NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|410378276|gb|AFV66949|]
View 

growth hormone receptor, partial [Scarturus elater]

Protein Classification

growth hormone receptor binding protein( domain architecture ID 10579657)

growth hormone receptor binding protein (GHBP) is produced either by proteolysis of the GHR (growth hormone receptor) at the cell surface thereby releasing its extracellular domain, the GHBP, or by alternative processing of the GHR transcript

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
GHBP pfam12772
Growth hormone receptor binding; Growth hormone receptor binding protein is produced either by ...
1-282 6.75e-158

Growth hormone receptor binding; Growth hormone receptor binding protein is produced either by proteolysis of the GHR (growth hormone receptor) at the cell surface thereby releasing its extracellular domain, the GHBP (growth hormone-binding protein), or, in rodents, by alternative processing of the GHR transcript. The sheddase proteolytic enzyme responsible for the cleavage is TACE (tumor necrosis factor-alpha-converting enzyme). Growth hormone (GH) binding to GH receptor (GHR) is the initial step that leads to the physiological functions of the hormone. The biological effects of GHBP are determined by the serum levels of growth hormone (GH), which can vary. Low levels of GH can result in a dwarf phenotype and have been positively correlated with an increased life expectancy. High levels of GH can lead to gigantism or a clinical syndrome termed acromegaly and have been implicated in diabetic eye and kidney damage.


:

Pssm-ID: 403851  Cd Length: 303  Bit Score: 441.61  E-value: 6.75e-158
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 410378276    1 FYNDDSWVEFIELDIDDPDEKTEGSDTDRLLNNDHQRSLNILGAKDDDSGRTSCYDPDILETDFPSSDMCDGASGVAQPQ 80
Cdd:pfam12772  21 FYNDDSWVEFIELDIEDPDEKTEGSDTDRLLGHDHLKSLNCLGAKDDDSGRASCYEPDIPETDFSASDTCDGTSDIAQSK 100
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 410378276   81 RLKGEADLLCLDQK-NQNNLPY-DASPATQQPSI-TLIEEDKPRPLLTSETESTHQLASMQISNPSSLANIDFYAQVSDI 157
Cdd:pfam12772 101 KLEKEADLLCLQPKdNETSLPSlERTPATLPPERpTLSEGSKPRPLLTDGTESTSPPVQTQLSNPSSLANTDFYAQVSDI 180
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 410378276  158 TPAGSVVLSPGQKSKAGIPPCDiMHPEVISVCQDNYNMDNAYFCEADAKKRIAVAPHMEVKSHVDPSFNQEDIYVTTESL 237
Cdd:pfam12772 181 TPAGGVVLSPGQKLKAGESQSD-SERETQTKCKQNFVVDSAYFCEADVKKCIAVAPPSEAEPGVGPQFNNEDPYITTESL 259
                         250       260       270       280
                  ....*....|....*....|....*....|....*....|....*
gi 410378276  238 TTTAGRSATAELAlSAEMPVPDYTSIHIVQSPQGLILNATPLPLP 282
Cdd:pfam12772 260 TTTAVSSGTAEGP-SSEMPVADYTSIHIVQSPQGLVLNATALPVP 303
 
Name Accession Description Interval E-value
GHBP pfam12772
Growth hormone receptor binding; Growth hormone receptor binding protein is produced either by ...
1-282 6.75e-158

Growth hormone receptor binding; Growth hormone receptor binding protein is produced either by proteolysis of the GHR (growth hormone receptor) at the cell surface thereby releasing its extracellular domain, the GHBP (growth hormone-binding protein), or, in rodents, by alternative processing of the GHR transcript. The sheddase proteolytic enzyme responsible for the cleavage is TACE (tumor necrosis factor-alpha-converting enzyme). Growth hormone (GH) binding to GH receptor (GHR) is the initial step that leads to the physiological functions of the hormone. The biological effects of GHBP are determined by the serum levels of growth hormone (GH), which can vary. Low levels of GH can result in a dwarf phenotype and have been positively correlated with an increased life expectancy. High levels of GH can lead to gigantism or a clinical syndrome termed acromegaly and have been implicated in diabetic eye and kidney damage.


Pssm-ID: 403851  Cd Length: 303  Bit Score: 441.61  E-value: 6.75e-158
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 410378276    1 FYNDDSWVEFIELDIDDPDEKTEGSDTDRLLNNDHQRSLNILGAKDDDSGRTSCYDPDILETDFPSSDMCDGASGVAQPQ 80
Cdd:pfam12772  21 FYNDDSWVEFIELDIEDPDEKTEGSDTDRLLGHDHLKSLNCLGAKDDDSGRASCYEPDIPETDFSASDTCDGTSDIAQSK 100
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 410378276   81 RLKGEADLLCLDQK-NQNNLPY-DASPATQQPSI-TLIEEDKPRPLLTSETESTHQLASMQISNPSSLANIDFYAQVSDI 157
Cdd:pfam12772 101 KLEKEADLLCLQPKdNETSLPSlERTPATLPPERpTLSEGSKPRPLLTDGTESTSPPVQTQLSNPSSLANTDFYAQVSDI 180
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 410378276  158 TPAGSVVLSPGQKSKAGIPPCDiMHPEVISVCQDNYNMDNAYFCEADAKKRIAVAPHMEVKSHVDPSFNQEDIYVTTESL 237
Cdd:pfam12772 181 TPAGGVVLSPGQKLKAGESQSD-SERETQTKCKQNFVVDSAYFCEADVKKCIAVAPPSEAEPGVGPQFNNEDPYITTESL 259
                         250       260       270       280
                  ....*....|....*....|....*....|....*....|....*
gi 410378276  238 TTTAGRSATAELAlSAEMPVPDYTSIHIVQSPQGLILNATPLPLP 282
Cdd:pfam12772 260 TTTAVSSGTAEGP-SSEMPVADYTSIHIVQSPQGLVLNATALPVP 303
 
Name Accession Description Interval E-value
GHBP pfam12772
Growth hormone receptor binding; Growth hormone receptor binding protein is produced either by ...
1-282 6.75e-158

Growth hormone receptor binding; Growth hormone receptor binding protein is produced either by proteolysis of the GHR (growth hormone receptor) at the cell surface thereby releasing its extracellular domain, the GHBP (growth hormone-binding protein), or, in rodents, by alternative processing of the GHR transcript. The sheddase proteolytic enzyme responsible for the cleavage is TACE (tumor necrosis factor-alpha-converting enzyme). Growth hormone (GH) binding to GH receptor (GHR) is the initial step that leads to the physiological functions of the hormone. The biological effects of GHBP are determined by the serum levels of growth hormone (GH), which can vary. Low levels of GH can result in a dwarf phenotype and have been positively correlated with an increased life expectancy. High levels of GH can lead to gigantism or a clinical syndrome termed acromegaly and have been implicated in diabetic eye and kidney damage.


Pssm-ID: 403851  Cd Length: 303  Bit Score: 441.61  E-value: 6.75e-158
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 410378276    1 FYNDDSWVEFIELDIDDPDEKTEGSDTDRLLNNDHQRSLNILGAKDDDSGRTSCYDPDILETDFPSSDMCDGASGVAQPQ 80
Cdd:pfam12772  21 FYNDDSWVEFIELDIEDPDEKTEGSDTDRLLGHDHLKSLNCLGAKDDDSGRASCYEPDIPETDFSASDTCDGTSDIAQSK 100
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 410378276   81 RLKGEADLLCLDQK-NQNNLPY-DASPATQQPSI-TLIEEDKPRPLLTSETESTHQLASMQISNPSSLANIDFYAQVSDI 157
Cdd:pfam12772 101 KLEKEADLLCLQPKdNETSLPSlERTPATLPPERpTLSEGSKPRPLLTDGTESTSPPVQTQLSNPSSLANTDFYAQVSDI 180
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 410378276  158 TPAGSVVLSPGQKSKAGIPPCDiMHPEVISVCQDNYNMDNAYFCEADAKKRIAVAPHMEVKSHVDPSFNQEDIYVTTESL 237
Cdd:pfam12772 181 TPAGGVVLSPGQKLKAGESQSD-SERETQTKCKQNFVVDSAYFCEADVKKCIAVAPPSEAEPGVGPQFNNEDPYITTESL 259
                         250       260       270       280
                  ....*....|....*....|....*....|....*....|....*
gi 410378276  238 TTTAGRSATAELAlSAEMPVPDYTSIHIVQSPQGLILNATPLPLP 282
Cdd:pfam12772 260 TTTAVSSGTAEGP-SSEMPVADYTSIHIVQSPQGLVLNATALPVP 303
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.20
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH