVKANITEMLAGGVNTTSMTLQWHLYEMarsLNVQEMLR---EE----VLNARRQAEGDISKMlqmvPLLKASIKETLR 347
Cdd:PLN02971 326 DEIKPTIKELVMAAPDNPSNAVEWAMAEM---INKPEILHkamEEidrvVGKERFVQESDIPKL----NYVKAIIREAFR 398
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433 348 LHPISV-TLQRYPESDLVLQDYLIPAKTLVQVAIYAMGRDPAFFSSPDKFDPTRWLSKDKDLI----HFRNLGFGWGVRQ 422
Cdd:PLN02971 399 LHPVAAfNLPHVALSDTTVAGYHIPKGSQVLLSRYGLGRNPKVWSDPLSFKPERHLNECSEVTltenDLRFISFSTGKRG 478
                        170       180
                 ....*....|....*....|...
gi 315113433 423 CVGRRIAELEMTLFLIHILENFK 445
Cdd:PLN02971 479 CAAPALGTAITTMMLARLLQGFK 501
PLN03018 PLN03018
homomethionine N-hydroxylase
275-444 4.08e-12

homomethionine N-hydroxylase


Pssm-ID: 178592  Cd Length: 534  Bit Score: 68.11  E-value: 4.08e-12
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433 275 EDVKANITEMLAGGVNTTSMTLQWHLYEMARSlnvQEMLR------EEVLNARRQA-EGDISKMlqmvPLLKASIKETLR 347
Cdd:PLN03018 313 DEIKAQCVEFCIAAIDNPANNMEWTLGEMLKN---PEILRkalkelDEVVGKDRLVqESDIPNL----NYLKACCRETFR 385
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433 348 LHPISVTLQRY-PESDLVLQDYLIPAKTLVQVAIYAMGRDPAFFSSPDKFDPTRWL-----SKDKDLI--HFRNLGFGWG 419
Cdd:PLN03018 386 IHPSAHYVPPHvARQDTTLGGYFIPKGSHIHVCRPGLGRNPKIWKDPLVYEPERHLqgdgiTKEVTLVetEMRFVSFSTG 465
                        170       180
                 ....*....|....*....|....*
gi 315113433 420 VRQCVGRRIAELEMTLFLIHILENF 444
Cdd:PLN03018 466 RRGCVGVKVGTIMMVMMLARFLQGF 490
PLN02169 PLN02169
fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase
254-462 1.66e-11

fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase


Pssm-ID: 177826  Cd Length: 500  Bit Score: 66.18  E-value: 1.66e-11
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433 254 TEFRNYPGILYCLLKSEK-MLLEDVkanITEMLAGGVNTTSMTLQWHLYEMARSLNVQEMLREEVlNARRQAEgDISKML 332
Cdd:PLN02169 281 TYYMNVDTSKYKLLKPKKdKFIRDV---IFSLVLAGRDTTSSALTWFFWLLSKHPQVMAKIRHEI-NTKFDNE-DLEKLV 355
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433 333 qmvpLLKASIKETLRLHPISVTLQRYP-ESDLVLQDYLIPAKTLVQVAIYAMGRDPAFF-SSPDKFDPTRWLSKDKDLIH 410
Cdd:PLN02169 356 ----YLHAALSESMRLYPPLPFNHKAPaKPDVLPSGHKVDAESKIVICIYALGRMRSVWgEDALDFKPERWISDNGGLRH 431
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|....*
gi 315113433 411 ---FRNLGFGWGVRQCVGRRIAELEMTLFLIHILENFKVEMQHIGDVDTIFNLIL 462
Cdd:PLN02169 432 epsYKFMAFNSGPRTCLGKHLALLQMKIVALEIIKNYDFKVIEGHKIEAIPSILL 486
PLN03195 PLN03195
fatty acid omega-hydroxylase; Provisional
34-448 4.65e-11

fatty acid omega-hydroxylase; Provisional


Pssm-ID: 215627  Cd Length: 516  Bit Score: 64.80  E-value: 4.65e-11
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433  34 QRIHFRHIENFQKyGPIYREKLGNLESVYIIHPEDVAHLFKFEGSyperyDIPPWLAYHRYYQKPIGV-LFKKSG-TWKK 111
Cdd:PLN03195  52 DRMHDWLVEYLSK-DRTVVVKMPFTTYTYIADPVNVEHVLKTNFA-----NYPKGEVYHSYMEVLLGDgIFNVDGeLWRK 125
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433 112 DRVVLNTEVmapeAIKNFIPLLNPVSQDFVSLLHKRIKQQGSGKFVGDIKEDLFHFAFESITNVMFGERLGMLEETV--N 189
Cdd:PLN03195 126 QRKTASFEF----ASKNLRDFSTVVFREYSLKLSSILSQASFANQVVDMQDLFMRMTLDSICKVGFGVEIGTLSPSLpeN 201
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433 190 PEAQ-----------KFIDAVYKMFHtsvpLLNVPPElyrlfrtktwrdhvaawdTIFNKAEKYTEIFYQDL--RRKTEF 256
Cdd:PLN03195 202 PFAQafdtaniivtlRFIDPLWKLKK----FLNIGSE------------------ALLSKSIKVVDDFTYSVirRRKAEM 259
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433 257 RNYPGILYCL---LKSEKMLL-EDVKANITE---------MLAGGVNTTSMTLQWHLYEMARSLNVQEMLR------EEV 317
Cdd:PLN03195 260 DEARKSGKKVkhdILSRFIELgEDPDSNFTDkslrdivlnFVIAGRDTTATTLSWFVYMIMMNPHVAEKLYselkalEKE 339
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433 318 LNARRQAEGDIS---KMLQMVPLLK-----------ASIKETLRLHPISVTLQRYPESDLVLQD-YLIPAKTLVQVAIYA 382
Cdd:PLN03195 340 RAKEEDPEDSQSfnqRVTQFAGLLTydslgklqylhAVITETLRLYPAVPQDPKGILEDDVLPDgTKVKAGGMVTYVPYS 419
                        410       420       430       440       450       460       470
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 315113433 383 MGRDPAFFsSPD--KFDPTRWLsKD---KDLIHFRNLGFGWGVRQCVGRRIAELEMTLFLIHILENFKVEM 448
Cdd:PLN03195 420 MGRMEYNW-GPDaaSFKPERWI-KDgvfQNASPFKFTAFQAGPRICLGKDSAYLQMKMALALLCRFFKFQL 488
PLN02774 PLN02774
brassinosteroid-6-oxidase
262-447 6.50e-11

brassinosteroid-6-oxidase


Pssm-ID: 178373  Cd Length: 463  Bit Score: 64.03  E-value: 6.50e-11
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433 262 ILYCLLKSE----KMLLEDVKANITEMLAGG---VNTTSMTLQWHLYEMARSLnvqEMLREEVL--NARRQAEGDIS-KM 331
Cdd:PLN02774 246 MLGYLMRKEgnryKLTDEEIIDQIITILYSGyetVSTTSMMAVKYLHDHPKAL---QELRKEHLaiRERKRPEDPIDwND 322
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433 332 LQMVPLLKASIKETLRLHPISVTLQRYPESDLVLQDYLIPAKTLVQVAIYAMGRDPAFFSSPDKFDPTRWLskDKDL-IH 410
Cdd:PLN02774 323 YKSMRFTRAVIFETSRLATIVNGVLRKTTQDMELNGYVIPKGWRIYVYTREINYDPFLYPDPMTFNPWRWL--DKSLeSH 400
                        170       180       190
                 ....*....|....*....|....*....|....*..
gi 315113433 411 FRNLGFGWGVRQCVGRRIAELEMTLFLIHILENFKVE 447
Cdd:PLN02774 401 NYFFLFGGGTRLCPGKELGIVEISTFLHYFVTRYRWE 437
PLN03141 PLN03141
3-epi-6-deoxocathasterone 23-monooxygenase; Provisional
269-459 1.16e-09

3-epi-6-deoxocathasterone 23-monooxygenase; Provisional


Pssm-ID: 215600  Cd Length: 452  Bit Score: 60.14  E-value: 1.16e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433 269 SEKMLLEDVKANITEMLAGGVNT--TSMTLQW-HLYEMARSLNvqeMLREEVLNARRQAEgDISKMLQ-----MVPLLKA 340
Cdd:PLN03141 244 SDELTDDLISDNMIDMMIPGEDSvpVLMTLAVkFLSDCPVALQ---QLTEENMKLKRLKA-DTGEPLYwtdymSLPFTQN 319
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433 341 SIKETLRLHPISVTLQRYPESDLVLQDYLIPAKTLVQVAIYAMGRDPAFFSSPDKFDPTRWLSKDKDLIHFRNlgFGWGV 420
Cdd:PLN03141 320 VITETLRMGNIINGVMRKAMKDVEIKGYLIPKGWCVLAYFRSVHLDEENYDNPYQFNPWRWQEKDMNNSSFTP--FGGGQ 397
                        170       180       190
                 ....*....|....*....|....*....|....*....
gi 315113433 421 RQCVGRRIAELEMTLFLIHILENFKvemqHIGDVDTIFN 459
Cdd:PLN03141 398 RLCPGLDLARLEASIFLHHLVTRFR----WVAEEDTIVN 432
PLN02290 PLN02290
cytokinin trans-hydroxylase
288-445 5.77e-08

cytokinin trans-hydroxylase


Pssm-ID: 215164  Cd Length: 516  Bit Score: 54.82  E-value: 5.77e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433 288 GVNTTSMTLQWHLYEMARSLNVQEMLREEV---LNARRQAEGDISKM--LQMVpllkasIKETLRLHPISVTLQRYPESD 362
Cdd:PLN02290 328 GHETTALLLTWTLMLLASNPTWQDKVRAEVaevCGGETPSVDHLSKLtlLNMV------INESLRLYPPATLLPRMAFED 401
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433 363 LVLQDYLIPAKTLVQVAIYAMGRDPAFF-SSPDKFDPTRWLSKD-KDLIHFrnLGFGWGVRQCVGRRIAELEMTLFLIHI 440
Cdd:PLN02290 402 IKLGDLHIPKGLSIWIPVLAIHHSEELWgKDANEFNPDRFAGRPfAPGRHF--IPFAAGPRNCIGQAFAMMEAKIILAML 479

                 ....*
gi 315113433 441 LENFK 445
Cdd:PLN02290 480 ISKFS 484
P450_rel_GT_act TIGR04515
P450-derived glycosyltranferase activator; Members of this family resemble cytochrome P450 by ...
340-400 2.93e-07

P450-derived glycosyltranferase activator; Members of this family resemble cytochrome P450 by homolog, but lack a critical heme-binding Cys residue. Members in general are encoded next to a glycosyltransferase gene in a natural products biosynthesis cluster, physically interact with it, and help the glycosyltransferase achieve high specificity while retaining high activity. Many members of this family assist in the attachment of a sugar moiety to a natural product such as a polyketide.


Pssm-ID: 275308  Cd Length: 384  Bit Score: 52.34  E-value: 2.93e-07
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 315113433  340 ASIKETLRLHPiSVTLQ-RYPESDLVLQDYLIPAKTLVQVAIYAMGRDPAFFSSPDKFDPTR 400
Cdd:TIGR04515 261 AAVEETLRHAP-PVRLEsRVAREDLELAGQRIPAGDHVVVLVAAANRDPAVFADPDRFDPDR 321
CYP450_TxtE TIGR04458
4-nitrotryptophan synthase; Members of this family are cytochrome P450 enzymes that convert ...
357-444 5.61e-07

4-nitrotryptophan synthase; Members of this family are cytochrome P450 enzymes that convert L-tryptophan into L-4-nitrotryptophan. In thaxtomin gene clusters, this enzyme (TxtE) uses nitric acid (NO) derived from arginine by the nitric oxide synthase TxtD, and O2, to perform the tryptophan nitration. L-4-nitrotryptophan is then used as a non-proteinogenic amino acid by non-ribosomal peptide synthases (NRPS).


Pssm-ID: 275251  Cd Length: 403  Bit Score: 51.41  E-value: 5.61e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433  357 RYPESDLVLQDYLIPAKTLVQVAIYAMGRDPAFFSSPDKFDPTRWLSKdkdlihfRNLGFGWGVRQCVGRRIAELEMTLF 436
Cdd:TIGR04458 295 RVATTDVDMGGVRIKAGQAVALFLGAANRDPEVFERPNDFDLDRPNSG-------RHLSFGQGVHACLGRQIASLQLKWF 367

                  ....*...
gi 315113433  437 LIHILENF 444
Cdd:TIGR04458 368 FVALLGRF 375
PLN02987 PLN02987
Cytochrome P450, family 90, subfamily A
275-444 9.96e-07

Cytochrome P450, family 90, subfamily A


Pssm-ID: 166628  Cd Length: 472  Bit Score: 51.13  E-value: 9.96e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433 275 EDVKANITEMLAGGVNTTSMTLQWHLYEMARSLNVQEMLREE--VLNARRQAEGDIS-KMLQMVPLLKASIKETLRLHPI 351
Cdd:PLN02987 266 EEIVDFLVALLVAGYETTSTIMTLAVKFLTETPLALAQLKEEheKIRAMKSDSYSLEwSDYKSMPFTQCVVNETLRVANI 345
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433 352 SVTLQRYPESDLVLQDYLIPAKTLVQVAIYAMGRDPAFFSSPDKFDPTRWLSKDKDLIHFRNLG-FGWGVRQCVGRRIAE 430
Cdd:PLN02987 346 IGGIFRRAMTDIEVKGYTIPKGWKVFASFRAVHLDHEYFKDARTFNPWRWQSNSGTTVPSNVFTpFGGGPRLCPGYELAR 425
                        170
                 ....*....|....
gi 315113433 431 LEMTLFLIHILENF 444
Cdd:PLN02987 426 VALSVFLHRLVTRF 439
PLN02426 PLN02426
cytochrome P450, family 94, subfamily C protein
119-447 1.32e-06

cytochrome P450, family 94, subfamily C protein


Pssm-ID: 215235  Cd Length: 502  Bit Score: 50.46  E-value: 1.32e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433 119 EVMAPEAIKNFIPLLNPVSQDfvsllhkrikqqGSGKFVgDIKEDLFHFAFESITNVMFGERLGMLEETVnpEAQKFIDA 198
Cdd:PLN02426 153 EIVASEIESRLLPLLSSAADD------------GEGAVL-DLQDVFRRFSFDNICKFSFGLDPGCLELSL--PISEFADA 217
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433 199 vykmFHTSVPL-----LNVPPELY---RLFRTKTWRDhvaawdtiFNKAEKYTEIFYQDL---RRKTEFRNYPGIL---Y 264
Cdd:PLN02426 218 ----FDTASKLsaeraMAASPLLWkikRLLNIGSERK--------LKEAIKLVDELAAEVirqRRKLGFSASKDLLsrfM 285
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433 265 CLLKSEKMLLEDVkanITEMLAGGvNTTSMTLQWHLYEMARSLNVQEMLREEV--LNARRQAEGDISKMLQMvPLLKASI 342
Cdd:PLN02426 286 ASINDDKYLRDIV---VSFLLAGR-DTVASALTSFFWLLSKHPEVASAIREEAdrVMGPNQEAASFEEMKEM-HYLHAAL 360
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433 343 KETLRLHPISVTLQRYPESDLVLQD-YLIPAKTLVQVAIYAMGRDPAFFSsPD--KFDPTRWLSKDKDLIH--FRNLGFG 417
Cdd:PLN02426 361 YESMRLFPPVQFDSKFAAEDDVLPDgTFVAKGTRVTYHPYAMGRMERIWG-PDclEFKPERWLKNGVFVPEnpFKYPVFQ 439
                        330       340       350
                 ....*....|....*....|....*....|
gi 315113433 418 WGVRQCVGRRIAELEMTLFLIHILENFKVE 447
Cdd:PLN02426 440 AGLRVCLGKEMALMEMKSVAVAVVRRFDIE 469
PLN02648 PLN02648
allene oxide synthase
309-405 2.76e-04

allene oxide synthase


Pssm-ID: 215350  Cd Length: 480  Bit Score: 43.00  E-value: 2.76e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 315113433 309 VQEMLREEVLNARRQAEGDIS-KMLQMVPLLKASIKETLRLHPiSVTLQrY--PESDLVLQ--DYLIPAKT---LVQVAI 380
Cdd:PLN02648 306 LQARLAEEVRSAVKAGGGGVTfAALEKMPLVKSVVYEALRIEP-PVPFQ-YgrAREDFVIEshDAAFEIKKgemLFGYQP 383
                         90       100
                 ....*....|....*....|....*
gi 315113433 381 YAMgRDPAFFSSPDKFDPTRWLSKD 405
Cdd:PLN02648 384 LVT-RDPKVFDRPEEFVPDRFMGEE 407
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH