NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|341940483|sp|P51906|]
View 

Protein Classification

dicarboxylate/amino acid:cation symporter (domain architecture ID 10448728)

dicarboxylate/amino acid:cation symporter facilitates H+ or Na+ symport with C4-dicarboxylates, dicarboxylic amino acids (aspartate, glutamate) or other amino acids; belongs to the sodium:dicarboxylate symporter family

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
SDF pfam00375
Sodium:dicarboxylate symporter family;
51-464 9.09e-118

Sodium:dicarboxylate symporter family;


:

Pssm-ID: 395299 [Multi-domain]  Cd Length: 388  Bit Score: 352.21  E-value: 9.09e-118
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 341940483   51 YFAFPGEILMRMLKLVILPLIVSSMITGVAAL-DSNVSGKIGLRAVVYYFSTTVIAVILGIVLVVSIKPGVTQkvNDINR 129
Cdd:pfam00375  25 WLSPLGDLFIRLLKMIIVPLIFASIISGIASLgDGKKLGKLGGKTLLYFLVTTAIAALIGLLVANIFQPGSGL--ALIAA 102
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 341940483  130 TGKTPEVSTMDAMLDLIRNMFPENLVQACFQQyktkreevkpvgdpggnatevsvttamttmsenktkeykivglysdgi 209
Cdd:pfam00375 103 AAEEAKAAEAPSLLDFILNIIPSNIFEALAEG------------------------------------------------ 134
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 341940483  210 NVLGLIIFCLVFGLVIGKMGEKGQILVDFFNALSDATMKIVQIIMCYMPIGILFLIAGKIIEvEDWEIFRKLGLYMATVL 289
Cdd:pfam00375 135 NVLQVIVFAILFGIALAALGEKGEPLLNFIESLQEVMMKVVGWVMKLAPIGVFALIANTVGT-YGLGTLGSLAKFLLAVY 213
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 341940483  290 SGLAIHSLIVLPLLYFIVVRKNPFRFALGMAQALLTALMISSSSATLPVTFRCAEEKNQVDKRITRFVLPVGATINMDGT 369
Cdd:pfam00375 214 LGLAIHLLIVYPLLLKFLGKINPFKFLKKMLPALLTAFSTASSAATLPVTLECAEKNLGVSKSIASFVLPLGATINMDGT 293
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 341940483  370 ALYEAVAAVFIAQLNGLDLSIGQIVTISITATAASIGAAGVPQAGLVTMVIVLSAVGLPAEDVTLIIAVDWLLDRFRTMV 449
Cdd:pfam00375 294 AIYLAVAAIFIAQAYGVDLSFGQQLTLVLTATLASIGAAGVPGGGLVALGLVLSALGLPLEGIALILAIDRLLDMFRTAV 373
                         410
                  ....*....|....*
gi 341940483  450 NVLGDAFGTGIVEKL 464
Cdd:pfam00375 374 NVTGDAAAAVIVAKL 388
 
Name Accession Description Interval E-value
SDF pfam00375
Sodium:dicarboxylate symporter family;
51-464 9.09e-118

Sodium:dicarboxylate symporter family;


Pssm-ID: 395299 [Multi-domain]  Cd Length: 388  Bit Score: 352.21  E-value: 9.09e-118
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 341940483   51 YFAFPGEILMRMLKLVILPLIVSSMITGVAAL-DSNVSGKIGLRAVVYYFSTTVIAVILGIVLVVSIKPGVTQkvNDINR 129
Cdd:pfam00375  25 WLSPLGDLFIRLLKMIIVPLIFASIISGIASLgDGKKLGKLGGKTLLYFLVTTAIAALIGLLVANIFQPGSGL--ALIAA 102
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 341940483  130 TGKTPEVSTMDAMLDLIRNMFPENLVQACFQQyktkreevkpvgdpggnatevsvttamttmsenktkeykivglysdgi 209
Cdd:pfam00375 103 AAEEAKAAEAPSLLDFILNIIPSNIFEALAEG------------------------------------------------ 134
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 341940483  210 NVLGLIIFCLVFGLVIGKMGEKGQILVDFFNALSDATMKIVQIIMCYMPIGILFLIAGKIIEvEDWEIFRKLGLYMATVL 289
Cdd:pfam00375 135 NVLQVIVFAILFGIALAALGEKGEPLLNFIESLQEVMMKVVGWVMKLAPIGVFALIANTVGT-YGLGTLGSLAKFLLAVY 213
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 341940483  290 SGLAIHSLIVLPLLYFIVVRKNPFRFALGMAQALLTALMISSSSATLPVTFRCAEEKNQVDKRITRFVLPVGATINMDGT 369
Cdd:pfam00375 214 LGLAIHLLIVYPLLLKFLGKINPFKFLKKMLPALLTAFSTASSAATLPVTLECAEKNLGVSKSIASFVLPLGATINMDGT 293
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 341940483  370 ALYEAVAAVFIAQLNGLDLSIGQIVTISITATAASIGAAGVPQAGLVTMVIVLSAVGLPAEDVTLIIAVDWLLDRFRTMV 449
Cdd:pfam00375 294 AIYLAVAAIFIAQAYGVDLSFGQQLTLVLTATLASIGAAGVPGGGLVALGLVLSALGLPLEGIALILAIDRLLDMFRTAV 373
                         410
                  ....*....|....*
gi 341940483  450 NVLGDAFGTGIVEKL 464
Cdd:pfam00375 374 NVTGDAAAAVIVAKL 388
GltP COG1301
Na+/H+-dicarboxylate symporter [Energy production and conversion];
51-471 9.31e-91

Na+/H+-dicarboxylate symporter [Energy production and conversion];


Pssm-ID: 224220 [Multi-domain]  Cd Length: 415  Bit Score: 283.73  E-value: 9.31e-91
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 341940483  51 YFAFPGEILMRMLKLVILPLIVSSMITGVAAL-DSNVSGKIGLRAVVYYFSTTVIAVILGIVLVVSIKPGVTQkvnDINR 129
Cdd:COG1301   34 YLKPLGDIFIKLIKMIIIPLVFFTLVLGIASLgDLKKLGRLGGKTLIYFLVTTTLAIAIGLVVANVLQPGAGI---NIDP 110
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 341940483 130 TGKTPEVSTMDAMLDLIRNMFPENLVQAcfqqyktkreevkpvgdpggnatevsvttamttMSENktkeykivglysdgi 209
Cdd:COG1301  111 ATLDTGAESEVSILDFLLDIIPTNIFGA---------------------------------LAEG--------------- 142
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 341940483 210 NVLGLIIFCLVFGLVIGKMGEKGQ-ILVDFFNALSDATMKIVQIIMCYMPIGILFLIAGKIIEvEDWEIFRKLGLYMATV 288
Cdd:COG1301  143 NVLQILFFAILFGLALAALGEKGKpPVENLFESLSEAMFKVTNFVMRLAPIGVFGLMAFTVAK-YGFGSLLSLGKLVLAV 221
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 341940483 289 LSGLAIHSLIVLPLLYFIVVRKNPFRFALGMAQALLTALMISSSSATLPVTFRCAEEKNQVDKRITRFVLPVGATINMDG 368
Cdd:COG1301  222 YLGLLLFVFVVLGLLLKLLSGFSPFKFLRYISEALLLAFSTSSSEATLPVTMEKAEKSLGVPKSIVSFVVPLGYTFNLDG 301
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 341940483 369 TALYEAVAAVFIAQLNGLDLSIGQIVTISITATAASIGAAGVPQAGLVTMVIVLSAVGLPAEDVTLIIAVDWLLDRFRTM 448
Cdd:COG1301  302 TAIYQTLAALFIAQAYGIPLSLGQQLTLLLVAMLASKGAAGVPGGGLVVLAATLSSVGLPLEGLALILGIDRFLDMARTA 381
                        410       420
                 ....*....|....*....|...
gi 341940483 449 VNVLGDAFGTGIVEKLSKKELEQ 471
Cdd:COG1301  382 TNVTGDAVATVVVAKWEGEEKAD 404
gltP PRK11283
glutamate/aspartate:proton symporter; Provisional
56-463 3.64e-40

glutamate/aspartate:proton symporter; Provisional


Pssm-ID: 183075 [Multi-domain]  Cd Length: 437  Bit Score: 150.68  E-value: 3.64e-40
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 341940483  56 GEILMRMLKLVILPLIVSSMITGVAAL-DSNVSGKIGLRAVVYYFSTTVIAVILGIVLVVSIKPGV-----TQKVNDINR 129
Cdd:PRK11283  45 GDIFIHLIKMIVVPIVISTLIVGIAGVgDAKQLGRIGAKTIIYFEVITTVAIILGITLANVFQPGAgidmsQLATVDISK 124
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 341940483 130 TGKTPEV--STMDAMLDLIRNMFPENLVQAcfqqykTKREEVKPVgdpggnatevsvttamttmsenktkeykivglysd 207
Cdd:PRK11283 125 YQSTTEEvqSHSHGLMGTILSLIPTNIFAS------MAKGEMLPI----------------------------------- 163
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 341940483 208 ginvlglIIFCLVFGLVIGKMGEK-GQILVDFFNALSDATMKIVQIIMCYMPIGILFLIAgkiIEVEDWEIFRKLGLYMA 286
Cdd:PRK11283 164 -------IFFSVLFGLGLSSLPAThREPLVTVFRSVSETMFKVTHMVMRYAPVGVFALIA---VTVANFGFASLWPLAKL 233
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 341940483 287 TVLSGLAI--HSLIVLPLLYFIVvRKNPFRFALGMAQALLTALMISSSSATLPvtfRCAE--EKNQVDKRITRFVLPVGA 362
Cdd:PRK11283 234 VLLVYFAIlfFALVVLGIVARLC-GLSIWILIRILKDELILAYSTASSETVLP---RIIEkmEAYGAPKSITSFVVPTGY 309
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 341940483 363 TINMDGTALYEAVAAVFIAQLNGLDLSIGQIVTISITATAASIGAAGVPQAGLVTMVIVLSAVGLPAEDVTLIIAVDWLL 442
Cdd:PRK11283 310 SFNLDGSTLYQSIAAIFIAQLYGIDLSIWQEIILVLTLMVTSKGIAGVPGVSFVVLLATLGSVGIPLEGLAFIAGVDRIL 389
                        410       420
                 ....*....|....*....|.
gi 341940483 443 DRFRTMVNVLGDAFGTGIVEK 463
Cdd:PRK11283 390 DMARTALNVVGNALAVLVIAK 410
 
Name Accession Description Interval E-value
SDF pfam00375
Sodium:dicarboxylate symporter family;
51-464 9.09e-118

Sodium:dicarboxylate symporter family;


Pssm-ID: 395299 [Multi-domain]  Cd Length: 388  Bit Score: 352.21  E-value: 9.09e-118
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 341940483   51 YFAFPGEILMRMLKLVILPLIVSSMITGVAAL-DSNVSGKIGLRAVVYYFSTTVIAVILGIVLVVSIKPGVTQkvNDINR 129
Cdd:pfam00375  25 WLSPLGDLFIRLLKMIIVPLIFASIISGIASLgDGKKLGKLGGKTLLYFLVTTAIAALIGLLVANIFQPGSGL--ALIAA 102
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 341940483  130 TGKTPEVSTMDAMLDLIRNMFPENLVQACFQQyktkreevkpvgdpggnatevsvttamttmsenktkeykivglysdgi 209
Cdd:pfam00375 103 AAEEAKAAEAPSLLDFILNIIPSNIFEALAEG------------------------------------------------ 134
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 341940483  210 NVLGLIIFCLVFGLVIGKMGEKGQILVDFFNALSDATMKIVQIIMCYMPIGILFLIAGKIIEvEDWEIFRKLGLYMATVL 289
Cdd:pfam00375 135 NVLQVIVFAILFGIALAALGEKGEPLLNFIESLQEVMMKVVGWVMKLAPIGVFALIANTVGT-YGLGTLGSLAKFLLAVY 213
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 341940483  290 SGLAIHSLIVLPLLYFIVVRKNPFRFALGMAQALLTALMISSSSATLPVTFRCAEEKNQVDKRITRFVLPVGATINMDGT 369
Cdd:pfam00375 214 LGLAIHLLIVYPLLLKFLGKINPFKFLKKMLPALLTAFSTASSAATLPVTLECAEKNLGVSKSIASFVLPLGATINMDGT 293
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 341940483  370 ALYEAVAAVFIAQLNGLDLSIGQIVTISITATAASIGAAGVPQAGLVTMVIVLSAVGLPAEDVTLIIAVDWLLDRFRTMV 449
Cdd:pfam00375 294 AIYLAVAAIFIAQAYGVDLSFGQQLTLVLTATLASIGAAGVPGGGLVALGLVLSALGLPLEGIALILAIDRLLDMFRTAV 373
                         410
                  ....*....|....*
gi 341940483  450 NVLGDAFGTGIVEKL 464
Cdd:pfam00375 374 NVTGDAAAAVIVAKL 388
GltP COG1301
Na+/H+-dicarboxylate symporter [Energy production and conversion];
51-471 9.31e-91

Na+/H+-dicarboxylate symporter [Energy production and conversion];


Pssm-ID: 224220 [Multi-domain]  Cd Length: 415  Bit Score: 283.73  E-value: 9.31e-91
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 341940483  51 YFAFPGEILMRMLKLVILPLIVSSMITGVAAL-DSNVSGKIGLRAVVYYFSTTVIAVILGIVLVVSIKPGVTQkvnDINR 129
Cdd:COG1301   34 YLKPLGDIFIKLIKMIIIPLVFFTLVLGIASLgDLKKLGRLGGKTLIYFLVTTTLAIAIGLVVANVLQPGAGI---NIDP 110
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 341940483 130 TGKTPEVSTMDAMLDLIRNMFPENLVQAcfqqyktkreevkpvgdpggnatevsvttamttMSENktkeykivglysdgi 209
Cdd:COG1301  111 ATLDTGAESEVSILDFLLDIIPTNIFGA---------------------------------LAEG--------------- 142
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 341940483 210 NVLGLIIFCLVFGLVIGKMGEKGQ-ILVDFFNALSDATMKIVQIIMCYMPIGILFLIAGKIIEvEDWEIFRKLGLYMATV 288
Cdd:COG1301  143 NVLQILFFAILFGLALAALGEKGKpPVENLFESLSEAMFKVTNFVMRLAPIGVFGLMAFTVAK-YGFGSLLSLGKLVLAV 221
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 341940483 289 LSGLAIHSLIVLPLLYFIVVRKNPFRFALGMAQALLTALMISSSSATLPVTFRCAEEKNQVDKRITRFVLPVGATINMDG 368
Cdd:COG1301  222 YLGLLLFVFVVLGLLLKLLSGFSPFKFLRYISEALLLAFSTSSSEATLPVTMEKAEKSLGVPKSIVSFVVPLGYTFNLDG 301
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 341940483 369 TALYEAVAAVFIAQLNGLDLSIGQIVTISITATAASIGAAGVPQAGLVTMVIVLSAVGLPAEDVTLIIAVDWLLDRFRTM 448
Cdd:COG1301  302 TAIYQTLAALFIAQAYGIPLSLGQQLTLLLVAMLASKGAAGVPGGGLVVLAATLSSVGLPLEGLALILGIDRFLDMARTA 381
                        410       420
                 ....*....|....*....|...
gi 341940483 449 VNVLGDAFGTGIVEKLSKKELEQ 471
Cdd:COG1301  382 TNVTGDAVATVVVAKWEGEEKAD 404
gltP PRK11283
glutamate/aspartate:proton symporter; Provisional
56-463 3.64e-40

glutamate/aspartate:proton symporter; Provisional


Pssm-ID: 183075 [Multi-domain]  Cd Length: 437  Bit Score: 150.68  E-value: 3.64e-40
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 341940483  56 GEILMRMLKLVILPLIVSSMITGVAAL-DSNVSGKIGLRAVVYYFSTTVIAVILGIVLVVSIKPGV-----TQKVNDINR 129
Cdd:PRK11283  45 GDIFIHLIKMIVVPIVISTLIVGIAGVgDAKQLGRIGAKTIIYFEVITTVAIILGITLANVFQPGAgidmsQLATVDISK 124
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 341940483 130 TGKTPEV--STMDAMLDLIRNMFPENLVQAcfqqykTKREEVKPVgdpggnatevsvttamttmsenktkeykivglysd 207
Cdd:PRK11283 125 YQSTTEEvqSHSHGLMGTILSLIPTNIFAS------MAKGEMLPI----------------------------------- 163
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 341940483 208 ginvlglIIFCLVFGLVIGKMGEK-GQILVDFFNALSDATMKIVQIIMCYMPIGILFLIAgkiIEVEDWEIFRKLGLYMA 286
Cdd:PRK11283 164 -------IFFSVLFGLGLSSLPAThREPLVTVFRSVSETMFKVTHMVMRYAPVGVFALIA---VTVANFGFASLWPLAKL 233
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 341940483 287 TVLSGLAI--HSLIVLPLLYFIVvRKNPFRFALGMAQALLTALMISSSSATLPvtfRCAE--EKNQVDKRITRFVLPVGA 362
Cdd:PRK11283 234 VLLVYFAIlfFALVVLGIVARLC-GLSIWILIRILKDELILAYSTASSETVLP---RIIEkmEAYGAPKSITSFVVPTGY 309
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 341940483 363 TINMDGTALYEAVAAVFIAQLNGLDLSIGQIVTISITATAASIGAAGVPQAGLVTMVIVLSAVGLPAEDVTLIIAVDWLL 442
Cdd:PRK11283 310 SFNLDGSTLYQSIAAIFIAQLYGIDLSIWQEIILVLTLMVTSKGIAGVPGVSFVVLLATLGSVGIPLEGLAFIAGVDRIL 389
                        410       420
                 ....*....|....*....|.
gi 341940483 443 DRFRTMVNVLGDAFGTGIVEK 463
Cdd:PRK11283 390 DMARTALNVVGNALAVLVIAK 410
PRK01663 PRK01663
C4-dicarboxylate transporter DctA; Reviewed
56-463 3.71e-38

C4-dicarboxylate transporter DctA; Reviewed


Pssm-ID: 234968 [Multi-domain]  Cd Length: 428  Bit Score: 144.66  E-value: 3.71e-38
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 341940483  56 GEILMRMLKLVILPLIVSSMITGVAAL-DSNVSGKIGLRAVVYYFSTTVIAVILGIVLVVSIKPGVtqkvndinrtGKTP 134
Cdd:PRK01663  38 GDGFIKLIKMIIAPIIFCTVVTGIAGMgDMKKVGRVGGKALLYFEIVSTIALIIGLIVVNVVQPGA----------GMNI 107
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 341940483 135 EVSTMDAmldlirnmfpenlvqACFQQYKTKREEVKPVGdpggnatevsvtTAMTTMSENktkeykIVGLYSDGiNVLGL 214
Cdd:PRK01663 108 DPATLDA---------------KAVAQYAAQAHEQGTVD------------FLMDIIPTT------VVGAFASG-DILQV 153
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 341940483 215 IIFCLVFGLVIGKMGEKGQILVDFFNALSDATMKIVQIIMCYMPIGILFLIA--------GKIIevedweifrKLGLYMA 286
Cdd:PRK01663 154 LLFAVLFGFALARLGEKGKPVFDFIESLSHVLFGIVNMIMKLAPIGAFGAMAftigkygvGSLV---------QLGQLIG 224
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 341940483 287 TVLSGLAIHSLIVLPllyfIVVRKNPF---RFALGMAQALLTALMISSSSATLPVTFRcAEEKNQVDKRITRFVLPVGAT 363
Cdd:PRK01663 225 CFYITCILFVFVVLG----AIARLTGFsifKFIRYIKEELLIVLGTSSSESALPRMME-KMEKLGCKKSVVGLVIPTGYS 299
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 341940483 364 INMDGTALYEAVAAVFIAQLNGLDLSIGQIVTISITATAASIGAAGVPQAGLVTMVIVLSAVG-LPAEDVTLIIAVDWLL 442
Cdd:PRK01663 300 FNLDGTSIYLTMAAVFIAQATNTPLSIGHQITLLAVLLLTSKGAAGVTGSGFIVLAATLSAVPhIPVAGLALILGIDRFM 379
                        410       420
                 ....*....|....*....|.
gi 341940483 443 DRFRTMVNVLGDAFGTGIVEK 463
Cdd:PRK01663 380 SEARALTNLIGNGVATVVVAK 400
PRK13027 PRK13027
C4-dicarboxylate transporter DctA; Reviewed
56-461 2.93e-34

C4-dicarboxylate transporter DctA; Reviewed


Pssm-ID: 183850 [Multi-domain]  Cd Length: 421  Bit Score: 133.64  E-value: 2.93e-34
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 341940483  56 GEILMRMLKLVILPLIVSSMITGVA-ALDSNVSGKIGLRAVVYYFSTTVIAVILGIVLVVSIKPGVTQKVNdinrtgktp 134
Cdd:PRK13027  37 GDGFIKLIKMLIGPIVFCVVVSGIAgAGDLKKVGRVGLKAVIYFEVMTTIALVIGLVLAYLTGPGVGMNID--------- 107
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 341940483 135 eVSTMDAmldlirnmfpenlvqacfqqyktkreevKPVGDPGGNATEVSVTTAMTTmsenKTKEYKIVGLYSDGiNVLGL 214
Cdd:PRK13027 108 -LRSLDA----------------------------ASLAGYAKNAQSLKGTAGFLL----KLIPTTAVDAFAKG-DILQV 153
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 341940483 215 IIFCLVFGLVIGKMGEKGQILVDFFNALSDATMKIVQIIMCYMPIGILFLIAgkiIEVEDWEI--FRKLGLYMATVLSGL 292
Cdd:PRK13027 154 LLFSVLFGSALSLLGERAKRVNRLIDELSHVLFRIMGFIIKLAPLGVLGAIA---FTTGKYGVgsLKQLGMLVAVFYLTC 230
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 341940483 293 AIHSLIVLPLlyfiVVRKNPFR-FAL--GMAQALLTALMISSSSATLPVTFRcAEEKNQVDKRITRFVLPVGATINMDGT 369
Cdd:PRK13027 231 FVFVVVVLGA----VMRLAGFSvFKLirYLREELLIVLGTASSDAVLPQVMR-KLEHMGIKDSTVGLVIPTGYSFNLDGF 305
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 341940483 370 ALYEAVAAVFIAQLNGLDLSIGQIVTISITATAASIGAAGVPQAGLVTMVIVLSAVG-LPAEDVTLIIAVDWLLDRFRTM 448
Cdd:PRK13027 306 SIYLTLAAVFIAQATNTPLSMHDLITILLVSLVTSKGAHGIPGSAIVILAATLSAIPaIPVLGLVLILPVDWFMGIARAL 385
                        410
                 ....*....|...
gi 341940483 449 VNVLGDAFGTGIV 461
Cdd:PRK13027 386 TNLIGNCVATVVV 398
TcyP COG1823
L-cystine uptake protein TcyP, sodium:dicarboxylate symporter family [Amino acid transport ...
41-467 1.23e-30

L-cystine uptake protein TcyP, sodium:dicarboxylate symporter family [Amino acid transport and metabolism];


Pssm-ID: 224736 [Multi-domain]  Cd Length: 458  Bit Score: 124.02  E-value: 1.23e-30
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 341940483  41 HSELSNLDKFYFAFPGEILMRMLKLVILPLIVSSMITGVAALDSNVS-GKIGLRAVVYYFSTTVIAVILGIVLVVSI--- 116
Cdd:COG1823   55 DSPVLKETIDWFNIVGNGYVRLLQMIVMPLVFISILSAIAKLDNASKlGKISLLTIGTLLFTTAIAALIGILVALLFglt 134
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 341940483 117 KPGVTQKVNDINRTGK-TPEVSTMDAML--DLIRNMFPENlvqacfqqyktkreevkPVGD-PGGNATevsvttamttms 192
Cdd:COG1823  135 AEGLVQGDAETARISEiQTYVGKVADLTipQLILSLIPKN-----------------PFADlTGANPT------------ 185
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 341940483 193 enktkeykivglysdgiNVLGLIIFCLVFGL----VIGKMGEKGQILVDFFNALSDATMKIVQIIMCYMPIGILFLIAgK 268
Cdd:COG1823  186 -----------------SIIAVVIFAAFLGIaalkLSKKDPEKGERFKAAIDTLQSIVMKLVRLVIRLTPYGVLALMT-K 247
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 341940483 269 IIEVEDWEIFRKLGLYMatVLSGLAIHSLIVLPLLYFIVVRKNPFRFALGMAQALLTALMISSSSATLPVTFRCAEEKNQ 348
Cdd:COG1823  248 VVATSNLEDIIKLGSFI--VASYIAIFIMFVVHGILLALNGVNPIKYFKKVWPVLTFAFTSRSSAATIPLNIETQTRKLG 325
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 341940483 349 VDKRITRFVLPVGATINMDGTA-LYEAVAAVFIAQLNGLD-LSIGQIVTISITATAASIGAAGVPQAGLVTMVIVLSAVG 426
Cdd:COG1823  326 VPEGIANFAASFGATIGQNGCAgIYPAMLAVMVAPTVGINpLDPHFIATLIGVVTISSFGVAGVGGGATFAALIVLSALG 405
                        410       420       430       440
                 ....*....|....*....|....*....|....*....|.
gi 341940483 427 LPAEDVTLIIAVDWLLDRFRTMVNVLGDAFGTGIVEKLSKK 467
Cdd:COG1823  406 LPVALVGLLISIEPLIDMGRTALNVSGSMTAGTITSKLLKQ 446
SstT COG3633
Na+/serine symporter [Amino acid transport and metabolism];
210-463 2.70e-15

Na+/serine symporter [Amino acid transport and metabolism];


Pssm-ID: 226159  Cd Length: 407  Bit Score: 77.82  E-value: 2.70e-15
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 341940483 210 NVLGLIIFCLVFGLVIGKMGEKGQILvdfFNALSDATMKIVQIIMCYMPIGILFLIAGKIIEVEdweiFRKLGLY---MA 286
Cdd:COG3633  146 NYIGILAWAIGLGLALRHASDTTKNL---VNDLSEAVSKIVKVVIRFAPIGIFGLVASTLAETG----FGALWGYaqlLA 218
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 341940483 287 TVLSGLAIHSLIVLPLLYFIVVRKNPFRFALG-MAQALLTALMISSSSATLPVTFRCAEEKNqVDKRITRFVLPVGATIN 365
Cdd:COG3633  219 VLVGCMLFVALVVNPLIVYWKIRRNPYPLVLTcLRESGVTAFFTRSSAANIPVNMALCKKLG-LDEDTYSVSIPLGATIN 297
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 341940483 366 MDGTALYEAVAAVFIAQLNGLDLSIGQIVTISITATAASIGAAGVPQAGLVTMVIVLSAVGLPAEDVTLIIAVDWLL--- 442
Cdd:COG3633  298 MAGAAITITVLTLAAVHTLGIPVDLPTALLLSVVASVCACGASGVAGGSLLLIPLACSLFGISNDVAMQVVAVGFIIgvl 377
                        250       260
                 ....*....|....*....|..
gi 341940483 443 -DRFRTMVNVLGDAFGTGIVEK 463
Cdd:COG3633  378 qDSAETALNSSTDVLFTAAACQ 399
PRK13628 PRK13628
serine/threonine transporter SstT; Provisional
237-410 3.01e-12

serine/threonine transporter SstT; Provisional


Pssm-ID: 184190  Cd Length: 402  Bit Score: 68.35  E-value: 3.01e-12
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 341940483 237 DFFNALSDATMKIVQIIMCYMPIGILFLIAGKIIEvEDWEIFRKLGLYMATVLSGLAIHSLIVLPLLYFIVVRKNPFRFA 316
Cdd:PRK13628 170 NVVNDLSEAVSQIVKWVIRFAPIGIFGLVASTLAE-TGFSALAGYAQLLAVLVGCMLFVALVVNPLIVFWKIRRNPYPLV 248
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 341940483 317 LG-MAQALLTALMISSSSATLPVTFRCAEEKNqVDKRITRFVLPVGATINMDGTALYEAVAAVFIAQLNGLDLSIGQIVT 395
Cdd:PRK13628 249 FTcLRESGVTAFFTRSSAANIPVNMALCEKLG-LDEDTYSVSIPLGATINMAGAAITITVLTLAAVHTLGIPVDLPTALL 327
                        170
                 ....*....|....*
gi 341940483 396 ISITATAASIGAAGV 410
Cdd:PRK13628 328 LSVVAAISACGASGV 342
PRK14695 PRK14695
serine/threonine transporter SstT; Provisional
210-468 7.09e-12

serine/threonine transporter SstT; Provisional


Pssm-ID: 173158  Cd Length: 319  Bit Score: 66.61  E-value: 7.09e-12
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 341940483 210 NVLGLIIFCLVFGLVigkMGEKGQILVDFFNALSDATMKIVQIIMCYMPIGILFLIAgKIIEVEDWEIFRKLGLYMATVL 289
Cdd:PRK14695  60 NYIGILSWAVIFGIA---MREASKNSKELLKTIADVTSKIVEWIINLAPFGILGLVF-KTISDKGVGSLANYGILLVLLV 135
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 341940483 290 SGLAIHSLIVLPLLYFIVVRKNPFRFALG-MAQALLTALMISSSSATLPVTFRCAEEKNqVDKRITRFVLPVGATINMDG 368
Cdd:PRK14695 136 TTMLFVAPVVNPLIAFFFMRRNPYPLVWNcLRVSGVTAFFTRSSATNIPVNMKLCHDLG-LNPDTYSVSIPLGSTINMAG 214
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 341940483 369 TALYEAVAAVFIAQLNGLDLSIGQIVTISITATAASIGAAGVPQAGLVTMVIVLSAVGLPAEDVTLIIAVDWLL----DR 444
Cdd:PRK14695 215 VAITINLLTLVTVNTLGIPVDFATAFVLSVVAAISACGASGIAGGSLLLIPVACSLFGISNDIAIQIVGVGFVIgviqDS 294
                        250       260
                 ....*....|....*....|....
gi 341940483 445 FRTMVNVLGDAFGTGIVEKLSKKE 468
Cdd:PRK14695 295 CETALNSSTDVLFTAVAEYAATRK 318
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH