NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|348671100|gb|EGZ10921|]
View 

Protein Classification

Ion_trans and Na_channel_gate domain-containing protein (domain architecture ID 11998098)

protein containing domains Ion_trans, Na_channel_gate, and GPHH

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
917-1228 8.70e-46

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


:

Pssm-ID: 395416 [Multi-domain]  Cd Length: 238  Bit Score: 165.52  E-value: 8.70e-46
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 348671100   917 HPYFDSTVFGLIVISSIALAVDNPLaDPSSGLATFLKGLDKSLAIVFAIEMVIKIVAMGLILHkgsYLRNSWNIIDGVIV 996
Cdd:pfam00520    1 SRYFELFILLLILLNTIFLALETYF-QPEEPLTTVLEILDYVFTGIFTLEMLLKIIAAGFKKR---YFRSPWNILDFVVV 76
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 348671100   997 ISSLIMLVAESSGkgkNLKSLRSLRGLRTFRPLRMISRRPGLKLVVNALFEAIPEVINVLFVCMLFFLIFSIVAVNYLKG 1076
Cdd:pfam00520   77 LPSLISLVLSSVG---SLSGLRVLRLLRLLRLLRLIRRLEGLRTLVNSLIRSLKSLGNLLLLLLLFLFIFAIIGYQLFGG 153
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 348671100  1077 TFnsckgdvfgalsdaqvdflvaplawsadsdlqRSWFNGTACETsfpnasssdltseyvcgcwgadwgpvlpqNFNNVG 1156
Cdd:pfam00520  154 KL--------------------------------KTWENPDNGRT-----------------------------NFDNFP 172
                          250       260       270       280       290       300       310
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 348671100  1157 SAMLTLFEISTTEGWADVMMAAIDSNGigmqpirdnNMLWALFFVLFIMVGSFFVVNLFVGVIIDNFNRMKA 1228
Cdd:pfam00520  173 NAFLWLFQTMTTEGWGDIMYDTIDGKG---------EFWAYIYFVSFIILGGFLLLNLFIAVIIDNFQELTE 235
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
1279-1539 3.95e-42

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


:

Pssm-ID: 395416 [Multi-domain]  Cd Length: 238  Bit Score: 154.73  E-value: 3.95e-42
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 348671100  1279 FEWFIMICIIVNTFLMAAQF-FGESTLQEYVINVVNEIFAVVFTMEAAMKLIAFG--WEYFEDQWNQFDFFVVLGTLLSV 1355
Cdd:pfam00520    4 FELFILLLILLNTIFLALETyFQPEEPLTTVLEILDYVFTGIFTLEMLLKIIAAGfkKRYFRSPWNILDFVVVLPSLISL 83
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 348671100  1356 VVemfTGASVRSLAMLVRVFRVTRILRLVKASKSIRQILLTLYIALPGLSNITSILFLMLFIYSTMGVQIFAKVALS--D 1433
Cdd:pfam00520   84 VL---SSVGSLSGLRVLRLLRLLRLLRLIRRLEGLRTLVNSLIRSLKSLGNLLLLLLLFLFIFAIIGYQLFGGKLKTweN 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 348671100  1434 NIDSHANFQDFGKGFLFLLRAATGEAWNSCMHDlasstpgcvddppyddtmcgfnnfdgckPLNGCGNPIAYAFFCTFTL 1513
Cdd:pfam00520  161 PDNGRTNFDNFPNAFLWLFQTMTTEGWGDIMYD----------------------------TIDGKGEFWAYIYFVSFII 212
                          250       260
                   ....*....|....*....|....*.
gi 348671100  1514 LVTYVMLNLTIAVILEGFSLSHEDDE 1539
Cdd:pfam00520  213 LGGFLLLNLFIAVIIDNFQELTERTE 238
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
470-703 1.66e-41

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


:

Pssm-ID: 395416 [Multi-domain]  Cd Length: 238  Bit Score: 153.19  E-value: 1.66e-41
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 348671100   470 HKLFAGFIMAVIMANTAVLALDHYPMP-TKMDEDLEIVNFALSCVFVVEMVMKLFGLGL-RQYSRDKFNLFDAFIVTMGL 547
Cdd:pfam00520    1 SRYFELFILLLILLNTIFLALETYFQPeEPLTTVLEILDYVFTGIFTLEMLLKIIAAGFkKRYFRSPWNILDFVVVLPSL 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 348671100   548 LETIASPPSFMSsnppkkgAVSALRSFRLFRVFKLARDWKSLRELLEMIARAVASITNFGVLLFLFIYIYALVGVQFFGN 627
Cdd:pfam00520   81 ISLVLSSVGSLS-------GLRVLRLLRLLRLLRLIRRLEGLRTLVNSLIRSLKSLGNLLLLLLLFLFIFAIIGYQLFGG 153
                          170       180       190       200       210       220       230
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 348671100   628 TMRFDDEEyptpftlegfwdgTVPRNNFDTLLWAAVTVFQIITGENWNSIMYYAILGNG-MFSCVYFISLVILGDFV 703
Cdd:pfam00520  154 KLKTWENP-------------DNGRTNFDNFPNAFLWLFQTMTTEGWGDIMYDTIDGKGeFWAYIYFVSFIILGGFL 217
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
60-433 9.50e-28

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


:

Pssm-ID: 395416 [Multi-domain]  Cd Length: 238  Bit Score: 113.52  E-value: 9.50e-28
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 348671100    60 HRYFDRFIIAAIIANSVILGLSDFSVVDSDLNptssgkkyedgalvdayslqnHIVEVSELPFTIIFTTECVLKIVAMGL 139
Cdd:pfam00520    1 SRYFELFILLLILLNTIFLALETYFQPEEPLT---------------------TVLEILDYVFTGIFTLEMLLKIIAAGF 59
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 348671100   140 QGHgsYEQDAWNILDFLVVVSSLV----ASLPGMPNVSAIRTIRVLRPLRSLSVIPGMRRLIAALLKALPALGNVVILQI 215
Cdd:pfam00520   60 KKR--YFRSPWNILDFVVVLPSLIslvlSSVGSLSGLRVLRLLRLLRLLRLIRRLEGLRTLVNSLIRSLKSLGNLLLLLL 137
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 348671100   216 FVFFIFGILGIQLFGGsmnrrcrvtplpiklplddanetiwpvprdyidqakanlatyrcidgplldyesstgdytkets 295
Cdd:pfam00520  138 LFLFIFAIIGYQLFGG---------------------------------------------------------------- 153
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 348671100   296 pwntaqdcfwpvdeddellcaaegqagnhgcnngmtcgsDYDAFGNPrfnhrkamdyalylpslDWGLTTFDNIGRAFFT 375
Cdd:pfam00520  154 ---------------------------------------KLKTWENP-----------------DNGRTNFDNFPNAFLW 177
                          330       340       350       360       370
                   ....*....|....*....|....*....|....*....|....*....|....*...
gi 348671100   376 IFQSITQEGWTSIMYMVMDSSQPTIGAVFFVVLIIFASFFVMNLTLAVISEEFNLDQK 433
Cdd:pfam00520  178 LFQTMTTEGWGDIMYDTIDGKGEFWAYIYFVSFIILGGFLLLNLFIAVIIDNFQELTE 235
Na_channel_gate cd13433
Inactivation gate of the voltage-gated sodium channel alpha subunits; This region is part of ...
1221-1271 3.74e-15

Inactivation gate of the voltage-gated sodium channel alpha subunits; This region is part of the intracellular linker between domains III and IV of the alpha subunits of voltage-gated sodium channels. It is responsible for fast inactivation of the channel and essential for proper physiological function.


:

Pssm-ID: 240441  Cd Length: 54  Bit Score: 71.06  E-value: 3.74e-15
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|...
gi 348671100 1221 DNFNRMKAALGG--DFMLTPEQKKWVEAQKAASRVGPVRILKPPRQMWRRYIF 1271
Cdd:cd13433     1 DNFNQLKKKYGGglDIFLTESQKKYYNAMKKLGSKKPQKPIPRPKNKFQGFIF 53
GPHH super family cl25190
Voltage-dependent L-type calcium channel, IQ-associated; GPHH is a sequence motif found in ...
1549-1605 6.52e-11

Voltage-dependent L-type calcium channel, IQ-associated; GPHH is a sequence motif found in this short domain on voltage-dependent L-type calcium channel proteins in eukaryotes. The domain is closely associated with the IQ-domain, pfam08763.


The actual alignment was detected with superfamily member pfam16905:

Pssm-ID: 407139  Cd Length: 54  Bit Score: 58.81  E-value: 6.52e-11
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|....*...
gi 348671100  1549 EFQTKWAGIDPKATGFVKVDKMLLLVNLLKPPLGKF-GLPFHMAhfFKYMckCQLELP 1605
Cdd:pfam16905    1 EFVRIWAEYDPAATGRISYQDMYELLRRISPPLGFGkKCPARVA--YKRL--VRMNMP 54
 
Name Accession Description Interval E-value
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
917-1228 8.70e-46

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


Pssm-ID: 395416 [Multi-domain]  Cd Length: 238  Bit Score: 165.52  E-value: 8.70e-46
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 348671100   917 HPYFDSTVFGLIVISSIALAVDNPLaDPSSGLATFLKGLDKSLAIVFAIEMVIKIVAMGLILHkgsYLRNSWNIIDGVIV 996
Cdd:pfam00520    1 SRYFELFILLLILLNTIFLALETYF-QPEEPLTTVLEILDYVFTGIFTLEMLLKIIAAGFKKR---YFRSPWNILDFVVV 76
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 348671100   997 ISSLIMLVAESSGkgkNLKSLRSLRGLRTFRPLRMISRRPGLKLVVNALFEAIPEVINVLFVCMLFFLIFSIVAVNYLKG 1076
Cdd:pfam00520   77 LPSLISLVLSSVG---SLSGLRVLRLLRLLRLLRLIRRLEGLRTLVNSLIRSLKSLGNLLLLLLLFLFIFAIIGYQLFGG 153
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 348671100  1077 TFnsckgdvfgalsdaqvdflvaplawsadsdlqRSWFNGTACETsfpnasssdltseyvcgcwgadwgpvlpqNFNNVG 1156
Cdd:pfam00520  154 KL--------------------------------KTWENPDNGRT-----------------------------NFDNFP 172
                          250       260       270       280       290       300       310
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 348671100  1157 SAMLTLFEISTTEGWADVMMAAIDSNGigmqpirdnNMLWALFFVLFIMVGSFFVVNLFVGVIIDNFNRMKA 1228
Cdd:pfam00520  173 NAFLWLFQTMTTEGWGDIMYDTIDGKG---------EFWAYIYFVSFIILGGFLLLNLFIAVIIDNFQELTE 235
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
1279-1539 3.95e-42

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


Pssm-ID: 395416 [Multi-domain]  Cd Length: 238  Bit Score: 154.73  E-value: 3.95e-42
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 348671100  1279 FEWFIMICIIVNTFLMAAQF-FGESTLQEYVINVVNEIFAVVFTMEAAMKLIAFG--WEYFEDQWNQFDFFVVLGTLLSV 1355
Cdd:pfam00520    4 FELFILLLILLNTIFLALETyFQPEEPLTTVLEILDYVFTGIFTLEMLLKIIAAGfkKRYFRSPWNILDFVVVLPSLISL 83
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 348671100  1356 VVemfTGASVRSLAMLVRVFRVTRILRLVKASKSIRQILLTLYIALPGLSNITSILFLMLFIYSTMGVQIFAKVALS--D 1433
Cdd:pfam00520   84 VL---SSVGSLSGLRVLRLLRLLRLLRLIRRLEGLRTLVNSLIRSLKSLGNLLLLLLLFLFIFAIIGYQLFGGKLKTweN 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 348671100  1434 NIDSHANFQDFGKGFLFLLRAATGEAWNSCMHDlasstpgcvddppyddtmcgfnnfdgckPLNGCGNPIAYAFFCTFTL 1513
Cdd:pfam00520  161 PDNGRTNFDNFPNAFLWLFQTMTTEGWGDIMYD----------------------------TIDGKGEFWAYIYFVSFII 212
                          250       260
                   ....*....|....*....|....*.
gi 348671100  1514 LVTYVMLNLTIAVILEGFSLSHEDDE 1539
Cdd:pfam00520  213 LGGFLLLNLFIAVIIDNFQELTERTE 238
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
470-703 1.66e-41

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


Pssm-ID: 395416 [Multi-domain]  Cd Length: 238  Bit Score: 153.19  E-value: 1.66e-41
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 348671100   470 HKLFAGFIMAVIMANTAVLALDHYPMP-TKMDEDLEIVNFALSCVFVVEMVMKLFGLGL-RQYSRDKFNLFDAFIVTMGL 547
Cdd:pfam00520    1 SRYFELFILLLILLNTIFLALETYFQPeEPLTTVLEILDYVFTGIFTLEMLLKIIAAGFkKRYFRSPWNILDFVVVLPSL 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 348671100   548 LETIASPPSFMSsnppkkgAVSALRSFRLFRVFKLARDWKSLRELLEMIARAVASITNFGVLLFLFIYIYALVGVQFFGN 627
Cdd:pfam00520   81 ISLVLSSVGSLS-------GLRVLRLLRLLRLLRLIRRLEGLRTLVNSLIRSLKSLGNLLLLLLLFLFIFAIIGYQLFGG 153
                          170       180       190       200       210       220       230
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 348671100   628 TMRFDDEEyptpftlegfwdgTVPRNNFDTLLWAAVTVFQIITGENWNSIMYYAILGNG-MFSCVYFISLVILGDFV 703
Cdd:pfam00520  154 KLKTWENP-------------DNGRTNFDNFPNAFLWLFQTMTTEGWGDIMYDTIDGKGeFWAYIYFVSFIILGGFL 217
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
60-433 9.50e-28

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


Pssm-ID: 395416 [Multi-domain]  Cd Length: 238  Bit Score: 113.52  E-value: 9.50e-28
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 348671100    60 HRYFDRFIIAAIIANSVILGLSDFSVVDSDLNptssgkkyedgalvdayslqnHIVEVSELPFTIIFTTECVLKIVAMGL 139
Cdd:pfam00520    1 SRYFELFILLLILLNTIFLALETYFQPEEPLT---------------------TVLEILDYVFTGIFTLEMLLKIIAAGF 59
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 348671100   140 QGHgsYEQDAWNILDFLVVVSSLV----ASLPGMPNVSAIRTIRVLRPLRSLSVIPGMRRLIAALLKALPALGNVVILQI 215
Cdd:pfam00520   60 KKR--YFRSPWNILDFVVVLPSLIslvlSSVGSLSGLRVLRLLRLLRLLRLIRRLEGLRTLVNSLIRSLKSLGNLLLLLL 137
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 348671100   216 FVFFIFGILGIQLFGGsmnrrcrvtplpiklplddanetiwpvprdyidqakanlatyrcidgplldyesstgdytkets 295
Cdd:pfam00520  138 LFLFIFAIIGYQLFGG---------------------------------------------------------------- 153
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 348671100   296 pwntaqdcfwpvdeddellcaaegqagnhgcnngmtcgsDYDAFGNPrfnhrkamdyalylpslDWGLTTFDNIGRAFFT 375
Cdd:pfam00520  154 ---------------------------------------KLKTWENP-----------------DNGRTNFDNFPNAFLW 177
                          330       340       350       360       370
                   ....*....|....*....|....*....|....*....|....*....|....*...
gi 348671100   376 IFQSITQEGWTSIMYMVMDSSQPTIGAVFFVVLIIFASFFVMNLTLAVISEEFNLDQK 433
Cdd:pfam00520  178 LFQTMTTEGWGDIMYDTIDGKGEFWAYIYFVSFIILGGFLLLNLFIAVIIDNFQELTE 235
Na_channel_gate cd13433
Inactivation gate of the voltage-gated sodium channel alpha subunits; This region is part of ...
1221-1271 3.74e-15

Inactivation gate of the voltage-gated sodium channel alpha subunits; This region is part of the intracellular linker between domains III and IV of the alpha subunits of voltage-gated sodium channels. It is responsible for fast inactivation of the channel and essential for proper physiological function.


Pssm-ID: 240441  Cd Length: 54  Bit Score: 71.06  E-value: 3.74e-15
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|...
gi 348671100 1221 DNFNRMKAALGG--DFMLTPEQKKWVEAQKAASRVGPVRILKPPRQMWRRYIF 1271
Cdd:cd13433     1 DNFNQLKKKYGGglDIFLTESQKKYYNAMKKLGSKKPQKPIPRPKNKFQGFIF 53
GPHH pfam16905
Voltage-dependent L-type calcium channel, IQ-associated; GPHH is a sequence motif found in ...
1549-1605 6.52e-11

Voltage-dependent L-type calcium channel, IQ-associated; GPHH is a sequence motif found in this short domain on voltage-dependent L-type calcium channel proteins in eukaryotes. The domain is closely associated with the IQ-domain, pfam08763.


Pssm-ID: 407139  Cd Length: 54  Bit Score: 58.81  E-value: 6.52e-11
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|....*...
gi 348671100  1549 EFQTKWAGIDPKATGFVKVDKMLLLVNLLKPPLGKF-GLPFHMAhfFKYMckCQLELP 1605
Cdd:pfam16905    1 EFVRIWAEYDPAATGRISYQDMYELLRRISPPLGFGkKCPARVA--YKRL--VRMNMP 54
 
Name Accession Description Interval E-value
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
917-1228 8.70e-46

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


Pssm-ID: 395416 [Multi-domain]  Cd Length: 238  Bit Score: 165.52  E-value: 8.70e-46
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 348671100   917 HPYFDSTVFGLIVISSIALAVDNPLaDPSSGLATFLKGLDKSLAIVFAIEMVIKIVAMGLILHkgsYLRNSWNIIDGVIV 996
Cdd:pfam00520    1 SRYFELFILLLILLNTIFLALETYF-QPEEPLTTVLEILDYVFTGIFTLEMLLKIIAAGFKKR---YFRSPWNILDFVVV 76
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 348671100   997 ISSLIMLVAESSGkgkNLKSLRSLRGLRTFRPLRMISRRPGLKLVVNALFEAIPEVINVLFVCMLFFLIFSIVAVNYLKG 1076
Cdd:pfam00520   77 LPSLISLVLSSVG---SLSGLRVLRLLRLLRLLRLIRRLEGLRTLVNSLIRSLKSLGNLLLLLLLFLFIFAIIGYQLFGG 153
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 348671100  1077 TFnsckgdvfgalsdaqvdflvaplawsadsdlqRSWFNGTACETsfpnasssdltseyvcgcwgadwgpvlpqNFNNVG 1156
Cdd:pfam00520  154 KL--------------------------------KTWENPDNGRT-----------------------------NFDNFP 172
                          250       260       270       280       290       300       310
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 348671100  1157 SAMLTLFEISTTEGWADVMMAAIDSNGigmqpirdnNMLWALFFVLFIMVGSFFVVNLFVGVIIDNFNRMKA 1228
Cdd:pfam00520  173 NAFLWLFQTMTTEGWGDIMYDTIDGKG---------EFWAYIYFVSFIILGGFLLLNLFIAVIIDNFQELTE 235
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
1279-1539 3.95e-42

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


Pssm-ID: 395416 [Multi-domain]  Cd Length: 238  Bit Score: 154.73  E-value: 3.95e-42
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 348671100  1279 FEWFIMICIIVNTFLMAAQF-FGESTLQEYVINVVNEIFAVVFTMEAAMKLIAFG--WEYFEDQWNQFDFFVVLGTLLSV 1355
Cdd:pfam00520    4 FELFILLLILLNTIFLALETyFQPEEPLTTVLEILDYVFTGIFTLEMLLKIIAAGfkKRYFRSPWNILDFVVVLPSLISL 83
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 348671100  1356 VVemfTGASVRSLAMLVRVFRVTRILRLVKASKSIRQILLTLYIALPGLSNITSILFLMLFIYSTMGVQIFAKVALS--D 1433
Cdd:pfam00520   84 VL---SSVGSLSGLRVLRLLRLLRLLRLIRRLEGLRTLVNSLIRSLKSLGNLLLLLLLFLFIFAIIGYQLFGGKLKTweN 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 348671100  1434 NIDSHANFQDFGKGFLFLLRAATGEAWNSCMHDlasstpgcvddppyddtmcgfnnfdgckPLNGCGNPIAYAFFCTFTL 1513
Cdd:pfam00520  161 PDNGRTNFDNFPNAFLWLFQTMTTEGWGDIMYD----------------------------TIDGKGEFWAYIYFVSFII 212
                          250       260
                   ....*....|....*....|....*.
gi 348671100  1514 LVTYVMLNLTIAVILEGFSLSHEDDE 1539
Cdd:pfam00520  213 LGGFLLLNLFIAVIIDNFQELTERTE 238
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
470-703 1.66e-41

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


Pssm-ID: 395416 [Multi-domain]  Cd Length: 238  Bit Score: 153.19  E-value: 1.66e-41
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 348671100   470 HKLFAGFIMAVIMANTAVLALDHYPMP-TKMDEDLEIVNFALSCVFVVEMVMKLFGLGL-RQYSRDKFNLFDAFIVTMGL 547
Cdd:pfam00520    1 SRYFELFILLLILLNTIFLALETYFQPeEPLTTVLEILDYVFTGIFTLEMLLKIIAAGFkKRYFRSPWNILDFVVVLPSL 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 348671100   548 LETIASPPSFMSsnppkkgAVSALRSFRLFRVFKLARDWKSLRELLEMIARAVASITNFGVLLFLFIYIYALVGVQFFGN 627
Cdd:pfam00520   81 ISLVLSSVGSLS-------GLRVLRLLRLLRLLRLIRRLEGLRTLVNSLIRSLKSLGNLLLLLLLFLFIFAIIGYQLFGG 153
                          170       180       190       200       210       220       230
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 348671100   628 TMRFDDEEyptpftlegfwdgTVPRNNFDTLLWAAVTVFQIITGENWNSIMYYAILGNG-MFSCVYFISLVILGDFV 703
Cdd:pfam00520  154 KLKTWENP-------------DNGRTNFDNFPNAFLWLFQTMTTEGWGDIMYDTIDGKGeFWAYIYFVSFIILGGFL 217
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
60-433 9.50e-28

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


Pssm-ID: 395416 [Multi-domain]  Cd Length: 238  Bit Score: 113.52  E-value: 9.50e-28
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 348671100    60 HRYFDRFIIAAIIANSVILGLSDFSVVDSDLNptssgkkyedgalvdayslqnHIVEVSELPFTIIFTTECVLKIVAMGL 139
Cdd:pfam00520    1 SRYFELFILLLILLNTIFLALETYFQPEEPLT---------------------TVLEILDYVFTGIFTLEMLLKIIAAGF 59
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 348671100   140 QGHgsYEQDAWNILDFLVVVSSLV----ASLPGMPNVSAIRTIRVLRPLRSLSVIPGMRRLIAALLKALPALGNVVILQI 215
Cdd:pfam00520   60 KKR--YFRSPWNILDFVVVLPSLIslvlSSVGSLSGLRVLRLLRLLRLLRLIRRLEGLRTLVNSLIRSLKSLGNLLLLLL 137
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 348671100   216 FVFFIFGILGIQLFGGsmnrrcrvtplpiklplddanetiwpvprdyidqakanlatyrcidgplldyesstgdytkets 295
Cdd:pfam00520  138 LFLFIFAIIGYQLFGG---------------------------------------------------------------- 153
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 348671100   296 pwntaqdcfwpvdeddellcaaegqagnhgcnngmtcgsDYDAFGNPrfnhrkamdyalylpslDWGLTTFDNIGRAFFT 375
Cdd:pfam00520  154 ---------------------------------------KLKTWENP-----------------DNGRTNFDNFPNAFLW 177
                          330       340       350       360       370
                   ....*....|....*....|....*....|....*....|....*....|....*...
gi 348671100   376 IFQSITQEGWTSIMYMVMDSSQPTIGAVFFVVLIIFASFFVMNLTLAVISEEFNLDQK 433
Cdd:pfam00520  178 LFQTMTTEGWGDIMYDTIDGKGEFWAYIYFVSFIILGGFLLLNLFIAVIIDNFQELTE 235
Na_channel_gate cd13433
Inactivation gate of the voltage-gated sodium channel alpha subunits; This region is part of ...
1221-1271 3.74e-15

Inactivation gate of the voltage-gated sodium channel alpha subunits; This region is part of the intracellular linker between domains III and IV of the alpha subunits of voltage-gated sodium channels. It is responsible for fast inactivation of the channel and essential for proper physiological function.


Pssm-ID: 240441  Cd Length: 54  Bit Score: 71.06  E-value: 3.74e-15
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|...
gi 348671100 1221 DNFNRMKAALGG--DFMLTPEQKKWVEAQKAASRVGPVRILKPPRQMWRRYIF 1271
Cdd:cd13433     1 DNFNQLKKKYGGglDIFLTESQKKYYNAMKKLGSKKPQKPIPRPKNKFQGFIF 53
GPHH pfam16905
Voltage-dependent L-type calcium channel, IQ-associated; GPHH is a sequence motif found in ...
1549-1605 6.52e-11

Voltage-dependent L-type calcium channel, IQ-associated; GPHH is a sequence motif found in this short domain on voltage-dependent L-type calcium channel proteins in eukaryotes. The domain is closely associated with the IQ-domain, pfam08763.


Pssm-ID: 407139  Cd Length: 54  Bit Score: 58.81  E-value: 6.52e-11
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|....*...
gi 348671100  1549 EFQTKWAGIDPKATGFVKVDKMLLLVNLLKPPLGKF-GLPFHMAhfFKYMckCQLELP 1605
Cdd:pfam16905    1 EFVRIWAEYDPAATGRISYQDMYELLRRISPPLGFGkKCPARVA--YKRL--VRMNMP 54
PKD_channel pfam08016
Polycystin cation channel; This family contains the cation channel region of PKD1 and PKD2 ...
1296-1532 9.98e-07

Polycystin cation channel; This family contains the cation channel region of PKD1 and PKD2 proteins.


Pssm-ID: 400395  Cd Length: 424  Bit Score: 53.12  E-value: 9.98e-07
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 348671100  1296 AQFFGESTLQEYVINVVNEIFAVVFTMEAAMKLIAFGWEYFEDQWNQFDFFVVLGTLLSVVVEMF--------------- 1360
Cdd:pfam08016  199 LRYVTNRSLFILLCEIVFVVFFLYFVVEEILKIRKHRPSYLRSVWNLLDLAIVILSVVLIVLNIYrdflvdrliksveas 278
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 348671100  1361 --TGASVRSLAMLVRVFRVT----------RILRLVKASKSIRQILLTLYIALPGLSNITSILFLMLFIYSTMGVQIFAk 1428
Cdd:pfam08016  279 pvTFIDFDRVAQLDNLYRIIlaflvfltwlKLFKVLRFNKTMSLFTKTLSRAWKDLAGFALMFVIFFFAYAQFGYLLFG- 357
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 348671100  1429 valsdniDSHANFQDFGKGFLFLLRaatgeawnscmhdlasstpgcvddppyddTMCG-FNNFDgckpLNGCGNPIAYAF 1507
Cdd:pfam08016  358 -------TQAPNFSNFVKSILTLFR-----------------------------TILGdFGYNE----IFSGNRVLGPLL 397
                          250       260
                   ....*....|....*....|....*
gi 348671100  1508 FCTFTLLVTYVMLNLTIAVILEGFS 1532
Cdd:pfam08016  398 FLTFVFLVIFILLNLFLAIINDSYV 422
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH