NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|345325741|ref|XP_003430954|]
View 

Protein Classification

Ig_J_chain domain-containing protein (domain architecture ID 10633428)

Ig_J_chain domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Ig_J_chain pfam15097
Immunoglobulin J chain;
36-160 3.64e-80

Immunoglobulin J chain;


:

Pssm-ID: 405738  Cd Length: 134  Bit Score: 233.09  E-value: 3.64e-80
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 345325741   36 NKCKCTRVTSKFVPSKEDPSVKVLERNIRVIIPLKARQNISDPTSPPRTRFVYELSKLCQKCDQTEVELDHEVVTATRGN 115
Cdd:pfam15097  10 NKCKCVRVTSRFVPSKEDPEEEVVERNIRIIVPLNNRENISDPTSPLRTKFVYHLSDLCKKCDPTEVELGNQVVTATQSN 89
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*
gi 345325741  116 SCDRPGDDCYTYDRNKCYMSTIPFTYGGETKVVNTVLTPESCYPD 160
Cdd:pfam15097  90 ICDEDSETCYTYDRNKCYTSTVPFTYGGETKMVETALTPDSCYPD 134
 
Name Accession Description Interval E-value
Ig_J_chain pfam15097
Immunoglobulin J chain;
36-160 3.64e-80

Immunoglobulin J chain;


Pssm-ID: 405738  Cd Length: 134  Bit Score: 233.09  E-value: 3.64e-80
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 345325741   36 NKCKCTRVTSKFVPSKEDPSVKVLERNIRVIIPLKARQNISDPTSPPRTRFVYELSKLCQKCDQTEVELDHEVVTATRGN 115
Cdd:pfam15097  10 NKCKCVRVTSRFVPSKEDPEEEVVERNIRIIVPLNNRENISDPTSPLRTKFVYHLSDLCKKCDPTEVELGNQVVTATQSN 89
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*
gi 345325741  116 SCDRPGDDCYTYDRNKCYMSTIPFTYGGETKVVNTVLTPESCYPD 160
Cdd:pfam15097  90 ICDEDSETCYTYDRNKCYTSTVPFTYGGETKMVETALTPDSCYPD 134
 
Name Accession Description Interval E-value
Ig_J_chain pfam15097
Immunoglobulin J chain;
36-160 3.64e-80

Immunoglobulin J chain;


Pssm-ID: 405738  Cd Length: 134  Bit Score: 233.09  E-value: 3.64e-80
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 345325741   36 NKCKCTRVTSKFVPSKEDPSVKVLERNIRVIIPLKARQNISDPTSPPRTRFVYELSKLCQKCDQTEVELDHEVVTATRGN 115
Cdd:pfam15097  10 NKCKCVRVTSRFVPSKEDPEEEVVERNIRIIVPLNNRENISDPTSPLRTKFVYHLSDLCKKCDPTEVELGNQVVTATQSN 89
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*
gi 345325741  116 SCDRPGDDCYTYDRNKCYMSTIPFTYGGETKVVNTVLTPESCYPD 160
Cdd:pfam15097  90 ICDEDSETCYTYDRNKCYTSTVPFTYGGETKMVETALTPDSCYPD 134
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH