NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|38257755|sp|Q9D4H8|]
View 

Protein Classification

cullin (domain architecture ID 12011692)

cullin is a core component of multiple cullin-RING-based SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complexes, which mediate the ubiquitination of proteins involved in cell cycle progression, signal transduction and transcription

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Cullin pfam00888
Cullin family;
14-644 0e+00

Cullin family;


:

Pssm-ID: 395716  Cd Length: 610  Bit Score: 614.18  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 38257755    14 WNKLLTTIKAVvMLEYVERATWNDRFSDIYALCVaypEPLGERLYAETKIFLESHVRHLYKRVLE---SEEQVLVMYHRY 90
Cdd:pfam00888   1 WEKLEDAIDEI-LNKNVSKLSYEELYRAVYNLCL---HKQGEKLYDRLKEYLEEHLKELVKPLLKelaDGEEFLKFYVKE 76
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 38257755    91 WEEYSKGADYMDCLYRYLNTQYIKKnklteadiqygyggvdmnepLMEIGELALDMWRKLMVE-PLQNILIRMLLREIKN 169
Cdd:pfam00888  77 WEDHTISMKMIRDIFMYLDRVYVKR--------------------LPSIYDLGLVLFRDHVFRiPLKDKLIDALLDLIEK 136
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 38257755   170 DRGGEDPNQKVIHGVINSFVHVEQYKKKfplKFYQGIFVSPFLTETGEYYKQEASNLLQE-SNCSQYMEKVLGRLKDEEI 248
Cdd:pfam00888 137 ERNGEVIDRSLIKSVIDMLVSLGEDDSK---KVYEEDFEPPFLEATEEFYRAESQELLAEnSVASEYLKKAERRLEEEEE 213
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 38257755   249 RCRKYLHPSSYTKVIHECQQRMVADHLQFLHS-ECHSIIQQERKNDMANMYVLLRAVSSGLPHMIEELQKHIHDEGLRAT 327
Cdd:pfam00888 214 RVQLYLHSSTKPKLLKVLEEVLISDHLEELLEeELQNLLDDNKIEDLKRLYRLLSRVPDGLDPLRKAFEEYIKEEGKAIV 293
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 38257755   328 SNL-TQEHMPTLFVESVLEVHGKFVQLINTVLNGDQHFMSALDKALTSVVNYRepKSVCKAPELLAKYCDNLLKKSAKGM 406
Cdd:pfam00888 294 KDAkEQTTDAKKYVEDLLELKDKFDKIVKDAFSNDELFVKALDEAFEEFINKN--TSNSKSPELLAKYIDSLLKKGLKGK 371
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 38257755   407 TENEVEDKLTSFITVFKYIDDKDVFQKFYARMLAKRLIHGLSMSMDSEEAMINKLKQACGYEFTSKLHRMYTDMSVSADL 486
Cdd:pfam00888 372 SEEELEEKLDKVITLFRYIEDKDVFEKFYKKHLAKRLLLGKSASDDAERSMISKLKEECGSEFTSKLEGMFKDIELSKDL 451
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 38257755   487 NNKFNNFIRNqDTVIDLGISFQIYVLQAGAWPlTQAPSSTFAIPQELEKSVQMFELFYSQHFSGRKLTWLHYLCTGEVKM 566
Cdd:pfam00888 452 NAEFKEHLAN-DNSSKKGIDLNVNVLTSGAWP-TYLTSPDFILPPELEKAIERFEKFYLSKHSGRKLTWLHNLGTAELKA 529
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 38257755   567 NYLGKPYVAMVTTYQMAVLLAFNNS-ETVSYKELQDSTQMNEKELTKTIKSLL--DVKMINHDSEKEDIDAESSFSLNMS 643
Cdd:pfam00888 530 NFPKGKKELNVSTYQMAILLLFNDDgDSLSYEEIQEATGLPDDELKRTLQSLAcaKAKVLLKEPMSKDINPTDVFSFNED 609

                  .
gi 38257755   644 F 644
Cdd:pfam00888 610 F 610
Cullin_Nedd8 pfam10557
Cullin protein neddylation domain; This is the neddylation site of cullin proteins which are a ...
675-735 5.21e-30

Cullin protein neddylation domain; This is the neddylation site of cullin proteins which are a family of structurally related proteins containing an evolutionarily conserved cullin domain. With the exception of APC2, each member of the cullin family is modified by Nedd8 and several cullins function in Ubiquitin-dependent proteolysis, a process in which the 26S proteasome recognizes and subsequently degrades a target protein tagged with K48-linked poly-ubiquitin chains. Cullins are molecular scaffolds responsible for assembling the ROC1/Rbx1 RING-based E3 ubiquitin ligases, of which several play a direct role in tumorigenesis. Nedd8/Rub1 is a small ubiquitin-like protein, which was originally found to be conjugated to Cdc53, a cullin component of the SCF (Skp1-Cdc53/CUL1-F-box protein) E3 Ub ligase complex in Saccharomyces cerevisiae, and Nedd8 modification has now emerged as a regulatory pathway of fundamental importance for cell cycle control and for embryogenesis in metazoans. The only identified Nedd8 substrates are cullins. Neddylation results in covalent conjugation of a Nedd8 moiety onto a conserved cullin lysine residue.


:

Pssm-ID: 402267  Cd Length: 62  Bit Score: 112.54  E-value: 5.21e-30
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 38257755   675 DRKMYLQAAIVRIMKARKVLRHNALIQEVISQSRARFNPSISMIKKCIEVLIDKQYIERSQ 735
Cdd:pfam10557   1 DRKHEIQAAIVRIMKSRKTLSHNELVNEVIEQLKSRFKPSVSDIKKRIESLIEKEYLERDE 61
 
Name Accession Description Interval E-value
Cullin pfam00888
Cullin family;
14-644 0e+00

Cullin family;


Pssm-ID: 395716  Cd Length: 610  Bit Score: 614.18  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 38257755    14 WNKLLTTIKAVvMLEYVERATWNDRFSDIYALCVaypEPLGERLYAETKIFLESHVRHLYKRVLE---SEEQVLVMYHRY 90
Cdd:pfam00888   1 WEKLEDAIDEI-LNKNVSKLSYEELYRAVYNLCL---HKQGEKLYDRLKEYLEEHLKELVKPLLKelaDGEEFLKFYVKE 76
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 38257755    91 WEEYSKGADYMDCLYRYLNTQYIKKnklteadiqygyggvdmnepLMEIGELALDMWRKLMVE-PLQNILIRMLLREIKN 169
Cdd:pfam00888  77 WEDHTISMKMIRDIFMYLDRVYVKR--------------------LPSIYDLGLVLFRDHVFRiPLKDKLIDALLDLIEK 136
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 38257755   170 DRGGEDPNQKVIHGVINSFVHVEQYKKKfplKFYQGIFVSPFLTETGEYYKQEASNLLQE-SNCSQYMEKVLGRLKDEEI 248
Cdd:pfam00888 137 ERNGEVIDRSLIKSVIDMLVSLGEDDSK---KVYEEDFEPPFLEATEEFYRAESQELLAEnSVASEYLKKAERRLEEEEE 213
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 38257755   249 RCRKYLHPSSYTKVIHECQQRMVADHLQFLHS-ECHSIIQQERKNDMANMYVLLRAVSSGLPHMIEELQKHIHDEGLRAT 327
Cdd:pfam00888 214 RVQLYLHSSTKPKLLKVLEEVLISDHLEELLEeELQNLLDDNKIEDLKRLYRLLSRVPDGLDPLRKAFEEYIKEEGKAIV 293
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 38257755   328 SNL-TQEHMPTLFVESVLEVHGKFVQLINTVLNGDQHFMSALDKALTSVVNYRepKSVCKAPELLAKYCDNLLKKSAKGM 406
Cdd:pfam00888 294 KDAkEQTTDAKKYVEDLLELKDKFDKIVKDAFSNDELFVKALDEAFEEFINKN--TSNSKSPELLAKYIDSLLKKGLKGK 371
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 38257755   407 TENEVEDKLTSFITVFKYIDDKDVFQKFYARMLAKRLIHGLSMSMDSEEAMINKLKQACGYEFTSKLHRMYTDMSVSADL 486
Cdd:pfam00888 372 SEEELEEKLDKVITLFRYIEDKDVFEKFYKKHLAKRLLLGKSASDDAERSMISKLKEECGSEFTSKLEGMFKDIELSKDL 451
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 38257755   487 NNKFNNFIRNqDTVIDLGISFQIYVLQAGAWPlTQAPSSTFAIPQELEKSVQMFELFYSQHFSGRKLTWLHYLCTGEVKM 566
Cdd:pfam00888 452 NAEFKEHLAN-DNSSKKGIDLNVNVLTSGAWP-TYLTSPDFILPPELEKAIERFEKFYLSKHSGRKLTWLHNLGTAELKA 529
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 38257755   567 NYLGKPYVAMVTTYQMAVLLAFNNS-ETVSYKELQDSTQMNEKELTKTIKSLL--DVKMINHDSEKEDIDAESSFSLNMS 643
Cdd:pfam00888 530 NFPKGKKELNVSTYQMAILLLFNDDgDSLSYEEIQEATGLPDDELKRTLQSLAcaKAKVLLKEPMSKDINPTDVFSFNED 609

                  .
gi 38257755   644 F 644
Cdd:pfam00888 610 F 610
COG5647 COG5647
Cullin, a subunit of E3 ubiquitin ligase [Posttranslational modification, protein turnover, ...
8-745 5.76e-136

Cullin, a subunit of E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones];


Pssm-ID: 227934 [Multi-domain]  Cd Length: 773  Bit Score: 419.59  E-value: 5.76e-136
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 38257755   8 VDFDETWNKLLTTIKAVVMLEYVERA--TWNDRFSDIYALCVAYPEPL-------------GERLYAETKIFLESHVRHL 72
Cdd:COG5647  18 EDFESTWEFIERAIGQIFERLYDSMAilSLMEVYTKIYNYCTNKTRSLesdlrwkidfiylGSRLIQKLVDYAKNYIEEY 97
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 38257755  73 YK-RVLESEEQVLVMYHRYWEEYSKGADYMDCLYRYLNTQYIKKNKLTEAdiqygyggvdmnePLMEIGELALDMWRKLM 151
Cdd:COG5647  98 NRgRSQENMEEFLDELVKFWNRFTKGATMINHLFLYMDRVYLKKARYDKT-------------LVFEVYSLCLVKEKIES 164
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 38257755 152 VEPLQNILIRMLLREIKNDRGGEDPNQKVIHGVINSFVHVEQYK--KKFPLKFYQGIFVSPFLTETGEYYKQEASNLLQE 229
Cdd:COG5647 165 FRLIVDSLINPLLYYVERYRALQSIDRKYIEDAKDMLESLERPSdyKKENLSYYKSVFEPIFLEETWEFYEMESSEVIEL 244
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 38257755 230 SNCSQYMEKVLGRLKDEEIRCRKYLHPSSYTKVIHECQQRMVADHLQFLH---SECHSIIQQERKNDMANMYVLLRAVSS 306
Cdd:COG5647 245 LSVTEYLEKAHKILEREEELVEIYLKVSTKKPLLEVLEDVLITRHLDDLEeqgSGFREALDASNLEKLQVLYRLLSETKY 324
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 38257755 307 GLPHMIEELQKHIHDEGLRA---TSNLTQ-----------EHMPTLFVESVLEVHGKFVQLINTVLNGDQHFMSALDKAL 372
Cdd:COG5647 325 GVQPLQEVFERYVKDEGVLInieTNYIFHckvdvgflgsrECLPKLYVQKLLSCHDLFPSLVNESFEGDGSIVKALGNAF 404
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 38257755 373 TSVVNYREpKSVCKAPELLAKYCDNLLKKSAKGMTENEVEDKLTSFITVFKYIDDKDVFQKFYARMLAKRLIHGLSMSMD 452
Cdd:COG5647 405 KTFINGNE-SADSGPSEYLAKYIDGLLKKDGKQSFIGKIKDLLQDIITLFRYVEEKDVFEKYYKKLLAKRLLNGRSASAQ 483
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 38257755 453 SEEAMINKLKQACGYEFTSKLHRMYTDMSVSADLNNKFNNFIRNQDTVIDlgisFQIYVLQAGAWPLtQAPSSTFAIPQE 532
Cdd:COG5647 484 AELKMISMLKKVCGQEFTSKLEGMFRDISLSSEFTEAFQHSPQSYNKYLD----LFVWVLTQAYWPL-SPEEVSIRLPKE 558
                       570       580       590       600       610       620       630       640
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 38257755 533 LEKSVQMFELFYSQHFSGRKLTWLHYLCTGEVKMNY-LGK--PYVAMVTTYQMAVLLAFNNSETVSYKELQDSTQMNEKE 609
Cdd:COG5647 559 LVPILEGFKKFYSSKHNGRKLKWYWHLGSGEVKARFnEGQkyLEISTFSVYQLLVFLLFNDHEELTFEEILELTKLSTDD 638
                       650       660       670       680       690       700       710       720
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 38257755 610 LTKTIKSLLDVKMINHDSEKEDIDAESSFSLNMSFSSKRTKFKITTSMQKDTPQELEQTRSAVDEDRKMYLQAAIVRIMK 689
Cdd:COG5647 639 LKRVLQSLSCAKLVVLLKDDKLVSPNTKFYVNENFSSKLERIKINYIAESECMQDNLDTHETVEEDRQAELQACIVRIMK 718
                       730       740       750       760       770
                ....*....|....*....|....*....|....*....|....*....|....*.
gi 38257755 690 ARKVLRHNALIQEVISQSRARFNPSISMIKKCIEVLIDKQYIERsQASADEYSYVA 745
Cdd:COG5647 719 ARKKLKHGDLVKEVIAQHKSRFEPKVSMVKRAIETLIEKEYLER-QADDEIYVYLA 773
CULLIN smart00182
Cullin;
424-568 2.05e-61

Cullin;


Pssm-ID: 214545 [Multi-domain]  Cd Length: 143  Bit Score: 202.55  E-value: 2.05e-61
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 38257755    424 YIDDKDVFQKFYARMLAKRLIHGLSMSMDSEEAMINKLKQACGYEFTSKLHRMYTDMSVSADLNNKFNNFIRNQdTVIDL 503
Cdd:smart00182   1 YIQDKDVFEKYYKKHLAKRLILNRSASDDAEENMITKLKQECGYEFTSKLERMFRDISLSKDLNQSFKDMLENN-PSAKP 79
                           90       100       110       120       130       140
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 38257755    504 GISFQIYVLQAGAWPLTQAPsSTFAIPQELEKSVQMFELFYSQHFSGRKLTWLHYLCTGEVKMNY 568
Cdd:smart00182  80 IIDLNVRVLTSGYWPTSSTE-VEINLPQELEDALEEFEEFYLAKHSGRKLTWLHSLGRGEVKANF 143
Cullin_Nedd8 pfam10557
Cullin protein neddylation domain; This is the neddylation site of cullin proteins which are a ...
675-735 5.21e-30

Cullin protein neddylation domain; This is the neddylation site of cullin proteins which are a family of structurally related proteins containing an evolutionarily conserved cullin domain. With the exception of APC2, each member of the cullin family is modified by Nedd8 and several cullins function in Ubiquitin-dependent proteolysis, a process in which the 26S proteasome recognizes and subsequently degrades a target protein tagged with K48-linked poly-ubiquitin chains. Cullins are molecular scaffolds responsible for assembling the ROC1/Rbx1 RING-based E3 ubiquitin ligases, of which several play a direct role in tumorigenesis. Nedd8/Rub1 is a small ubiquitin-like protein, which was originally found to be conjugated to Cdc53, a cullin component of the SCF (Skp1-Cdc53/CUL1-F-box protein) E3 Ub ligase complex in Saccharomyces cerevisiae, and Nedd8 modification has now emerged as a regulatory pathway of fundamental importance for cell cycle control and for embryogenesis in metazoans. The only identified Nedd8 substrates are cullins. Neddylation results in covalent conjugation of a Nedd8 moiety onto a conserved cullin lysine residue.


Pssm-ID: 402267  Cd Length: 62  Bit Score: 112.54  E-value: 5.21e-30
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 38257755   675 DRKMYLQAAIVRIMKARKVLRHNALIQEVISQSRARFNPSISMIKKCIEVLIDKQYIERSQ 735
Cdd:pfam10557   1 DRKHEIQAAIVRIMKSRKTLSHNELVNEVIEQLKSRFKPSVSDIKKRIESLIEKEYLERDE 61
Cullin_Nedd8 smart00884
Cullin protein neddylation domain; This is the neddylation site of cullin proteins which are a ...
672-739 6.25e-28

Cullin protein neddylation domain; This is the neddylation site of cullin proteins which are a family of structurally related proteins containing an evolutionarily conserved cullin domain. With the exception of APC2, each member of the cullin family is modified by Nedd8 and several cullins function in Ubiquitin-dependent proteolysis, a process in which the 26S proteasome recognises and subsequently degrades a target protein tagged with K48-linked poly-ubiquitin chains. Cullins are molecular scaffolds responsible for assembling the ROC1/Rbx1 RING-based E3 ubiquitin ligases, of which several play a direct role in tumorigenesis. Nedd8/Rub1 is a small ubiquitin-like protein, which was originally found to be conjugated to Cdc53, a cullin component of the SCF (Skp1-Cdc53/CUL1-F-box protein) E3 Ub ligase complex in Saccharomyces cerevisiae, and Nedd8 modification has now emerged as a regulatory pathway of fundamental importance for cell cycle control and for embryogenesis in metazoans. The only identified Nedd8 substrates are cullins. Neddylation results in covalent conjugation of a Nedd8 moiety onto a conserved cullin lysine residue.


Pssm-ID: 214883  Cd Length: 68  Bit Score: 106.86  E-value: 6.25e-28
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 38257755    672 VDEDRKMYLQAAIVRIMKARKVLRHNALIQEVISQSRARFNPSISMIKKCIEVLIDKQYIERSQASAD 739
Cdd:smart00884   1 VEEDRKLEIQAAIVRIMKSRKTLSHSELVSEVIEQLKKRFKPSVSDIKKRIESLIEREYLERDEDDPN 68
 
Name Accession Description Interval E-value
Cullin pfam00888
Cullin family;
14-644 0e+00

Cullin family;


Pssm-ID: 395716  Cd Length: 610  Bit Score: 614.18  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 38257755    14 WNKLLTTIKAVvMLEYVERATWNDRFSDIYALCVaypEPLGERLYAETKIFLESHVRHLYKRVLE---SEEQVLVMYHRY 90
Cdd:pfam00888   1 WEKLEDAIDEI-LNKNVSKLSYEELYRAVYNLCL---HKQGEKLYDRLKEYLEEHLKELVKPLLKelaDGEEFLKFYVKE 76
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 38257755    91 WEEYSKGADYMDCLYRYLNTQYIKKnklteadiqygyggvdmnepLMEIGELALDMWRKLMVE-PLQNILIRMLLREIKN 169
Cdd:pfam00888  77 WEDHTISMKMIRDIFMYLDRVYVKR--------------------LPSIYDLGLVLFRDHVFRiPLKDKLIDALLDLIEK 136
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 38257755   170 DRGGEDPNQKVIHGVINSFVHVEQYKKKfplKFYQGIFVSPFLTETGEYYKQEASNLLQE-SNCSQYMEKVLGRLKDEEI 248
Cdd:pfam00888 137 ERNGEVIDRSLIKSVIDMLVSLGEDDSK---KVYEEDFEPPFLEATEEFYRAESQELLAEnSVASEYLKKAERRLEEEEE 213
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 38257755   249 RCRKYLHPSSYTKVIHECQQRMVADHLQFLHS-ECHSIIQQERKNDMANMYVLLRAVSSGLPHMIEELQKHIHDEGLRAT 327
Cdd:pfam00888 214 RVQLYLHSSTKPKLLKVLEEVLISDHLEELLEeELQNLLDDNKIEDLKRLYRLLSRVPDGLDPLRKAFEEYIKEEGKAIV 293
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 38257755   328 SNL-TQEHMPTLFVESVLEVHGKFVQLINTVLNGDQHFMSALDKALTSVVNYRepKSVCKAPELLAKYCDNLLKKSAKGM 406
Cdd:pfam00888 294 KDAkEQTTDAKKYVEDLLELKDKFDKIVKDAFSNDELFVKALDEAFEEFINKN--TSNSKSPELLAKYIDSLLKKGLKGK 371
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 38257755   407 TENEVEDKLTSFITVFKYIDDKDVFQKFYARMLAKRLIHGLSMSMDSEEAMINKLKQACGYEFTSKLHRMYTDMSVSADL 486
Cdd:pfam00888 372 SEEELEEKLDKVITLFRYIEDKDVFEKFYKKHLAKRLLLGKSASDDAERSMISKLKEECGSEFTSKLEGMFKDIELSKDL 451
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 38257755   487 NNKFNNFIRNqDTVIDLGISFQIYVLQAGAWPlTQAPSSTFAIPQELEKSVQMFELFYSQHFSGRKLTWLHYLCTGEVKM 566
Cdd:pfam00888 452 NAEFKEHLAN-DNSSKKGIDLNVNVLTSGAWP-TYLTSPDFILPPELEKAIERFEKFYLSKHSGRKLTWLHNLGTAELKA 529
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 38257755   567 NYLGKPYVAMVTTYQMAVLLAFNNS-ETVSYKELQDSTQMNEKELTKTIKSLL--DVKMINHDSEKEDIDAESSFSLNMS 643
Cdd:pfam00888 530 NFPKGKKELNVSTYQMAILLLFNDDgDSLSYEEIQEATGLPDDELKRTLQSLAcaKAKVLLKEPMSKDINPTDVFSFNED 609

                  .
gi 38257755   644 F 644
Cdd:pfam00888 610 F 610
COG5647 COG5647
Cullin, a subunit of E3 ubiquitin ligase [Posttranslational modification, protein turnover, ...
8-745 5.76e-136

Cullin, a subunit of E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones];


Pssm-ID: 227934 [Multi-domain]  Cd Length: 773  Bit Score: 419.59  E-value: 5.76e-136
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 38257755   8 VDFDETWNKLLTTIKAVVMLEYVERA--TWNDRFSDIYALCVAYPEPL-------------GERLYAETKIFLESHVRHL 72
Cdd:COG5647  18 EDFESTWEFIERAIGQIFERLYDSMAilSLMEVYTKIYNYCTNKTRSLesdlrwkidfiylGSRLIQKLVDYAKNYIEEY 97
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 38257755  73 YK-RVLESEEQVLVMYHRYWEEYSKGADYMDCLYRYLNTQYIKKNKLTEAdiqygyggvdmnePLMEIGELALDMWRKLM 151
Cdd:COG5647  98 NRgRSQENMEEFLDELVKFWNRFTKGATMINHLFLYMDRVYLKKARYDKT-------------LVFEVYSLCLVKEKIES 164
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 38257755 152 VEPLQNILIRMLLREIKNDRGGEDPNQKVIHGVINSFVHVEQYK--KKFPLKFYQGIFVSPFLTETGEYYKQEASNLLQE 229
Cdd:COG5647 165 FRLIVDSLINPLLYYVERYRALQSIDRKYIEDAKDMLESLERPSdyKKENLSYYKSVFEPIFLEETWEFYEMESSEVIEL 244
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 38257755 230 SNCSQYMEKVLGRLKDEEIRCRKYLHPSSYTKVIHECQQRMVADHLQFLH---SECHSIIQQERKNDMANMYVLLRAVSS 306
Cdd:COG5647 245 LSVTEYLEKAHKILEREEELVEIYLKVSTKKPLLEVLEDVLITRHLDDLEeqgSGFREALDASNLEKLQVLYRLLSETKY 324
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 38257755 307 GLPHMIEELQKHIHDEGLRA---TSNLTQ-----------EHMPTLFVESVLEVHGKFVQLINTVLNGDQHFMSALDKAL 372
Cdd:COG5647 325 GVQPLQEVFERYVKDEGVLInieTNYIFHckvdvgflgsrECLPKLYVQKLLSCHDLFPSLVNESFEGDGSIVKALGNAF 404
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 38257755 373 TSVVNYREpKSVCKAPELLAKYCDNLLKKSAKGMTENEVEDKLTSFITVFKYIDDKDVFQKFYARMLAKRLIHGLSMSMD 452
Cdd:COG5647 405 KTFINGNE-SADSGPSEYLAKYIDGLLKKDGKQSFIGKIKDLLQDIITLFRYVEEKDVFEKYYKKLLAKRLLNGRSASAQ 483
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 38257755 453 SEEAMINKLKQACGYEFTSKLHRMYTDMSVSADLNNKFNNFIRNQDTVIDlgisFQIYVLQAGAWPLtQAPSSTFAIPQE 532
Cdd:COG5647 484 AELKMISMLKKVCGQEFTSKLEGMFRDISLSSEFTEAFQHSPQSYNKYLD----LFVWVLTQAYWPL-SPEEVSIRLPKE 558
                       570       580       590       600       610       620       630       640
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 38257755 533 LEKSVQMFELFYSQHFSGRKLTWLHYLCTGEVKMNY-LGK--PYVAMVTTYQMAVLLAFNNSETVSYKELQDSTQMNEKE 609
Cdd:COG5647 559 LVPILEGFKKFYSSKHNGRKLKWYWHLGSGEVKARFnEGQkyLEISTFSVYQLLVFLLFNDHEELTFEEILELTKLSTDD 638
                       650       660       670       680       690       700       710       720
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 38257755 610 LTKTIKSLLDVKMINHDSEKEDIDAESSFSLNMSFSSKRTKFKITTSMQKDTPQELEQTRSAVDEDRKMYLQAAIVRIMK 689
Cdd:COG5647 639 LKRVLQSLSCAKLVVLLKDDKLVSPNTKFYVNENFSSKLERIKINYIAESECMQDNLDTHETVEEDRQAELQACIVRIMK 718
                       730       740       750       760       770
                ....*....|....*....|....*....|....*....|....*....|....*.
gi 38257755 690 ARKVLRHNALIQEVISQSRARFNPSISMIKKCIEVLIDKQYIERsQASADEYSYVA 745
Cdd:COG5647 719 ARKKLKHGDLVKEVIAQHKSRFEPKVSMVKRAIETLIEKEYLER-QADDEIYVYLA 773
CULLIN smart00182
Cullin;
424-568 2.05e-61

Cullin;


Pssm-ID: 214545 [Multi-domain]  Cd Length: 143  Bit Score: 202.55  E-value: 2.05e-61
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 38257755    424 YIDDKDVFQKFYARMLAKRLIHGLSMSMDSEEAMINKLKQACGYEFTSKLHRMYTDMSVSADLNNKFNNFIRNQdTVIDL 503
Cdd:smart00182   1 YIQDKDVFEKYYKKHLAKRLILNRSASDDAEENMITKLKQECGYEFTSKLERMFRDISLSKDLNQSFKDMLENN-PSAKP 79
                           90       100       110       120       130       140
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 38257755    504 GISFQIYVLQAGAWPLTQAPsSTFAIPQELEKSVQMFELFYSQHFSGRKLTWLHYLCTGEVKMNY 568
Cdd:smart00182  80 IIDLNVRVLTSGYWPTSSTE-VEINLPQELEDALEEFEEFYLAKHSGRKLTWLHSLGRGEVKANF 143
Cullin_Nedd8 pfam10557
Cullin protein neddylation domain; This is the neddylation site of cullin proteins which are a ...
675-735 5.21e-30

Cullin protein neddylation domain; This is the neddylation site of cullin proteins which are a family of structurally related proteins containing an evolutionarily conserved cullin domain. With the exception of APC2, each member of the cullin family is modified by Nedd8 and several cullins function in Ubiquitin-dependent proteolysis, a process in which the 26S proteasome recognizes and subsequently degrades a target protein tagged with K48-linked poly-ubiquitin chains. Cullins are molecular scaffolds responsible for assembling the ROC1/Rbx1 RING-based E3 ubiquitin ligases, of which several play a direct role in tumorigenesis. Nedd8/Rub1 is a small ubiquitin-like protein, which was originally found to be conjugated to Cdc53, a cullin component of the SCF (Skp1-Cdc53/CUL1-F-box protein) E3 Ub ligase complex in Saccharomyces cerevisiae, and Nedd8 modification has now emerged as a regulatory pathway of fundamental importance for cell cycle control and for embryogenesis in metazoans. The only identified Nedd8 substrates are cullins. Neddylation results in covalent conjugation of a Nedd8 moiety onto a conserved cullin lysine residue.


Pssm-ID: 402267  Cd Length: 62  Bit Score: 112.54  E-value: 5.21e-30
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 38257755   675 DRKMYLQAAIVRIMKARKVLRHNALIQEVISQSRARFNPSISMIKKCIEVLIDKQYIERSQ 735
Cdd:pfam10557   1 DRKHEIQAAIVRIMKSRKTLSHNELVNEVIEQLKSRFKPSVSDIKKRIESLIEKEYLERDE 61
Cullin_Nedd8 smart00884
Cullin protein neddylation domain; This is the neddylation site of cullin proteins which are a ...
672-739 6.25e-28

Cullin protein neddylation domain; This is the neddylation site of cullin proteins which are a family of structurally related proteins containing an evolutionarily conserved cullin domain. With the exception of APC2, each member of the cullin family is modified by Nedd8 and several cullins function in Ubiquitin-dependent proteolysis, a process in which the 26S proteasome recognises and subsequently degrades a target protein tagged with K48-linked poly-ubiquitin chains. Cullins are molecular scaffolds responsible for assembling the ROC1/Rbx1 RING-based E3 ubiquitin ligases, of which several play a direct role in tumorigenesis. Nedd8/Rub1 is a small ubiquitin-like protein, which was originally found to be conjugated to Cdc53, a cullin component of the SCF (Skp1-Cdc53/CUL1-F-box protein) E3 Ub ligase complex in Saccharomyces cerevisiae, and Nedd8 modification has now emerged as a regulatory pathway of fundamental importance for cell cycle control and for embryogenesis in metazoans. The only identified Nedd8 substrates are cullins. Neddylation results in covalent conjugation of a Nedd8 moiety onto a conserved cullin lysine residue.


Pssm-ID: 214883  Cd Length: 68  Bit Score: 106.86  E-value: 6.25e-28
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 38257755    672 VDEDRKMYLQAAIVRIMKARKVLRHNALIQEVISQSRARFNPSISMIKKCIEVLIDKQYIERSQASAD 739
Cdd:smart00884   1 VEEDRKLEIQAAIVRIMKSRKTLSHSELVSEVIEQLKKRFKPSVSDIKKRIESLIEREYLERDEDDPN 68
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH