NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|416802|sp|P32246|]
View 

Protein Classification

7tmA_CCR1 domain-containing protein (domain architecture ID 11606917)

7tmA_CCR1 domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
7tmA_CCR1 cd15183
CC chemokine receptor type 1, member of the class A family of seven-transmembrane G ...
35-312 7.88e-176

CC chemokine receptor type 1, member of the class A family of seven-transmembrane G protein-coupled receptors; CCR1 is widely expressed on both hematopoietic and non-hematopoietic cells and binds to the inflammatory CC chemokines CCL3, CCL5, CCL6, CCL9, CCL15, and CCL23. CCR1 activates the typical chemokine signaling pathway through the G(i/o) type of G proteins, causing inhibition of adenylate cyclase and stimulation of phospholipase C, PKC, calcium flux, and PLA2. Chemokines are principal regulators for leukocyte trafficking, recruitment, and activation. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling. Currently, there are ten known receptors for CC chemokines, seven for CXC chemokines, and single receptors for the XC and CX3C chemokines.


:

Pssm-ID: 320311  Cd Length: 278  Bit Score: 489.00  E-value: 7.88e-176
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802    35 QLLPPLYSLVFVIGLVGNILVVLVLVQYKRLKNMTSIYLLNLAISDLLFLFTLPFWIDYKLKDDWVFGDAMCKILSGFYY 114
Cdd:cd15183   1 TLLPPLYSLVFIIGVVGNVLVVLVLIQHKRLRNMTSIYLFNLAISDLVFLFTLPFWIDYKLKDDWIFGDAMCKFLSGFYY 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802   115 TGLYSEIFFIILLTIDRYLAIVHAVFALRARTVTFGVITSIIIWALAILASMPGLYFSKTQWEFTHHTCSLHFPHESLRE 194
Cdd:cd15183  81 LGLYSEIFFIILLTIDRYLAIVHAVFALRARTVTFGIITSIITWALAILASMPCLYFFKSQWEFTHHTCSAHFPRKSLIR 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802   195 WKLFQALKLNLFGLVLPLLVMIICYTGIIKILLRRPNEKKSKAVRLIFVIMIIFFLFWTPYNLTILISVFQDFLFTHECE 274
Cdd:cd15183 161 WKRFQALKLNLLGLILPLLVMIICYTGIINILLRRPNEKKAKAVRLIFVITLLFFLLWTPYNLAAFVSAFQDVLFTPSCE 240
                       250       260       270
                ....*....|....*....|....*....|....*...
gi 416802   275 QSRHLDLAVQVTEVIAYTHCCVNPVIYAFVGERFRKYL 312
Cdd:cd15183 241 QSQQLDLALQVTEVIAYTHCCVNPVIYVFVGERFRKYL 278
 
Name Accession Description Interval E-value
7tmA_CCR1 cd15183
CC chemokine receptor type 1, member of the class A family of seven-transmembrane G ...
35-312 7.88e-176

CC chemokine receptor type 1, member of the class A family of seven-transmembrane G protein-coupled receptors; CCR1 is widely expressed on both hematopoietic and non-hematopoietic cells and binds to the inflammatory CC chemokines CCL3, CCL5, CCL6, CCL9, CCL15, and CCL23. CCR1 activates the typical chemokine signaling pathway through the G(i/o) type of G proteins, causing inhibition of adenylate cyclase and stimulation of phospholipase C, PKC, calcium flux, and PLA2. Chemokines are principal regulators for leukocyte trafficking, recruitment, and activation. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling. Currently, there are ten known receptors for CC chemokines, seven for CXC chemokines, and single receptors for the XC and CX3C chemokines.


Pssm-ID: 320311  Cd Length: 278  Bit Score: 489.00  E-value: 7.88e-176
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802    35 QLLPPLYSLVFVIGLVGNILVVLVLVQYKRLKNMTSIYLLNLAISDLLFLFTLPFWIDYKLKDDWVFGDAMCKILSGFYY 114
Cdd:cd15183   1 TLLPPLYSLVFIIGVVGNVLVVLVLIQHKRLRNMTSIYLFNLAISDLVFLFTLPFWIDYKLKDDWIFGDAMCKFLSGFYY 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802   115 TGLYSEIFFIILLTIDRYLAIVHAVFALRARTVTFGVITSIIIWALAILASMPGLYFSKTQWEFTHHTCSLHFPHESLRE 194
Cdd:cd15183  81 LGLYSEIFFIILLTIDRYLAIVHAVFALRARTVTFGIITSIITWALAILASMPCLYFFKSQWEFTHHTCSAHFPRKSLIR 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802   195 WKLFQALKLNLFGLVLPLLVMIICYTGIIKILLRRPNEKKSKAVRLIFVIMIIFFLFWTPYNLTILISVFQDFLFTHECE 274
Cdd:cd15183 161 WKRFQALKLNLLGLILPLLVMIICYTGIINILLRRPNEKKAKAVRLIFVITLLFFLLWTPYNLAAFVSAFQDVLFTPSCE 240
                       250       260       270
                ....*....|....*....|....*....|....*...
gi 416802   275 QSRHLDLAVQVTEVIAYTHCCVNPVIYAFVGERFRKYL 312
Cdd:cd15183 241 QSQQLDLALQVTEVIAYTHCCVNPVIYVFVGERFRKYL 278
7tm_1 pfam00001
7 transmembrane receptor (rhodopsin family); This family contains, amongst other ...
51-301 3.96e-71

7 transmembrane receptor (rhodopsin family); This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins.


Pssm-ID: 333754 [Multi-domain]  Cd Length: 255  Bit Score: 222.18  E-value: 3.96e-71
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802      51 GNILVVLVLVQYKRLKNMTSIYLLNLAISDLLF-LFTLPFWIDYKLKDDWVFGDAMCKILSGFYYTGLYSEIFFIILLTI 129
Cdd:pfam00001   1 GNLLVILVILRNKKLRTPTNIFLLNLAVADLLFlLLTLPFWLVYYLHGTWPFGSALCKLVTFLDVVNGYASILLLTAISI 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802     130 DRYLAIVHAVFALRARTVtfGVITSIIIWALAILASMPGLYFSKT--QWEFTHHTCSLHFPHESlreWKLFQALKLNLFG 207
Cdd:pfam00001  81 DRYLAIVHPLRYRRIMRR--AKAIILLIWVLALLLSLPPLLGWNTldIPSNGVTSCLITFPESL---WPVSYLLFSTVLG 155
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802     208 LVLPLLVMIICYTGIIKILL------RRPNEKKSKAVRLIFVIMIIFFLFWTPYNLTILISVFQDFLFTHECEQSRHLDL 281
Cdd:pfam00001 156 FLLPLLVILVCYTRIIRTLRkqqsssIRSVRSERKALKTLLVVVVVFILCWLPYHILLLLDSLCDLGIIISCEVVTPPRT 235
                         250       260
                  ....*....|....*....|
gi 416802     282 AVQVTEVIAYTHCCVNPVIY 301
Cdd:pfam00001 236 LLQLTVWLAYSNSCLNPIIY 255
PHA03087 PHA03087
G protein-coupled chemokine receptor-like protein; Provisional
40-315 4.33e-68

G protein-coupled chemokine receptor-like protein; Provisional


Pssm-ID: 222976 [Multi-domain]  Cd Length: 335  Bit Score: 216.95  E-value: 4.33e-68
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802     40 LYSLVFVIGLVGNILVVLVLVQYKrLKNMTSIYLLNLAISDLLFLFTLPFWIDYKLKDDWVFGDAMCKILSGFYYTGLYS 119
Cdd:PHA03087  46 VYSTIFFFGLVGNIIVIYVLTKTK-IKTPMDIYLLNLAVSDLLFVMTLPFQIYYYILFQWSFGEFACKIVSGLYYIGFYN 124
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802    120 EIFFIILLTIDRYLAIVHAVFALRARTVTFGVITSIIIWALAILASMPGLYFSKTQWEFTHHTCSLHFPHESLReWKLFQ 199
Cdd:PHA03087 125 SMNFITVMSVDRYIAIVHPVKSNKINTVKYGYIVSLVIWIISIIETTPILFVYTTKKDHETLICCMFYNNKTMN-WKLFI 203
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802    200 ALKLNLFGLVLPLLVMIICYTGIIKILLRRPNEKKS-KAVRLIFVIMIIFFLFWTPYNLTILISVFQDFLFTHECEQSRH 278
Cdd:PHA03087 204 NFEINIIGMLIPLTILLYCYSKILITLKGINKSKKNkKAIKLVLIIVILFVIFWLPFNVSVFVYSLHILHFKSGCKAVKY 283
                        250       260       270
                 ....*....|....*....|....*....|....*..
gi 416802    279 LDLAVQVTEVIAYTHCCVNPVIYAFVGERFRKYLRQL 315
Cdd:PHA03087 284 IQYALHVTEIISLSHCCINPLIYAFVSEFFNKHKKKS 320
 
Name Accession Description Interval E-value
7tmA_CCR1 cd15183
CC chemokine receptor type 1, member of the class A family of seven-transmembrane G ...
35-312 7.88e-176

CC chemokine receptor type 1, member of the class A family of seven-transmembrane G protein-coupled receptors; CCR1 is widely expressed on both hematopoietic and non-hematopoietic cells and binds to the inflammatory CC chemokines CCL3, CCL5, CCL6, CCL9, CCL15, and CCL23. CCR1 activates the typical chemokine signaling pathway through the G(i/o) type of G proteins, causing inhibition of adenylate cyclase and stimulation of phospholipase C, PKC, calcium flux, and PLA2. Chemokines are principal regulators for leukocyte trafficking, recruitment, and activation. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling. Currently, there are ten known receptors for CC chemokines, seven for CXC chemokines, and single receptors for the XC and CX3C chemokines.


Pssm-ID: 320311  Cd Length: 278  Bit Score: 489.00  E-value: 7.88e-176
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802    35 QLLPPLYSLVFVIGLVGNILVVLVLVQYKRLKNMTSIYLLNLAISDLLFLFTLPFWIDYKLKDDWVFGDAMCKILSGFYY 114
Cdd:cd15183   1 TLLPPLYSLVFIIGVVGNVLVVLVLIQHKRLRNMTSIYLFNLAISDLVFLFTLPFWIDYKLKDDWIFGDAMCKFLSGFYY 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802   115 TGLYSEIFFIILLTIDRYLAIVHAVFALRARTVTFGVITSIIIWALAILASMPGLYFSKTQWEFTHHTCSLHFPHESLRE 194
Cdd:cd15183  81 LGLYSEIFFIILLTIDRYLAIVHAVFALRARTVTFGIITSIITWALAILASMPCLYFFKSQWEFTHHTCSAHFPRKSLIR 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802   195 WKLFQALKLNLFGLVLPLLVMIICYTGIIKILLRRPNEKKSKAVRLIFVIMIIFFLFWTPYNLTILISVFQDFLFTHECE 274
Cdd:cd15183 161 WKRFQALKLNLLGLILPLLVMIICYTGIINILLRRPNEKKAKAVRLIFVITLLFFLLWTPYNLAAFVSAFQDVLFTPSCE 240
                       250       260       270
                ....*....|....*....|....*....|....*...
gi 416802   275 QSRHLDLAVQVTEVIAYTHCCVNPVIYAFVGERFRKYL 312
Cdd:cd15183 241 QSQQLDLALQVTEVIAYTHCCVNPVIYVFVGERFRKYL 278
7tmA_CCR5_CCR2 cd15184
CC chemokine receptor types 5 and 2, member of the class A family of seven-transmembrane G ...
35-312 5.42e-141

CC chemokine receptor types 5 and 2, member of the class A family of seven-transmembrane G protein-coupled receptors; CCR2 and CCR5 share very high amino acid sequence identity. Both receptors play important roles in the trafficking of monocytes/macrophages and are implicated in the pathogenesis of immunologic diseases (rheumatoid arthritis, celiac disease, and transplant rejection) and cardiovascular diseases (atherosclerosis and autoimmune hepatitis). CCR2 is a receptor specific for members of the monocyte chemotactic protein family, including CCL2, CCL7, and CCL13. Conversely, CCR5 is a major co-receptor for HIV infection and binds many CC chemokine ligands, including CC chemokine ligands including CCL2, CCL3, CCL4, CCL5, CCL11, CCL13, CCL14, and CCL16. CCR2 is expressed primarily on blood monocytes and memory T cells, whereas CCR5 is expressed on antigen-presenting cells (macrophages and dendritic cells) and activated T effector cells. Chemokines are principal regulators for leukocyte trafficking, recruitment, and activation. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling. Currently, there are ten known receptors for CC chemokines, seven for CXC chemokines, and single receptors for the XC and CX3C chemokines.


Pssm-ID: 341338  Cd Length: 278  Bit Score: 400.67  E-value: 5.42e-141
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802    35 QLLPPLYSLVFVIGLVGNILVVLVLVQYKRLKNMTSIYLLNLAISDLLFLFTLPFWIDYKlKDDWVFGDAMCKILSGFYY 114
Cdd:cd15184   1 RLLPPLYSLVFIFGFVGNMLVVLILINCKKLKSMTDIYLLNLAISDLLFLLTLPFWAHYA-ANEWVFGNAMCKLLTGLYH 79
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802   115 TGLYSEIFFIILLTIDRYLAIVHAVFALRARTVTFGVITSIIIWALAILASMPGLYFSKTQWEFTHHTCSLHFPHESLRE 194
Cdd:cd15184  80 IGFFSGIFFIILLTIDRYLAIVHAVFALKARTVTFGVVTSVVTWVVAVFASLPGIIFTKSQKEGSHYTCSPHFPPSQYQF 159
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802   195 WKLFQALKLNLFGLVLPLLVMIICYTGIIKILLRRPNEKK-SKAVRLIFVIMIIFFLFWTPYNLTILISVFQDFLFTHEC 273
Cdd:cd15184 160 WKNFQTLKMNILGLVLPLLVMIICYSGILKTLLRCRNEKKrHKAVRLIFTIMIVYFLFWAPYNIVLLLNTFQEFFGLNNC 239
                       250       260       270
                ....*....|....*....|....*....|....*....
gi 416802   274 EQSRHLDLAVQVTEVIAYTHCCVNPVIYAFVGERFRKYL 312
Cdd:cd15184 240 SSSNRLDQAMQVTETLGMTHCCINPVIYAFVGEKFRSYL 278
7tmA_Chemokine_R cd14984
classical and atypical chemokine receptors, member of the class A family of ...
35-312 9.68e-140

classical and atypical chemokine receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Chemokines are principal regulators for leukocyte trafficking, recruitment, and activation. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling. Currently, there are ten known receptors for CC chemokines, seven for CXC chemokines, and single receptors for the XC and CX3C chemokines. In addition to these classical chemokine receptors, there exists a subfamily of atypical chemokine receptors (ACKRs) that are unable to couple to G-proteins and, instead, they preferentially mediate beta-arrestin dependent processes, such as receptor internalization, after ligand binding. The classical chemokine receptors contain a conserved DRYLAIV motif in the second intracellular loop, which is required for G-protein coupling. However, the ACKRs lack this conserved motif and fail to couple to G-proteins and induce classical GPCR signaling. Five receptors have been identified for the ACKR family, including CC-chemokine receptors like 1 and 2 (CCRL1 and CCRL2), CXCR7, Duffy antigen receptor for chemokine (DARC), and D6. Both ACKR1 (DARC) and ACKR3 (CXCR7) show low sequence homology to the classic chemokine receptors.


Pssm-ID: 341319 [Multi-domain]  Cd Length: 278  Bit Score: 397.36  E-value: 9.68e-140
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802    35 QLLPPLYSLVFVIGLVGNILVVLVLVQYKRLKNMTSIYLLNLAISDLLFLFTLPFWIDYKLkDDWVFGDAMCKILSGFYY 114
Cdd:cd14984   1 VFLPVLYSLVFLLGLVGNSLVLLVLLYYRKLRSMTDVYLLNLALADLLFVLTLPFWAVYAA-DGWVFGSFLCKLVSALYT 79
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802   115 TGLYSEIFFIILLTIDRYLAIVHAVFALRARTVTFGVITSIIIWALAILASMPGLYFSKTQWEFTHHTCSLHFPHESLRE 194
Cdd:cd14984  80 INFYSGILFLACISIDRYLAIVHAVSALRARTLLHGKLTCLGVWALALLLSLPEFIFSQVSEENGSSICSYDYPEDTATT 159
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802   195 WKLFQALKLNLFGLVLPLLVMIICYTGIIKILLRRPNEKKSKAVRLIFVIMIIFFLFWTPYNLTILISVFQDFLFT-HEC 273
Cdd:cd14984 160 WKTLLRLLQNILGFLLPLLVMLFCYSRIIRTLLRARNHKKHRALRVIFAVVVVFFLCWLPYNIVLLLDTLQLLGIIsRSC 239
                       250       260       270
                ....*....|....*....|....*....|....*....
gi 416802   274 EQSRHLDLAVQVTEVIAYTHCCVNPVIYAFVGERFRKYL 312
Cdd:cd14984 240 ELSKSLDYALQVTESLAFSHCCLNPVLYAFVGVKFRKYL 278
7tmA_CCR3 cd15185
CC chemokine receptor type 3, member of the class A family of seven-transmembrane G ...
35-312 1.14e-136

CC chemokine receptor type 3, member of the class A family of seven-transmembrane G protein-coupled receptors; CCR3 is a highly promiscuous receptor that binds a variety of inflammatory CC-type chemokines, including CCL11 (eotaxin-1), CCL3L1, CCL5 (regulated on activation, normal T cell expressed and secreted; RANTES), CCL7 (monocyte-specific chemokine 3 or MCP-3), CCL8 (MCP-2), CCL11, CCL13 (MCP-4), CCL15, CCL24 (eotaxin-2), CCL26 (eotaxin-3), and CCL28. Among these, the eosinophil chemotactic chemokines (CCL11, CCL24, and CCL26) are the most potent and specific ligands. In addition to eosinophil, CCR3 is expressed on cells involved in allergic responses, such as basophils, Th2 lymphocytes, and mast cells. Chemokines are principal regulators for leukocyte trafficking, recruitment, and activation. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling. Currently, there are ten known receptors for CC chemokines, seven for CXC chemokines, and single receptors for the XC and CX3C chemokines.


Pssm-ID: 341339  Cd Length: 278  Bit Score: 389.57  E-value: 1.14e-136
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802    35 QLLPPLYSLVFVIGLVGNILVVLVLVQYKRLKNMTSIYLLNLAISDLLFLFTLPFWIDYKLKDDWVFGDAMCKILSGFYY 114
Cdd:cd15185   1 QFLPPLYSLVFIVGLLGNVVVVVILIKYRRLRIMTNIYLLNLAISDLLFLFTLPFWIHYVRWNNWVFGHGMCKLLSGFYY 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802   115 TGLYSEIFFIILLTIDRYLAIVHAVFALRARTVTFGVITSIIIWALAILASMPGLYFSKTQWEFTHHTCSLHFPHESLRE 194
Cdd:cd15185  81 LGLYSEIFFIILLTIDRYLAIVHAVFALRARTVTFGIITSIITWGLAVLAALPEFIFYETQELFEEFLCSPLYPEDTEDS 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802   195 WKLFQALKLNLFGLVLPLLVMIICYTGIIKILLRRPNEKKSKAVRLIFVIMIIFFLFWTPYNLTILISVFQDFLFTHECE 274
Cdd:cd15185 161 WKRFHALRMNIFGLALPLLIMVICYTGIIKTLLRCPSKKKYKAIRLIFVIMVVFFIFWTPYNLVLLLSAFQSIFFETDCE 240
                       250       260       270
                ....*....|....*....|....*....|....*...
gi 416802   275 QSRHLDLAVQVTEVIAYTHCCVNPVIYAFVGERFRKYL 312
Cdd:cd15185 241 RSKHLDLAMQVTEVIAYTHCCINPVIYAFVGERFRKYL 278
7tmA_CCR8 cd15187
CC chemokine receptor type 8, member of the class A family of seven-transmembrane G ...
36-312 8.81e-94

CC chemokine receptor type 8, member of the class A family of seven-transmembrane G protein-coupled receptors; CCR8, the receptor for the CC chemokines CCL1 and CC16, is highly expressed on allergen-specific T-helper type 2 cells, and is implicated in the pathogenesis of human asthma. CCL1- and CCR8-expressing CD4+ effector T lymphocytes are shown to have a critical role in lung mucosal inflammatory responses. CCR8 is also a functional receptor for CCL16, a liver-expressed CC chemokine that involved in attracting lymphocytes, dendritic cells, and monocytes. Chemokines are principal regulators for leukocyte trafficking, recruitment, and activation. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling. Currently, there are ten known receptors for CC chemokines, seven for CXC chemokines, and single receptors for the XC and CX3C chemokines.


Pssm-ID: 320315  Cd Length: 276  Bit Score: 280.53  E-value: 8.81e-94
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802    36 LLPPLYSLVFVIGLVGNILVVLVLVQYKRLKNMTSIYLLNLAISDLLFLFTLPFWIDYKLkDDWVFGDAMCKILSGFYYT 115
Cdd:cd15187   2 FLPVLYCLLFVFGLLGNSLVIWVLVACKKLRSMTDVYLLNLAASDLLFVFSLPFQAYYLL-DQWVFGNAMCKIVSGAYYI 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802   116 GLYSEIFFIILLTIDRYLAIVHAVFALRARTVTFGVITSIIIWALAILASMPGLYFSKTQWEFTHHTCSLHFPHESLReW 195
Cdd:cd15187  81 GFYSSMFFITLMSIDRYLAIVHAVYALKVRTASHGTILSLALWLVAILASVPLLVFYQVASEDGRLQCIPFYPGQGNS-W 159
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802   196 KLFQALKLNLFGLVLPLLVMIICYTGIIKILLRRPNEKKSKAVRLIFVIMIIFFLFWTPYNLTILISVFQDFLFTHECEQ 275
Cdd:cd15187 160 KVFTNFEVNILGLLIPFSILIFCYHNILRNLRRCHNQNKTKAIKLVFIVVIVFFLFWTPFNVVLFLDSLHSLHIIDGCQN 239
                       250       260       270
                ....*....|....*....|....*....|....*..
gi 416802   276 SRHLDLAVQVTEVIAYTHCCVNPVIYAFVGERFRKYL 312
Cdd:cd15187 240 SQRLTLALHLTETISFTHCCLNPVIYAFVGEKFKKHL 276
7tmA_CX3CR1 cd15186
CX3C chemokine receptor 1, member of the class A family of seven-transmembrane G ...
36-312 3.76e-84

CX3C chemokine receptor 1, member of the class A family of seven-transmembrane G protein-coupled receptors; CX3CR1 is an inflammatory receptor specific for CX3CL1 (also known as fractalkine in human), which is involved in the adhesion and migration of leukocytes. The CX3C chemokine subfamily is only represented by CX3CL1, which exists in both soluble and membrane-anchored forms. Membrane-anchored form promotes strong adhesion of receptor-bearing leukocytes to CX3CL1-expressing endothelial cells. On the other hand, soluble CX3CL1, which is released by the proteolytic cleavage of membrane-anchored CX3CL1, is a potent chemoattractant for CX3CR1-expressing T cells and monocytes. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling.


Pssm-ID: 320314 [Multi-domain]  Cd Length: 273  Bit Score: 255.91  E-value: 3.76e-84
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802    36 LLPPLYSLVFVIGLVGNILVVLVLVQYKRLKNMTSIYLLNLAISDLLFLFTLPFWIDYkLKDDWVFGDAMCKILSGFYYT 115
Cdd:cd15186   2 FLSIFYSLVFAFGLVGNLLVVLALTNSGKSKSITDIYLLNLALSDLLFVATLPFWTHY-LINEWGLHNAMCKLTTAFFFI 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802   116 GLYSEIFFIILLTIDRYLAIVHAVFALRARTVTFGVITSIIIWALAILASMPGLYFSKTQweftHHTCSLHFPHESLREW 195
Cdd:cd15186  81 GFFGGIFFITVISIDRYLAIVLAANSMNNRTVQHGVTISLGVWAAAILVAVPQFMFTKMK----ENECLGDYPEVLQEIW 156
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802   196 KLFQALKLNLFGLVLPLLVMIICYTGIIKILLRRPNEKKSKAVRLIFVIMIIFFLFWTPYNLTILISVFQDFLFTHECEQ 275
Cdd:cd15186 157 PVLRNVELNFLGFLLPLLIMSYCYFRIIQTLFSCKNHKKARAIKLILLVVIVFFLFWTPYNVMIFLETLKLYDFFPSCDM 236
                       250       260       270
                ....*....|....*....|....*....|....*..
gi 416802   276 SRHLDLAVQVTEVIAYTHCCVNPVIYAFVGERFRKYL 312
Cdd:cd15186 237 KKDLRLALSVTETIAFSHCCLNPLIYAFAGEKFRRYL 273
7tmA_CCRL2 cd15171
CC chemokine receptor-like 2, member of the class A family of seven-transmembrane G ...
35-312 1.20e-78

CC chemokine receptor-like 2, member of the class A family of seven-transmembrane G protein-coupled receptors; Chemokine (CC-motif) receptor-like 2 (CCRL2) is a member of the atypical chemokine receptor family. CCRL2, like other atypical receptors, has an alteration in the conserved DRYLAIV motif in the third intracellular loop, which is essential for GPCR coupling and signaling. CCR2L is expressed in most hematopoietic cells and many lymphoid organs as well as in heart and lung. CCRL2 was initially reported to promote chemotaxis and calcium fluxes in responses to chemokines (CCL2, CCL5, CCL7, and CCL8); however, these results are still controversial. More recently, chemerin, a chemotactic agonist of CMKLR1 (chemokine-like receptor-1) and GPR1, was identified as a novel non-signaling ligand for both human and mouse CCRL2. Chemokines are principal regulators for leukocyte trafficking, recruitment, and activation. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C).


Pssm-ID: 320299  Cd Length: 279  Bit Score: 242.04  E-value: 1.20e-78
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802    35 QLLPPLYSLVFVIGLVGNILVVLVLVQYKRLKNMTSIYLLNLAISDLLFLFTLPFWIDYKLkDDWVFGDAMCKILSGFYY 114
Cdd:cd15171   1 QLVPQLCSAVFLVGLLDNGLVVFILVKYKGLKHVENIYFLNLAVSNLCFLLTLPFWAHAAW-HGGSLGNPTCKVLVALSS 79
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802   115 TGLYSEIFFIILLTIDRYLAIVHA-VFALRARTVTFGVITSIIIWALAILASMPGLYFSKTQWEFTHHTCSLHFPHESLR 193
Cdd:cd15171  80 VGLHSEALFNVLLTVQASRVFFHGrLASSARRVAPCGIIASVLAWLTAFLVTLPEFVFYKPQMDSQKSKCAFSRPHFLPA 159
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802   194 E---WKLFQALKLNLFGLVLPLLVMIICYTGIIKILLRRpnEKKSKAVRLIFVIMIIFFLFWTPYNLTILISVFQDFLFT 270
Cdd:cd15171 160 EetfWKYFLTLKMNIVVLVFPLLVFIICCVQLRKTQRFR--ERQRDLSKLVFAIMVVFLLMWAPYNIALFLSAFKEHFSL 237
                       250       260       270       280
                ....*....|....*....|....*....|....*....|..
gi 416802   271 HECEQSRHLDLAVQVTEVIAYTHCCVNPVIYAFVGERFRKYL 312
Cdd:cd15171 238 RDCKSSYHLDASVQVTKLIATTHCCVNPLLYALLDPAFRRRL 279
7tmA_XCR1 cd15182
XC chemokine receptor 1, member of the class A family of seven-transmembrane G protein-coupled ...
36-312 1.47e-77

XC chemokine receptor 1, member of the class A family of seven-transmembrane G protein-coupled receptors; XCR1 is a chemokine receptor specific for XCL1 and XCL2 (previously called lymphotatctin alpha/beta), which differ in only two amino acids. XCL1/2 is the only member of the C chemokine subfamily, which is unique as containing only two of the four cysteines that are found in other chemokine families. Human XCL1/2 has been shown to be secreted by activated CD8+ T cells and upon activation of the innate immune system. Chemokines are principal regulators for leukocyte trafficking, recruitment, and activation. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling.


Pssm-ID: 341337 [Multi-domain]  Cd Length: 271  Bit Score: 239.19  E-value: 1.47e-77
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802    36 LLPPLYSLVFVIGLVGNILVVLVLVQYKRLKNMTSIYLLNLAISDLLFLFTLPFWIDYKLKDdWVFGDAMCKILSGFYYT 115
Cdd:cd15182   2 FLPVFYYLVFLLSLLGNGLVLWILVKYEKLKTLTNIFILNLAISDLLFTFTLPFWASYHSSG-WIFGEILCKAVTSIFYI 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802   116 GLYSEIFFIILLTIDRYLAIVHAVFALRARTVTFGVITSIIIWALAILASMPGLYFSKTQwefTHHTCSLHFPHESLReW 195
Cdd:cd15182  81 GFYSSILFLTLMTIDRYLAVVHPLSALRSRKLRYASLVSVAVWVISILASLPELILSTVM---KSDEDGSLCEYSSIK-W 156
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802   196 KLFQALKLNLFgLVLPLLVMIICYTGIIKILLRRPNEKKSKAVRLIFVIMIIFFLFWTPYNLTILISVFQDfLFTHECEQ 275
Cdd:cd15182 157 KLGYYYQQNLF-FLIPLGIIVYCYVRILQTLMRTRTMRKHRTVKLIFVIVLVFFLSWAPYNIVIFLRSLKD-LTIPICEC 234
                       250       260       270
                ....*....|....*....|....*....|....*..
gi 416802   276 SRHLDLAVQVTEVIAYTHCCVNPVIYAFVGERFRKYL 312
Cdd:cd15182 235 SKQLDYAFYICRNIAFSHCCLNPVFYVFVGVKFRNHL 271
7tmA_CXCR1_2 cd15178
CXC chemokine receptor types 1 and 2, member of the class A family of seven-transmembrane G ...
40-312 2.21e-74

CXC chemokine receptor types 1 and 2, member of the class A family of seven-transmembrane G protein-coupled receptors; CXCR1 and CXCR2 are closely related chemotactic receptors for a group of CXC chemokines distinguished by the presence of the amino acid motif ELR immediately adjacent to their CXC motif. Expression of CXCR1 and CXCR2 is strictly controlled in neutrophils by external stimuli such as lipopolysaccharide (LPS), tumor necrosis factor (TNF)-alpha, Toll-like receptor agonists, and nitric oxide. CXCL8 (formerly known as interleukin-8) binds with high-affinity and activates both receptors. CXCR1 also binds CXCL7 (neutrophil-activating protein-2), whereas CXCR2 non-selectively binds to all seven ELR-positive chemokines (CXCL1-7). Chemokines are principal regulators for leukocyte trafficking, recruitment, and activation. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling. Currently, there are ten known receptors for CC chemokines, seven for CXC chemokines, and single receptors for the XC and CX3C chemokines.


Pssm-ID: 341333 [Multi-domain]  Cd Length: 279  Bit Score: 231.39  E-value: 2.21e-74
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802    40 LYSLVFVIGLVGNILVVLVLVQYKRLKNMTSIYLLNLAISDLLFLFTLPFWIDYKLKdDWVFGDAMCKILSGFYYTGLYS 119
Cdd:cd15178   6 IYVLVFLLSLPGNSLVVLVILYNRRSRSSTDVYLLHLAIADLLFALTLPFWAVSVVK-GWIFGTFMCKLVSLLQEANFYS 84
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802   120 EIFFIILLTIDRYLAIVHAVFALRARTVTFGVItSIIIWALAILASMPGLYFSKTqweFTHHT-----CSLHFPHESLRE 194
Cdd:cd15178  85 GILLLACISVDRYLAIVHATRALTQKRHLVKFV-CAGVWLLSLLLSLPALLNRDA---FKPPNsgrtvCYENLGNESADK 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802   195 WKLFQALKLNLFGLVLPLLVMIICYTGIIKILLRRPNEKKSKAVRLIFVIMIIFFLFWTPYNLTILI-SVFQDFLFTHEC 273
Cdd:cd15178 161 WRVVLRILRHTLGFLLPLVVMLFCYGFTIKTLLQTRSFQKHRAMRVIFAVVLAFLLCWLPYNVTVLIdTLMRTKLITETC 240
                       250       260       270
                ....*....|....*....|....*....|....*....
gi 416802   274 EQSRHLDLAVQVTEVIAYTHCCVNPVIYAFVGERFRKYL 312
Cdd:cd15178 241 ELRNHVDVALYVTQILGFLHSCINPVLYAFIGQKFRNNL 279
7tmA_CCR9 cd15174
CC chemokine receptor type 9, member of the class A family of seven-transmembrane G ...
37-312 1.49e-73

CC chemokine receptor type 9, member of the class A family of seven-transmembrane G protein-coupled receptors; CCR9 is a homeostatic receptor specific for CCL25 (formerly known as thymus expressed chemokine) and is highly expressed on both immature and mature thymocytes as well as on intestinal homing T Lymphocytes and mucosal Lymphocytes. In cutaneous melanoma, activation of CCR9-CCL25 has been shown to stimulate metastasis to the small intestine. Chemokines are principal regulators for leukocyte trafficking, recruitment, and activation. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling. Currently, there are ten known receptors for CC chemokines, seven for CXC chemokines, and single receptors for the XC and CX3C chemokines. The CC chemokine receptors are all activating the G protein Gi.


Pssm-ID: 320302  Cd Length: 280  Bit Score: 229.25  E-value: 1.49e-73
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802    37 LPPLYSLVFVIGLVGNILVVLVLVQYKRLKNMTSIYLLNLAISDLLFLFTLPFWIdYKLKDDWVFGDAMCKILSGFYYTG 116
Cdd:cd15174   3 LPPLYWLIFLVGAVGNSLVVLIYTYYRRRKTMTDVYLLNLAIADLLFLCTLPFWA-TAASSGWVFGTFLCKVVNSMYKIN 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802   117 LYSEIFFIILLTIDRYLAIVHAVFA--LRARTVTFGVITSIIIWALAILASMPGLYFSKTQWEFTHHTCSLHFPHESLRE 194
Cdd:cd15174  82 FYSCMLLLTCISVDRYIAIVQATKAhnSKNKRLLYSKLVCFFVWLLSTILSLPEILFSQSKEEESVTTCTMVYPSNESNR 161
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802   195 WK-LFQALKLnLFGLVLPLLVMIICYTGIIKILLRRPNEKKSKAVRLIFVIMIIFFLFWTPYNLTILISVFQ-DFLFTHE 272
Cdd:cd15174 162 FKvAVLALKV-TVGFFLPFVVMVICYTLIIHTLLQAKRFQKHKALKVIIAVVTVFVLSQLPYNSILLIKTINaYNITITD 240
                       250       260       270       280
                ....*....|....*....|....*....|....*....|
gi 416802   273 CEQSRHLDLAVQVTEVIAYTHCCVNPVIYAFVGERFRKYL 312
Cdd:cd15174 241 CATSQNLDIAGQVTQSIAFLHSCLNPFLYVFVGVRFRKDL 280
7tmA_CCR6 cd15172
CC chemokine receptor type 6, member of the class A family of seven-transmembrane G ...
36-311 3.37e-72

CC chemokine receptor type 6, member of the class A family of seven-transmembrane G protein-coupled receptors; CCR6 is the only known receptor identified for the chemokine CCL20 (also known as macrophage inflammatory protein-3alpha, MIP-3alpha). CCR6 is expressed by all mature human B cells, effector memory T-cells, and dendritic cells found in the gut mucosal immune system. CCL20 contributes to recruitment of CCR6-expressing cells to Peyer's patches and isolated lymphoid follicles in the intestine, thereby promoting the assembly and maintenance of organized lymphoid structures. Also, CCL20 expression is highly inducible in response to inflammatory signals. Thus, CCL20 is involved in both inflammatory and homeostatic functions in the immune system. Chemokines are principal regulators for leukocyte trafficking, recruitment, and activation. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling. Currently, there are ten known receptors for CC chemokines, seven for CXC chemokines, and single receptors for the XC and CX3C chemokines. The CC chemokine receptors are all activating the G protein Gi.


Pssm-ID: 341330  Cd Length: 281  Bit Score: 225.79  E-value: 3.37e-72
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802    36 LLPPLYSLVFVIGLVGNILVVLVLVQYKRLKNMTSIYLLNLAISDLLFLFTLPFWIDYKLKdDWVFGDAMCKILSGFYYT 115
Cdd:cd15172   2 FVPVIYSLICVVGLIGNSLVVITYAFYKRTKSMTDVYLLNMAIADILFVLTLPFWAVYEAH-QWIFGNFSCKLLRGIYAI 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802   116 GLYSEIFFIILLTIDRYLAIVHAV--FALRARTVTFGVITSIIIWALAILASMPGLYFSKTqWEFT---HHTCSLHFPHE 190
Cdd:cd15172  81 NFYSGMLLLACISVDRYIAIVQATksFRLRSRTLAYSKLICAAVWLLAILISLPTFIFSEV-YDFGleeQYVCEPKYPKN 159
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802   191 S-LREWKLFQALKLNLFGLVLPLLVMIICYTGIIKILLRRPNEKKSKAVRLIFVIMIIFFLFWTPYNLTILISVFQDFLf 269
Cdd:cd15172 160 StAIMWKLLVLSLQVSLGFFIPLLVMIFCYSFIIKTLLQAQNSQRHKAVRVVVAVVLVFLVCQVPYNIVLLIEAINLGE- 238
                       250       260       270       280
                ....*....|....*....|....*....|....*....|..
gi 416802   270 THECEQSRHLDLAVQVTEVIAYTHCCVNPVIYAFVGERFRKY 311
Cdd:cd15172 239 QQSCSSEKAVAYAKTITECLAFFHCCLNPVLYAFIGVKFRNY 280
7tm_1 pfam00001
7 transmembrane receptor (rhodopsin family); This family contains, amongst other ...
51-301 3.96e-71

7 transmembrane receptor (rhodopsin family); This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins.


Pssm-ID: 333754 [Multi-domain]  Cd Length: 255  Bit Score: 222.18  E-value: 3.96e-71
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802      51 GNILVVLVLVQYKRLKNMTSIYLLNLAISDLLF-LFTLPFWIDYKLKDDWVFGDAMCKILSGFYYTGLYSEIFFIILLTI 129
Cdd:pfam00001   1 GNLLVILVILRNKKLRTPTNIFLLNLAVADLLFlLLTLPFWLVYYLHGTWPFGSALCKLVTFLDVVNGYASILLLTAISI 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802     130 DRYLAIVHAVFALRARTVtfGVITSIIIWALAILASMPGLYFSKT--QWEFTHHTCSLHFPHESlreWKLFQALKLNLFG 207
Cdd:pfam00001  81 DRYLAIVHPLRYRRIMRR--AKAIILLIWVLALLLSLPPLLGWNTldIPSNGVTSCLITFPESL---WPVSYLLFSTVLG 155
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802     208 LVLPLLVMIICYTGIIKILL------RRPNEKKSKAVRLIFVIMIIFFLFWTPYNLTILISVFQDFLFTHECEQSRHLDL 281
Cdd:pfam00001 156 FLLPLLVILVCYTRIIRTLRkqqsssIRSVRSERKALKTLLVVVVVFILCWLPYHILLLLDSLCDLGIIISCEVVTPPRT 235
                         250       260
                  ....*....|....*....|
gi 416802     282 AVQVTEVIAYTHCCVNPVIY 301
Cdd:pfam00001 236 LLQLTVWLAYSNSCLNPIIY 255
7tmA_ACKR2_D6 cd15188
atypical chemokine receptor 2, member of the class A family of seven-transmembrane G ...
37-312 6.20e-71

atypical chemokine receptor 2, member of the class A family of seven-transmembrane G protein-coupled receptors; ACKR2 (also known as D6) binds non-selectively to all inflammatory CC-chemokines, but not to homeostatic CC-chemokines involved in controlling the migration of cells. Unlike the classical chemokine receptors that contain a conserved DRYLAIV motif in the second intracellular loop, which is required for G-protein coupling, the ACKRs lack this conserved motif and fail to couple to G-proteins and induce classical GPCR signaling. Five receptors have been identified for the ACKR family, including CC-chemokine receptors like 1 and 2 (CCRL1 and CCRL2), CXCR7, Duffy antigen receptor for chemokine (DARC), and D6. Both ACKR1 (DARC) and ACKR3 (CXCR7) show low sequence homology to the classic chemokine receptors.


Pssm-ID: 320316  Cd Length: 278  Bit Score: 222.35  E-value: 6.20e-71
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802    37 LPPLYSLVFVIGLVGNILVVLVLVQY-KRLKNMTSIYLLNLAISDLLFLFTLPFWIDYkLKDDWVFGDAMCKILSGFYYT 115
Cdd:cd15188   3 LPVFYTLVFLLGLAGNLLLFVVLLLYvPKKKKMTEVYLLNLAVSDLLFLVTLPFWAMY-VAWHWVFGSFLCKFVSTLYTI 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802   116 GLYSEIFFIILLTIDRYLAIVHAVFALRARTVTFGVITSIIIWALAILASMPGLYFSKTqweftHHT------CSLHFPH 189
Cdd:cd15188  82 NFYSGIFFVSCMSLDKYLEIVHAQSPHRLRTRRKSLLVLVAVWVLSIALSVPDMVFVQT-----HHTnngvwvCHADYGG 156
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802   190 ESLReWKLFQALKLNLFGLVLPLLVMIICYTGIIKILLRRPNEKKSKAVRLIFVIMIIFFLFWTPYNLTILISVFQDFLF 269
Cdd:cd15188 157 HHTI-WKLVFQFQQNLLGFLFPLLAMVFFYSRIACVLTRLRPPGQGRALRFVAALVVVFFVLWFPYNLTLFLHSLQDLHV 235
                       250       260       270       280
                ....*....|....*....|....*....|....*....|...
gi 416802   270 THECEQSRHLDLAVQVTEVIAYTHCCVNPVIYAFVGERFRKYL 312
Cdd:cd15188 236 IGNCERSRHLDYALQVTESLAFVHCCLNPLLYAFVSKRFRLYL 278
7tmA_ACKR4_CCR11 cd15176
atypical chemokine receptor 4, member of the class A family of seven-transmembrane G ...
37-312 7.77e-71

atypical chemokine receptor 4, member of the class A family of seven-transmembrane G protein-coupled receptors; ACKR4 was first reported to bind several CC chemokines including CCL19, CCL21, and CCL25 and was originally designated CCR11. AKCR4 is unable to couple to G-protein and, instead, it preferentially mediates beta-arrestin dependent processes, such as receptor internalization, after ligand binding. Thus, ACKR4 may act as a scavenger receptor to suppress the effects of proinflammatory chemokines. Unlike the classical chemokine receptors that contain a conserved DRYLAIV motif in the second intracellular loop, which is required for G-protein coupling, the ACKRs lack this conserved motif and fail to couple to G-proteins and induce classical GPCR signaling. Five receptors have been identified for the ACKR family, including CC-chemokine receptors like 1 and 2 (CCRL1 and CCRL2), CXCR7, Duffy antigen receptor for chemokine (DARC), and D6. Both ACKR1 (DARC) and ACKR3 (CXCR7) show low sequence homology to the classic chemokine receptors.


Pssm-ID: 320304  Cd Length: 276  Bit Score: 221.93  E-value: 7.77e-71
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802    37 LPPLYSLVFVIGLVGNILVVLVLVQYKRLKNMTSIYLLNLAISDLLFLFTLPFWIdYKLKDDWVFGDAMCKILSGFYYTG 116
Cdd:cd15176   3 LPVFYTIALVVGLAGNSLVVAIYAYYKKLKTKTDVYILNLAVADLLLLFTLPFWA-ADAVNGWVLGTAMCKITSALYTMN 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802   117 LYSEIFFIILLTIDRYLAIVHAvfALRARTVTFGVITSIIIWALAILASMPGLYFSKTQWEFTHHTCSLHFPHESLREWK 196
Cdd:cd15176  82 FSCGMQFLACISVDRYVAITKA--TSRQFTGKHCWIVCLCVWLLAILLSIPDLVFSTVRENSDRYRCLPVFPPSLVTSAK 159
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802   197 -LFQALKLnLFGLVLPLLVMIICYTGIIKILLRRPNEKKSKAVRLIFVIMIIFFLFWTPYNLTILISVFQD-FLFTHECE 274
Cdd:cd15176 160 aTIQILEV-LLGFVLPFLVMVFCYSRVARALSRTPNVKKSRALKVLLAVVGVFIVTQLPYNVVKFYRAIDViYLLITDCS 238
                       250       260       270
                ....*....|....*....|....*....|....*...
gi 416802   275 QSRHLDLAVQVTEVIAYTHCCVNPVIYAFVGERFRKYL 312
Cdd:cd15176 239 MSKTLDIAIQVTESIALFHSCLNPVLYVFMGASFKSHI 276
7tmA_CCR7 cd15175
CC chemokine receptor type 7, member of the class A family of seven-transmembrane G ...
37-312 2.85e-70

CC chemokine receptor type 7, member of the class A family of seven-transmembrane G protein-coupled receptors; CCR7 is a major homeostatic receptor responsible for lymph node development and effective adaptive immune responses and plays a critical role in trafficking of dendritic cells and B and T lymphocytes. Its only two ligands, CCL and CCl21, are primarily produced by stromal cells in the T cell zones of lymph nodes and spleen. Chemokines are principal regulators for leukocyte trafficking, recruitment, and activation. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling. Currently, there are ten known receptors for CC chemokines, seven for CXC chemokines, and single receptors for the XC and CX3C chemokines. The CC chemokine receptors are all activating the G protein Gi.


Pssm-ID: 341331  Cd Length: 278  Bit Score: 220.79  E-value: 2.85e-70
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802    37 LPPLYSLVFVIGLVGNILVVLVLVQYKRLKNMTSIYLLNLAISDLLFLFTLPFWIdYKLKDDWVFGDAMCKILSGFYYTG 116
Cdd:cd15175   3 LPAMYSVICFLGLLGNGLVILTYIYFKRLKTMTDIYLLNLALADILFLLTLPFWA-ASAAKKWVFGEEMCKAVYCLYKMS 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802   117 LYSEIFFIILLTIDRYLAIVHAVFA--LRARTVTFGVITSIIIWALAILASMPGLYFSKTQWEFTHHTCSLHfpHESLRE 194
Cdd:cd15175  82 FFSGMLLLMCISIDRYFAIVQAASAhrHRSRAVFISKVSSLGVWVLAFILSIPELLYSGVNNNDGNGTCSIF--TNNKQT 159
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802   195 WKLFQALKLNLFGLVLPLLVMIICYTGIIKILLRRPNEKKSKAVRLIFVIMIIFFLFWTPYNLTILISVFQDF-LFTHEC 273
Cdd:cd15175 160 LSVKIQISQMVLGFLVPLVVMSFCYSVIIKTLLQARNFEKNKAIKVIIAVVVVFVVFQLPYNSVMLVSTLSSFkGNTTDC 239
                       250       260       270
                ....*....|....*....|....*....|....*....
gi 416802   274 EQSRHLDLAVQVTEVIAYTHCCVNPVIYAFVGERFRKYL 312
Cdd:cd15175 240 DYSKNLDFALDVTYSLACFRCCLNPFLYAFIGVKFRNDL 278
PHA03087 PHA03087
G protein-coupled chemokine receptor-like protein; Provisional
40-315 4.33e-68

G protein-coupled chemokine receptor-like protein; Provisional


Pssm-ID: 222976 [Multi-domain]  Cd Length: 335  Bit Score: 216.95  E-value: 4.33e-68
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802     40 LYSLVFVIGLVGNILVVLVLVQYKrLKNMTSIYLLNLAISDLLFLFTLPFWIDYKLKDDWVFGDAMCKILSGFYYTGLYS 119
Cdd:PHA03087  46 VYSTIFFFGLVGNIIVIYVLTKTK-IKTPMDIYLLNLAVSDLLFVMTLPFQIYYYILFQWSFGEFACKIVSGLYYIGFYN 124
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802    120 EIFFIILLTIDRYLAIVHAVFALRARTVTFGVITSIIIWALAILASMPGLYFSKTQWEFTHHTCSLHFPHESLReWKLFQ 199
Cdd:PHA03087 125 SMNFITVMSVDRYIAIVHPVKSNKINTVKYGYIVSLVIWIISIIETTPILFVYTTKKDHETLICCMFYNNKTMN-WKLFI 203
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802    200 ALKLNLFGLVLPLLVMIICYTGIIKILLRRPNEKKS-KAVRLIFVIMIIFFLFWTPYNLTILISVFQDFLFTHECEQSRH 278
Cdd:PHA03087 204 NFEINIIGMLIPLTILLYCYSKILITLKGINKSKKNkKAIKLVLIIVILFVIFWLPFNVSVFVYSLHILHFKSGCKAVKY 283
                        250       260       270
                 ....*....|....*....|....*....|....*..
gi 416802    279 LDLAVQVTEVIAYTHCCVNPVIYAFVGERFRKYLRQL 315
Cdd:PHA03087 284 IQYALHVTEIISLSHCCINPLIYAFVSEFFNKHKKKS 320
7tmA_CCR10 cd15177
CC chemokine receptor type 10, member of the class A family of seven-transmembrane G ...
38-310 5.00e-67

CC chemokine receptor type 10, member of the class A family of seven-transmembrane G protein-coupled receptors; CCR10 is a homeostatic receptor specific for two C-C motif chemokines, CCL27 and CCL28. Activation of CCR10 by its two ligands mediates diverse activities, ranging from leukocyte trafficking to skin cancer. Chemokines are principal regulators for leukocyte trafficking, recruitment, and activation. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling. Currently, there are ten known receptors for CC chemokines, seven for CXC chemokines, and single receptors for the XC and CX3C chemokines. The CC chemokine receptors are all activating the G protein Gi.


Pssm-ID: 341332 [Multi-domain]  Cd Length: 280  Bit Score: 212.33  E-value: 5.00e-67
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802    38 PPLYSLVFVIGLVGNILVVLVLVQYKRLKNMTSIYLLNLAISDLLFLFTLPFWIDYKLKDdWVFGDAMCKILSGFYYTGL 117
Cdd:cd15177   4 PCVYLVVFVLGLVGNGLVLATHTRYRRLRSMTDVYLLNLALADLLLLLTLPFAAAETLQG-WIFGNAMCKLIQGLYAINF 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802   118 YSEIFFIILLTIDRYLAIVHAVFA--LRARTVTFGVITSIIIWALAILASMPGLYFSKTQWEFTHHTCSLHFPHESLREW 195
Cdd:cd15177  83 YSGFLFLTCISVDRYVVIVRATSAhrLRPKTLFYSVLTSLIVWLLSILFALPQLIYSRVENRSELSSCRMIFPEVVSRTV 162
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802   196 KLFQALKLNLFGLVLPLLVMIICYTGIIKILLRRPNEKKSKAVRLIFVIMIIFFLFWTPYNLTILISVfQDFLFTHE--C 273
Cdd:cd15177 163 KGATALTQVVLGFAIPLIVMAVCYAAIGRTLLAARGWERHRALRVIAALVVAFVLFQLPYSVVLLLDT-ADLLATLElsC 241
                       250       260       270
                ....*....|....*....|....*....|....*..
gi 416802   274 EQSRHLDLAVQVTEVIAYTHCCVNPVIYAFVGERFRK 310
Cdd:cd15177 242 SQSKRKDIALLVTSGLAYVRCCLNPLLYAFVGVRFRR 278
7tmA_Angiotensin_R-like cd14985
angiotesin receptor family and its related G protein-coupled receptors, member of the class A ...
36-312 2.61e-65

angiotesin receptor family and its related G protein-coupled receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes the angiotensin receptors, the bradykinin receptors, apelin receptor as well as putative G-protein coupled receptors (GPR15 and GPR25). Angiotensin II (Ang II), the main effector in the renin-angiotensin system, plays a crucial role in the regulation of cardiovascular homeostasis through its type 1 (AT1) and type 2 (AT2) receptors. Ang II contributes to cardiovascular diseases such as hypertension and atherosclerosis via AT1R activation. Ang II increases blood pressure through Gq-mediated activation of phospholipase C, resulting in phosphoinositide (PI) hydrolysis and increased intracellular calcium levels. Through the AT2 receptor, Ang II counteracts the vasoconstrictor action of AT1R and thereby induces vasodilation, sodium excretion, and reduction of blood pressure. Bradykinins (BK) are pro-inflammatory peptides that mediate various vascular and pain responses to tissue injury through its B1 and B2 receptors. Apelin (APJ) receptor binds the endogenous peptide ligands, apelin and Toddler/Elabela. APJ is an adipocyte-derived hormone that is ubiquitously expressed throughout the human body, and Toddler/Elabela is a short secretory peptide that is required for normal cardiac development in zebrafish. Activation of APJ receptor plays key roles in diverse physiological processes including vasoconstriction and vasodilation, cardiac muscle contractility, angiogenesis, and regulation of water balance and food intake. Orphan receptors, GPR15 and GPR25, share strong sequence homology to the angiotensin II type AT1 and AT2 receptors.


Pssm-ID: 341320  Cd Length: 284  Bit Score: 208.00  E-value: 2.61e-65
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802    36 LLPPLYSLVFVIGLVGNILVVLVLVQYKRLKNMTSIYLLNLAISDLLFLFTLPFWIDYKLKD-DWVFGDAMCKILSGFYY 114
Cdd:cd14985   2 VIPALYIAIFLVGLLGNLFVVWVFLFPRGPKRVADIFIANLAAADLVFVLTLPLWATYTANQyDWPFGAFLCKVSSYVIS 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802   115 TGLYSEIFFIILLTIDRYLAIVHAVFALRARTVTFGVITSIIIWALAILASMPGLYFSKTQW-EFTHHT-CSLHFPHESl 192
Cdd:cd14985  82 VNMFASIFLLTCMSVDRYLAIVHPVASRRLRRRRQARVTCALIWVVACLLSLPTFLLRSLQAiENLNKTaCIMLYPHEA- 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802   193 reWKLFQALKLNLFGLVLPLLVMIICYTGIIKILLRRP------NEKKSKAVRLIFVIMIIFFLFWTPYNLTILISVFQD 266
Cdd:cd14985 161 --WHFGLSLELNILGFVLPLLIILTCYFHIARSLRKRYertgknGRKRRKSLKIIFALVVAFLVCWLPFHFFKFLDFLAQ 238
                       250       260       270       280
                ....*....|....*....|....*....|....*....|....*.
gi 416802   267 FLFTHECEQSRHLDLAVQVTEVIAYTHCCVNPVIYAFVGERFRKYL 312
Cdd:cd14985 239 LGAIRPCFWELFLDLGLPIATCLAFTNSCLNPFIYVFVDRRFRQKV 284
7tmA_purinoceptor-like cd14982
purinoceptor and its related proteins, member of the class A family of seven-transmembrane G ...
35-312 9.78e-65

purinoceptor and its related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; Members of this subfamily include lysophosphatidic acid receptor, P2 purinoceptor, protease-activated receptor, platelet-activating factor receptor, Epstein-Barr virus induced gene 2, proton-sensing G protein-coupled receptors, GPR35, and GPR55, among others. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 341318 [Multi-domain]  Cd Length: 283  Bit Score: 206.73  E-value: 9.78e-65
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802    35 QLLPPLYSLVFVIGLVGNILVVLVLVQYKRLKNMTSIYLLNLAISDLLFLFTLPFWIDYKLK-DDWVFGDAMCKILSGFY 113
Cdd:cd14982   1 TLFPIVYSLIFILGLLGNILALWVFLRKMKKRSPTTIYMINLALADLLFVLTLPFRIYYYLNgGWWPFGDFLCRLTGLLF 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802   114 YTGLYSEIFFIILLTIDRYLAIVHAVFALRARTVTFGVITSIIIWALAILASMPGLYFSKTQWEFTHHTCSLHFPHESLR 193
Cdd:cd14982  81 YINMYGSILFLTCISVDRYLAVVHPLKSRRLRRKRYAVGVCAGVWILVLVASVPLLLLRSTIAKENNSTTCFEFLSEWLA 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802   194 EWKLFQALKLnLFGLVLPLLVMIICYTGIIKILLRRPNE-----KKSKAVRLIFVIMIIFFLFWTPYNLTILISVFQDFL 268
Cdd:cd14982 161 SAAPIVLIAL-VVGFLIPLLIILVCYSLIIRALRRRSKQsqksvRKRKALRMILIVLAVFLVCFLPYHVTRILYLLVRLS 239
                       250       260       270       280
                ....*....|....*....|....*....|....*....|....
gi 416802   269 FTHECEQSRHLDLAVQVTEVIAYTHCCVNPVIYAFVGERFRKYL 312
Cdd:cd14982 240 FIADCSARNSLYKAYRITLCLASLNSCLDPLIYYFLSKTFRKRL 283
7tmA_CXCR3 cd15180
CXC chemokine receptor type 3, member of the class A family of seven-transmembrane G ...
36-312 1.09e-64

CXC chemokine receptor type 3, member of the class A family of seven-transmembrane G protein-coupled receptors; CXCR3 is an inflammatory chemotactic receptor for a group of CXC chemokines distinguished by the presence of the amino acid motif ELR immediately adjacent to their CXC motif. CXCR3 specifically binds three chemokines CXCL9 (monokine induced by gamma-interferon), CXCL10 (interferon induced protein of 10 kDa), and CXCL11 (interferon inducible T-cell alpha-chemoattractant, I-TAC). CXC3R is expressed on CD4+ Th1 and CD8+ cytotoxic T lymphocytes as well as highly on innate lymphocytes, such as NK cells and NK T cells, where it may mediate the recruitment of these cells to the sites of infection and inflammation. Chemokines are principal regulators for leukocyte trafficking, recruitment, and activation. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling. Currently, there are ten known receptors for CC chemokines, seven for CXC chemokines, and single receptors for the XC and CX3C chemokines.


Pssm-ID: 341335 [Multi-domain]  Cd Length: 280  Bit Score: 206.47  E-value: 1.09e-64
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802    36 LLPPLYSLVFVIGLVGNILVVLVLVQYKRLKNMTSIYLLNLAISDLLFLFTLPFWIDYKLKdDWVFGDAMCKILSGFYYT 115
Cdd:cd15180   2 FLPVLYSLVFLLGLLGNGLVLAVLLQKRRNLSVTDTFILHLALADILLLVTLPFWAVQAVH-GWIFGTGLCKLAGAVFKI 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802   116 GLYSEIFFIILLTIDRYLAIVHAVFALRARTVTFGVITSIIIWALAILASMPGLYFSKTQWEFTHHT--CSLHFPHeSLR 193
Cdd:cd15180  81 NFYCGIFLLACISFDRYLSIVHAVQMYSRKKPMLVHLSCLIVWLFCLLLSIPDFIFLEATKDPRQNKteCVHNFPQ-SDT 159
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802   194 EWKLFQALKLNLFGLVLPLLVMIICYTGIIKILLRRPNE-KKSKAVRLIFVIMIIFFLFWTPYNLTILISVFQDF-LFTH 271
Cdd:cd15180 160 YWWLALRLLYHIVGFLLPLAVMVYCYTSILLRLLRSSQGfQKQRAIRVIVAVVVVFFLCWTPYNIALLVDTLIDLsVLDR 239
                       250       260       270       280
                ....*....|....*....|....*....|....*....|.
gi 416802   272 ECEQSRHLDLAVQVTEVIAYTHCCVNPVIYAFVGERFRKYL 312
Cdd:cd15180 240 NCGTESRLDIALSVTSSLGYFHCCLNPLLYAFVGVKFRRKL 280
7tmA_CXCR6 cd15173
CXC chemokine receptor type 6, member of the class A family of seven-transmembrane G ...
37-311 4.01e-64

CXC chemokine receptor type 6, member of the class A family of seven-transmembrane G protein-coupled receptors; CXCR6 binds specifically to the chemokine CXCL16, which is expressed on dendritic cells, monocyte/macrophages, activated T cells, fibroblastic reticular cells, and cancer cells. CXCR6 is phylogenetically more closely related to CC-type chemokine receptors (CCR6 and CCR9) than other CXC receptors. Chemokines are principal regulators for leukocyte trafficking, recruitment, and activation. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling. Currently, there are ten known receptors for CC chemokines, seven for CXC chemokines, and single receptors for the XC and CX3C chemokines.


Pssm-ID: 320301 [Multi-domain]  Cd Length: 270  Bit Score: 204.62  E-value: 4.01e-64
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802    37 LPPLYSLVFVIGLVGNILVVLVLVQYKRLKNMTSIYLLNLAISDLLFLFTLPFWIdYKLKDDWVFGDAMCKILSGFYYTG 116
Cdd:cd15173   3 LPCMYSVMFVTGLVGNSLVIVIYIFYEKLRTLTDIFLVNLAVADLLFLCTLPFWA-YSAAHEWIFGTVMCKITNGLYTIN 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802   117 LYSEIFFIILLTIDRYLAIVHAVFAL--RARTVTFGVITSIIIWALAILASMPGLYFSKTQwEFTHHTCSLHFPHESLRe 194
Cdd:cd15173  82 LYSSMLILTCITVDRFIVIVQATKAHncHAKKMRWGKVVCTLVWVISLLLSLPQFIYSEVR-NLSSKICSMVYPPDAIE- 159
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802   195 wKLFQALKLNLfGLVLPLLVMIICYTGIIKILLRRPNEKKSKAVRLIFVIMIIFFLFWTPYNLTILISVFQdflftHECE 274
Cdd:cd15173 160 -VVVNIIQMTV-GFFLPLLAMIICYSVIIKTLLHAKGFQKHKSLKIIFVVVAVFILTQLPYNIMKLIRTLH-----IENT 232
                       250       260       270
                ....*....|....*....|....*....|....*..
gi 416802   275 QSRHLDLAVQVTEVIAYTHCCVNPVIYAFVGERFRKY 311
Cdd:cd15173 233 DSTNFKYAILITEAIAYLHACLNPILYAFVGVKFRKN 269
7tmA_CXCR4 cd15179
CXC chemokine receptor type 4, member of the class A family of seven-transmembrane G ...
36-312 5.45e-64

CXC chemokine receptor type 4, member of the class A family of seven-transmembrane G protein-coupled receptors; CXCR4 is the only known G protein-coupled chemokine receptor for the key homeostatic ligand CXCL12, which is constitutively secreted by bone marrow stromal cells. Atypical chemokine receptor CXCR7 (ACKR3) also binds CXCL12, but activates signaling in a G protein-independent manner. CXCR4 is also a co-receptor for HIV infection and plays critical roles in the development of immune system during both lymphopoiesis and myelopoiesis. Chemokines are principal regulators for leukocyte trafficking, recruitment, and activation. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling. Currently, there are ten known receptors for CC chemokines, seven for CXC chemokines, and single receptors for the XC and CX3C chemokines.


Pssm-ID: 341334 [Multi-domain]  Cd Length: 278  Bit Score: 204.62  E-value: 5.45e-64
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802    36 LLPPLYSLVFVIGLVGNILVVLVLVQYKRLKNMTSIYLLNLAISDLLFLFTLPFWiDYKLKDDWVFGDAMCKILSGFYYT 115
Cdd:cd15179   2 FLPTVYSIIFLLGIVGNGLVILVMGYQKKSRTMTDKYRLHLSVADLLFVLTLPFW-AVDAAANWYFGNFLCKAVHVIYTV 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802   116 GLYSEIFFIILLTIDRYLAIVHAVFALRARTVTFGVITSIIIWALAILASMPGLYFSKTQWEFTHHTCSLHFPHESLREW 195
Cdd:cd15179  81 NLYSSVLILAFISLDRYLAIVHATNSQRPRKLLAEKVVYVGVWLPALLLTVPDLVFAKVSELDDRYICDRIYPEDTFELW 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802   196 KLFQALKLNLFGLVLPLLVMIICYTGIIKILLRRPNEKKSKAVRLIFVIMIIFFLFWTPYNLTILISVFQDF-LFTHECE 274
Cdd:cd15179 161 VVAFRFQHILVGLVLPGLVILTCYCIIISKLSHSKGHQKRKALKTTVILILAFFACWLPYYIGISIDTFMLLeIIKQSCE 240
                       250       260       270
                ....*....|....*....|....*....|....*...
gi 416802   275 QSRHLDLAVQVTEVIAYTHCCVNPVIYAFVGERFRKYL 312
Cdd:cd15179 241 MEQTVHKWISITEALAFFHCCLNPILYAFLGAKFKTSA 278
7tmA_CXCR5 cd15181
CXC chemokine receptor type 5, member of the class A family of seven-transmembrane G ...
38-312 1.80e-61

CXC chemokine receptor type 5, member of the class A family of seven-transmembrane G protein-coupled receptors; CXCR5 is a B-cell selective receptor that binds specifically to the homeostatic chemokine CXCL13 and regulates adaptive immunity. The receptor is found on all peripheral blood and tonsillar B cells and is involved in lymphocyte migration (homing) to specific tissues and development of normal lymphoid tissue. Chemokines are principal regulators for leukocyte trafficking, recruitment, and activation. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling. Currently, there are ten known receptors for CC chemokines, seven for CXC chemokines, and single receptors for the XC and CX3C chemokines.


Pssm-ID: 341336 [Multi-domain]  Cd Length: 281  Bit Score: 198.05  E-value: 1.80e-61
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802    38 PPLYSLVFVIGLVGNILVVLVLVQYKRLKNMTSIYLLNLAISDLLFLFTLPFWIDYKLKdDWVFGDAMCKILSGFYYTGL 117
Cdd:cd15181   4 PLAYSLVFLLGVVGNGLVLTILLRRRRSRRTTENYLLHLALADLLLLLTFPFSVVESIA-GWVFGTFLCKLVGAIHKLNF 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802   118 YSEIFFIILLTIDRYLAIVHAVFALRARTVTFGVITSIIIWALAILASMPGLYFSK--TQWEFTHHTCSLHFPHESLREW 195
Cdd:cd15181  83 YCSSLLLACISVDRYLAIVHAIHSYRHRRLRSVHLTCGSIWLVCFLLSLPNLVFLEveTSTNANRTSCSFHQYGIHESNW 162
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802   196 KLFQALKLNLFGLVLPLLVMIICYTGIIKILLRRPNE-KKSKAVRLIFVIMIIFFLFWTPYNLTILISVFQDF-LFTHEC 273
Cdd:cd15181 163 WLTSRFLYHVVGFFLPLLIMGYCYATIVVTLCQSSRRlQKQKAIRVAILVTLVFCLCWLPYNIVIFLDTLDDLkAVVKNC 242
                       250       260       270
                ....*....|....*....|....*....|....*....
gi 416802   274 EQSRHLDLAVQVTEVIAYTHCCVNPVIYAFVGERFRKYL 312
Cdd:cd15181 243 KLNDLLDAAITVTESLGFSHCCLNPILYAFIGVKFRNDL 281
7tmA_AT1R cd15192
type 1 angiotensin II receptor, member of the class A family of seven-transmembrane G ...
36-312 3.02e-58

type 1 angiotensin II receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; Angiotensin II (Ang II), the main effector in the renin-angiotensin system, plays a crucial role in the regulation of cardiovascular homeostasis through its type 1 (AT1) and type 2 (AT2) receptors. Ang II contributes to cardiovascular diseases such as hypertension and atherosclerosis via AT1R activation. Ang II increases blood pressure through Gq-mediated activation of phospholipase C, resulting in phosphoinositide (PI) hydrolysis and increased intracellular calcium levels. Through the AT2R, Ang II counteracts the vasoconstrictor action of AT1R and thereby induces vasodilation, sodium excretion, and reduction of blood pressure. Moreover, AT1R promotes cell proliferation, whereas AT2R inhibits proliferation and stimulates cell differentiation. The AT2R is highly expressed during fetal development, however it is scarcely present in adult tissues and is induced in pathological conditions. Generally, the AT1R mediates many actions of Ang II, while the AT2R is involved in the regulation of blood pressure and renal function.


Pssm-ID: 320320 [Multi-domain]  Cd Length: 285  Bit Score: 189.95  E-value: 3.02e-58
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802    36 LLPPLYSLVFVIGLVGNILVVLVLVQYKRLKNMTSIYLLNLAISDLLFLFTLPFWIDYKLKD-DWVFGDAMCKILSGFYY 114
Cdd:cd15192   2 MIPTVYSIIFVIGIFGNSLVVIVIYCYMKLKTVANIFLLNLALADLCFLITLPLWAAYTAMGyHWPFGNFLCKISSTLVS 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802   115 TGLYSEIFFIILLTIDRYLAIVHAVFALRARTVTFGVITSIIIWALAILASMPGLYFSKT----QWEFThhTCSLHFPhE 190
Cdd:cd15192  82 FNLYASVFLLTCLSIDRYLAIVHPMKSRIRRTLVVARVTCIVIWLLAGVASLPAIIFRDVffyeNWNKT--VCAFHYP-N 158
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802   191 SLREWKLFQALKLNLFGLVLPLLVMIICYTGIIKILLRRPNEKKSKAV-----RLIFVIMIIFFLFWTPYNLTILISVFQ 265
Cdd:cd15192 159 QNKQLLVGMGLMKNLLGFLIPFLIILTCYTLIGKTLKQAYQIQRSKSRndeifKMIMAVVLFFFFCWIPHQVFTFLDVLI 238
                       250       260       270       280
                ....*....|....*....|....*....|....*....|....*..
gi 416802   266 DFLFTHECEQSRHLDLAVQVTEVIAYTHCCVNPVIYAFVGERFRKYL 312
Cdd:cd15192 239 QLKVIQNCHILEIVDTAMPFTICIAYFNSCLNPILYGFVGKNFRKKF 285
7tmA_Opioid_R-like cd14970
opioid receptors and related proteins, member of the class A family of seven-transmembrane G ...
36-310 1.08e-57

opioid receptors and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes opioid receptors, somatostatin receptors, melanin-concentrating hormone receptors (MCHRs), and neuropeptides B/W receptors. Together they constitute the opioid receptor-like family, members of the class A G-protein coupled receptors. Opioid receptors are coupled to inhibitory G proteins of the G(i/o) family and are involved in regulating a variety of physiological functions such as pain, addiction, mood, stress, epileptic seizure, and obesity, among many others. G protein-coupled somatostatin receptors (SSTRs), which display strong sequence similarity with opioid receptors, binds somatostatin (somatotropin release inhibiting factor), a polypeptide hormone that regulates a wide variety of physiological functions such as neurotransmission, cell proliferation, contractility of smooth muscle cells, and endocrine signaling as well as inhibition of the release of many secondary hormones. MCHR binds melanin concentrating hormone and is presumably involved in the neuronal regulation of food intake. Despite strong homology with somatostatin receptors, MCHR does not appear to bind somatostatin. Neuropeptides B/W receptors are primarily expressed in the CNS and stimulate the cortisol secretion by activating the adenylate cyclase- and the phospholipase C-dependent signaling pathways.


Pssm-ID: 320101 [Multi-domain]  Cd Length: 282  Bit Score: 188.27  E-value: 1.08e-57
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802    36 LLPPLYSLVFVIGLVGNILVVLVLVQYKRLKNMTSIYLLNLAISDLLFLFTLPFWIDYKLKDDWVFGDAMCKILSGFYYT 115
Cdd:cd14970   2 VIPAVYSVVCVVGLTGNSLVIYVILRYSKMKTVTNIYILNLAVADELFLLGLPFLATSYLLGYWPFGEVMCKIVLSVDAY 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802   116 GLYSEIFFIILLTIDRYLAIVHAVFALRARTVTFGVITSIIIWALAILASMPGLYFSKTQWEFTH-HTCSLHFPHES--- 191
Cdd:cd14970  82 NMFTSIFCLTVMSVDRYLAVVHPVKSLRFRTPRKAKLVSLCVWALSLVLGLPVIIFARTLQEEGGtISCNLQWPDPPdyw 161
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802   192 LREWKLFQAlklnLFGLVLPLLVMIICYTGIIKILLRRPNEKKSKA----------VRLIFVIMIIFFLFWTPYNLTILI 261
Cdd:cd14970 162 GRVFTIYTF----VLGFAVPLLVITVCYSLIIRRLRSSRNLSTSGArekrrarrkvTRLVLVVVAVFVVCWLPFHVFQIV 237
                       250       260       270       280       290
                ....*....|....*....|....*....|....*....|....*....|..
gi 416802   262 SVFQDFlftheceqsRHLDLAVQV---TEVIAYTHCCVNPVIYAFVGERFRK 310
Cdd:cd14970 238 RLLIDP---------PETLTVVGVflfCIALSYANSCLNPILYAFLDENFRK 280
PHA02638 PHA02638
CC chemokine receptor-like protein; Provisional
40-318 5.74e-55

CC chemokine receptor-like protein; Provisional


Pssm-ID: 165021 [Multi-domain]  Cd Length: 417  Bit Score: 185.22  E-value: 5.74e-55
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802     40 LYSLVFVIGLVGNILVVLVLVqYKRLKNMTSIYLLNLAISDLLFLFTLPFWIdYKLKDDWVFGDAMCKILSGFYYTGLYS 119
Cdd:PHA02638 104 FYIIIFILGLFGNAAIIMILF-CKKIKTITDIYIFNLAISDLIFVIDFPFII-YNEFDQWIFGDFMCKVISASYYIGFFS 181
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802    120 EIFFIILLTIDRYLAIVHAVFALRARTVTFGVITSIIIWALAILASMPGLY-FSKTQWEFT---------HHTCSLHFPH 189
Cdd:PHA02638 182 NMFLITLMSIDRYFAILYPISFQKYRTFNIGIILCIISWILSLIITSPAYFiFEASNIIFSaqdsnetisNYQCTLIEDN 261
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802    190 ESLREWKLFQALK--LNLFGLVLPLLVMIICYTGIIKILLRRPNEKKSKAVRLIFVIMIIFFLFWTPYNLTILISV---- 263
Cdd:PHA02638 262 EKNNISFLGRILQfeINILGMFIPIIIFAFCYIKIILKLKQLKKSKKTKSIIIVSIIIICSLICWIPLNIVILFATmysf 341
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|....*..
gi 416802    264 --FQDFLFTHECEQSRhLDLAVQVTEVIAYTHCCVNPVIYAFVGERFRKYLRQLFHR 318
Cdd:PHA02638 342 kgFNSIISEHICGFIK-LGYAMMLAEAISLTHCCINPLIYTLIGENFRMHLLMIFRN 397
7tmA_Bradykinin_R cd15189
bradykinin receptors, member of the class A family of seven-transmembrane G protein-coupled ...
36-310 6.39e-53

bradykinin receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; The bradykinin receptor family is a group of the seven transmembrane G-protein coupled receptors, whose endogenous ligand is the pro-inflammatory nonapeptide bradykinin that mediates various vascular and pain responses. Two major bradykinin receptor subtypes, B1 and B2, have been identified based on their pharmacological properties. The B1 receptor is rapidly induced by tissue injury and inflammation, whereas the B2 receptor is ubiquitously expressed on many tissue types. Both receptors contain three consensus sites for N-linked glycosylation in extracellular domains and couple to G(q) protein to activate phospholipase C, leading to phosphoinositide hydrolysis and intracellular calcium mobilization. They can also interact with G(i) protein to inhibit adenylate cyclase and activate the MAPK (mitogen-activated protein kinase) pathways.


Pssm-ID: 320317  Cd Length: 284  Bit Score: 176.12  E-value: 6.39e-53
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802    36 LLPPLYSLVFVIGLVGNILVVLVLVQYKRLKNMTSIYLLNLAISDLLFLFTLPFWIDYKLKD-DWVFGDAMCKILSGFYY 114
Cdd:cd15189   2 IIPPFIFSLCLFGLLGNLFVLLVFLLHRRRLTVAEIYLGNLAAADLVFVSGLPFWAMNILNQfNWPFGELLCRVVNGVIK 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802   115 TGLYSEIFFIILLTIDRYLAIVHAVFALRARTVTFGVITSIIIWALAILASMPGLYFSKTQWEFTHHT--CSLHFPHESl 192
Cdd:cd15189  82 VNLYTSIYLLVMISQDRYLALVKTMAARRLRRRRYAKLICVLIWVVGLLLSIPTFLLRKIKAIPDLNItaCVLLYPHEA- 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802   193 reWKLFQALKLNLFGLVLPLLVMIICYTGIIKILLRRPNE------KKSKAVRLIFVIMIIFFLFWTPYNLTILISVFQD 266
Cdd:cd15189 161 --WHFAHIVLLNIVGFLLPLLVITFCNYNILQALRTREEStrcedrNDSKATALVLAVTLLFLVCWGPYHFFTFLDFLFD 238
                       250       260       270       280
                ....*....|....*....|....*....|....*....|....
gi 416802   267 FLFTHECEQSRHLDLAVQVTEVIAYTHCCVNPVIYAFVGERFRK 310
Cdd:cd15189 239 VGVLDECFWEHFIDIGLQLAVFLAFSNSCLNPVLYVFVGRYFRR 282
7tmA_AT2R cd15191
type 2 angiotensin II receptor, member of the class A family of seven-transmembrane G ...
36-312 9.51e-53

type 2 angiotensin II receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; Angiotensin II (Ang II), the main effector in the renin-angiotensin system, plays a crucial role in the regulation of cardiovascular homeostasis through its type 1 (AT1) and type 2 (AT2) receptors. Ang II contributes to cardiovascular diseases such as hypertension and atherosclerosis via AT1R activation. Ang II increases blood pressure through Gq-mediated activation of phospholipase C, resulting in phosphoinositide (PI) hydrolysis and increased intracellular calcium levels. Through the AT2R, Ang II counteracts the vasoconstrictor action of AT1R and thereby induces vasodilation, sodium excretion, and reduction of blood pressure. Moreover, AT1R promotes cell proliferation, whereas AT2R inhibits proliferation and stimulates cell differentiation. The AT2R is highly expressed during fetal development, however it is scarcely present in adult tissues and is induced in pathological conditions. Generally, the AT1R mediates many actions of Ang II, while the AT2R is involved in the regulation of blood pressure and renal function.


Pssm-ID: 341341 [Multi-domain]  Cd Length: 285  Bit Score: 175.71  E-value: 9.51e-53
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802    36 LLPPLYSLVFVIGLVGNILVVLVLVQYKRLKNMTSIYLLNLAISDLLFLFTLPFW-IDYKLKDDWVFGDAMCKILSGFYY 114
Cdd:cd15191   2 AIPVLYSIIFILGFLGNSLVVCVFCHQSGPKTVASIYIFNLAVADLLFLATLPLWaTYYSYGYNWLFGSVMCKICGSLLT 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802   115 TGLYSEIFFIILLTIDRYLAIVHAVFALRARTVTFGVItSIIIWALAILASMPGLYFSKTQW--EFTHHTCSLHFPHESL 192
Cdd:cd15191  82 LNLFASIFFITCMSVDRYLAVVYPLRSQRRRSWQARLV-CLLVWVLACLSSLPTFYFRDTYYieELGVNACIMAFPNEKY 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802   193 REWKLFQALKLNLFGLVLPLLVMIICYTGIIKILLRRPN-----EKKSKAVRLIFVIMIIFFLFWTPYNLTILISVFQDF 267
Cdd:cd15191 161 AQWSAGLALMKNTLGFLIPLIVIATCYFGIGRHLLKTKGfgknkQRRDKVLKMVAAVVLAFLICWFPFHVLTFLDALARM 240
                       250       260       270       280
                ....*....|....*....|....*....|....*....|....*
gi 416802   268 LFTHECEQSRHLDLAVQVTEVIAYTHCCVNPVIYAFVGERFRKYL 312
Cdd:cd15191 241 GVINNCWVITVIDKALPFAICLGFSNSCINPFLYCFVGNHFREKL 285
PHA02834 PHA02834
chemokine receptor-like protein; Provisional
40-318 1.93e-52

chemokine receptor-like protein; Provisional


Pssm-ID: 165177  Cd Length: 323  Bit Score: 176.25  E-value: 1.93e-52
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802     40 LYSLVFVIGLVGNILVVLVLVqYKRLKNMTSIYLLNLAISDLLFLFTLPFWIDYKLkDDWVFGDAMCKILSGFYYTGLYS 119
Cdd:PHA02834  34 FYILLFIFGLIGNVLVIAVLI-VKRFMFVVDVYLFNIAMSDLMLVFSFPFIIHNDL-NEWIFGEFMCKLVLGVYFVGFFS 111
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802    120 EIFFIILLTIDRYLAIVHAVfALRARTVTFGVITSIIIWALAILASMPGLYFSKTQWEFTHHTCSLHFPHESLrEWKLFQ 199
Cdd:PHA02834 112 NMFFVTLISIDRYILVVNAT-KIKNKSISLSVLLSVAAWVCSVILSMPAMVLYYVDNTDNLKQCIFNDYHENF-SWSAFF 189
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802    200 ALKLNLFGLVLPLLVMIICYTGIIKILLRRPNEKKSKAVRLIFVIMIIFFLFWTPYNLTILISVFQDF-LFTHECEQSRH 278
Cdd:PHA02834 190 NFEINIFGIVIPLIILIYCYSKILYTLKNCKNKNKTRSIKIILTVVTFTVVFWVPFNIVLFINSLQSVgLIDIGCYHFKK 269
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|
gi 416802    279 LDLAVQVTEVIAYTHCCVNPVIYAFVGERFRKYLRQLFHR 318
Cdd:PHA02834 270 IVYSIDIAELISFVHCCVNPIIYAFVGKNFKKVFKNMFCR 309
7tm_classA_rhodopsin-like cd00637
rhodopsin receptor-like class A family of the seven-transmembrane G protein-coupled receptor ...
40-303 3.00e-52

rhodopsin receptor-like class A family of the seven-transmembrane G protein-coupled receptor superfamily; Class A rhodopsin-like receptors constitute about 90% of all GPCRs. The class A GPCRs include the light-sensitive rhodopsin as well as receptors for biogenic amines, lipids, nucleotides, odorants, peptide hormones, and a variety of other ligands. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes. Based on sequence similarity, GPCRs can be divided into six major classes: class A (rhodopsin-like family), class B (Methuselah-like, adhesion and secretin-like receptor family), class C (metabotropic glutamate receptor family), class D (fungal mating pheromone receptors), class E (cAMP receptor family), and class F (frizzled/smoothened receptor family). Nearly 800 human GPCR genes have been identified and are involved essentially in all major physiological processes. Approximately 40% of clinically marketed drugs mediate their effects through modulation of GPCR function for the treatment of a variety of human diseases including bacterial infections.


Pssm-ID: 341313 [Multi-domain]  Cd Length: 275  Bit Score: 174.00  E-value: 3.00e-52
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802    40 LYSLVFVIGLVGNILVVLVLVQYKRLKNMTSIYLLNLAISDLLF-LFTLPFWIDYKLKDDWVFGDAMCKILSGFYYTGLY 118
Cdd:cd00637   4 LYILIFVVGVVGNLLVILVILRNRRLRTVTNYFILNLAVADLLVgLLVIPFSLVSLLLGGWWFGDALCKLLGFLQTVSLT 83
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802   119 SEIFFIILLTIDRYLAIVHAVFALRARTVTFGVITSIIIWALAILASMPGLYFSKTQWEFTHHTCSLHFPHESLRewKLF 198
Cdd:cd00637  84 ASILTLTAISVDRYLAIVHPLRYRRRFTRRRAKLVIALIWLLSLLLALPPLLGWKVYDYGGYCCCCLCWPDSTLR--KAY 161
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802   199 QALkLNLFGLVLPLLVMIICYTGIIKILLR---------------RPNEKKSKAVRLIFVIMIIFFLFWTPYNLTILISV 263
Cdd:cd00637 162 TIF-LFVLLFLLPLLVIIVCYVRIFRKLRRhrrrirrsssnssrrRRRRRERKVTKMLLIVVVVFLLCWLPYFILLLLDV 240
                       250       260       270       280
                ....*....|....*....|....*....|....*....|
gi 416802   264 FQDFLFtheceqsRHLDLAVQVTEVIAYTHCCVNPVIYAF 303
Cdd:cd00637 241 FGPDPS-------PLPRILYFLALLLAYLNSAINPIIYAF 273
7tmA_BK-2 cd15381
bradykinin receptor B2, member of the class A family of seven-transmembrane G protein-coupled ...
38-310 3.09e-52

bradykinin receptor B2, member of the class A family of seven-transmembrane G protein-coupled receptors; The bradykinin receptor family is a group of the seven transmembrane G-protein coupled receptors, whose endogenous ligand is the pro-inflammatory nonapeptide bradykinin that mediates various vascular and pain responses. Two major bradykinin receptor subtypes, B1 and B2, have been identified based on their pharmacological properties. The B1 receptor is rapidly induced by tissue injury and inflammation, whereas the B2 receptor is ubiquitously expressed on many tissue types. Both receptors contain three consensus sites for N-linked glycosylation in extracellular domains and couple to G(q) protein to activate phospholipase C, leading to phosphoinositide hydrolysis and intracellular calcium mobilization. They can also interact with G(i) protein to inhibit adenylate cyclase and activate the MAPK (mitogen-activated protein kinase) pathways.


Pssm-ID: 320503  Cd Length: 284  Bit Score: 174.19  E-value: 3.09e-52
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802    38 PPLYSLVFVIGLVGNILVVLVLVQYKRLKNMTSIYLLNLAISDLLFLFTLPFW-IDYKLKDDWVFGDAMCKILSGFYYTG 116
Cdd:cd15381   4 PIYLWIIFVLGTIENAFVLIVFCLHKSSCTVAEIYLGNLAAADLLLVCCLPFWaINISNGFNWPFGEFLCKSVNAVIYMN 83
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802   117 LYSEIFFIILLTIDRYLAIVHAVFALRARTVTFGVITSIIIWALAILASMPGLYFSKTQW--EFTHHTCSLHFPHESlre 194
Cdd:cd15381  84 LYSSIYFLMMVSIDRYLALVKTMSSGRMRRPACAKLNCLIIWMFGLLMSTPMIVFRTVMYfpEYNITACVLDYPSEG--- 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802   195 WKLFQALKLNLFGLVLPLLVMIICYTGIIKILlrRPNE--------KKSKAVRLIFVIMIIFFLFWTPYNLTILISVFQD 266
Cdd:cd15381 161 WHVALNILLNVVGFLIPLSIITFCSTQIIQVL--RNNKmqkfkeiqTERKATVLVLAVLLMFFICWLPFHIFTFLDTLHK 238
                       250       260       270       280
                ....*....|....*....|....*....|....*....|....
gi 416802   267 FLFTHECEQSRHLDLAVQVTEVIAYTHCCVNPVIYAFVGERFRK 310
Cdd:cd15381 239 LGLISGCRWEDILDIGTQIATFLAYSNSCLNPLLYVIVGKHFRK 282
7tmA_CysLTR1 cd15158
cysteinyl leukotriene receptor 1, member of the class A family of seven-transmembrane G ...
40-312 2.76e-49

cysteinyl leukotriene receptor 1, member of the class A family of seven-transmembrane G protein-coupled receptors; Cysteinyl leukotrienes (LTC4, LTD4, and LTE4) are the most potent inflammatory lipid mediators that play an important role in human asthma. They are synthesized in the leucocytes (cells of immune system) from arachidonic acid by the actions of 5-lipoxygenase and induce bronchial constriction through G protein-coupled receptors, CysLTR1 and CysLTR2. Activation of CysLTR1 by LTD4 induces airway smooth muscle contraction and proliferation, eosinophil migration, and damage to the lung tissue. They belong to the class A GPCR superfamily, which all have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320286  Cd Length: 285  Bit Score: 166.84  E-value: 2.76e-49
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802    40 LYSLVFVIGLVGNILVVLVLVQYKRLKNMTSIYLLNLAISDLLFLFTLPFWIDYKL-KDDWVFGDAMCKILSGFYYTGLY 118
Cdd:cd15158   6 LYSVITVFGLVGNGFALYVLIKTYRQKSAFHIYMLNLAVSDLLCVCTLPLRVVYYVhKGQWLFGDFLCRISSYALYVNLY 85
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802   119 SEIFFIILLTIDRYLAIVHAVFALRARTVTFGVITSIIIWALAILASMPGLyFSKTQWEFTHHTCSLHFPHESLREWKLf 198
Cdd:cd15158  86 CSIYFMTAMSFTRFLAIVFPVQNLNLVTVKKARIVCVGIWIFVTLTSSPFL-MSGSHDTETNKTKCFEPPQSNQQLTKL- 163
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802   199 qaLKLNLFGLV----LPLLVMIICYTGIIKILLRRPN------EKKSKAVRLIFVIMIIFFLFWTPYNLTILISVFQDFL 268
Cdd:cd15158 164 --LVLNYISLVvgfiIPFLVILICYAMIIRTLLKNTMkarkqqSSRKKAIRMIIIVLLAFLVSFMPYHIQRTIHLHFLSR 241
                       250       260       270       280
                ....*....|....*....|....*....|....*....|....
gi 416802   269 FTHECEQSRHLDLAVQVTEVIAYTHCCVNPVIYAFVGERFRKYL 312
Cdd:cd15158 242 KDSTCEEVLYMQKSVVITLCLAAANCCFDPLLYFFSGENFRRRL 285
7tmA_CCKR-like cd14993
cholecystokinin receptors and related proteins, member of the class A family of ...
40-312 1.19e-48

cholecystokinin receptors and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group represents four G-protein coupled receptors that are members of the RFamide receptor family, including cholecystokinin receptors (CCK-AR and CCK-BR), orexin receptors (OXR), neuropeptide FF receptors (NPFFR), and pyroglutamylated RFamide peptide receptor (QRFPR). These RFamide receptors are activated by their endogenous peptide ligands that share a common C-terminal arginine (R) and an amidated phenylanine (F) motif. CCK-AR (type A, alimentary; also known as CCK1R) is found abundantly on pancreatic acinar cells and binds only sulfated CCK-peptides with very high affinity, whereas CCK-BR (type B, brain; also known as CCK2R), the predominant form in the brain and stomach, binds CCK or gastrin and discriminates poorly between sulfated and non-sulfated peptides. CCK is implicated in regulation of digestion, appetite control, and body weight, and is involved in neurogenesis via CCK-AR. There is some evidence to support that CCK and gastrin, via their receptors, are involved in promoting cancer development and progression, acting as growth and invasion factors. Orexins (OXs; also referred to as hypocretins) are neuropeptide hormones that regulate the sleep-wake cycle and potently influence homeostatic systems regulating appetite and feeding behavior or modulating emotional responses such as anxiety or panic. OXs are synthesized as prepro-orexin (PPO) in the hypothalamus and then proteolytically cleaved into two forms of isoforms: orexin-A (OX-A) and orexin-B (OX-B). OXA is a 33 amino-acid peptide with N-terminal pyroglutamyl residue and two intramolecular disulfide bonds, whereas OXB is a 28 amino-acid linear peptide with no disulfide bonds. OX-A binds orexin receptor 1 (OX1R) with high-affinity, but also binds with somewhat low-affinity to OX2R, and signals primarily to Gq coupling, whereas OX-B shows a strong preference for the orexin receptor 2 (OX2R) and signals through Gq or Gi/o coupling. The 26RFa, also known as QRFP (Pyroglutamylated RFamide peptide), is a 26-amino acid residue peptide that exerts similar orexigenic activity including the regulation of feeding behavior in mammals. It is the ligand for G-protein coupled receptor 103 (GPR103), which is predominantly expressed in paraventricular (PVN) and ventromedial (VMH) nuclei of the hypothalamus. GPR103 shares significant protein sequence homology with orexin receptors (OX1R and OX2R), which have recently shown to produce a neuroprotective effect in Alzheimer's disease by forming a functional heterodimer with GPR103. Neuropeptide FF (NPFF) is a mammalian octapeptide that has been implicated in a wide range of physiological functions in the brain including pain sensitivity, insulin release, food intake, memory, blood pressure, and opioid-induced tolerance and hyperalgesia. The effects of NPFF are mediated through neuropeptide FF1 and FF2 receptors (NPFF1-R and NPFF2-R) which are predominantly expressed in the brain. NPFF induces pro-nociceptive effects, mainly through the NPFF1-R, and anti-nociceptive effects, mainly through the NPFF2-R.


Pssm-ID: 320124 [Multi-domain]  Cd Length: 296  Bit Score: 165.47  E-value: 1.19e-48
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802    40 LYSLVFVIGLVGNILVVLVLVQYKRLKNMTSIYLLNLAISDLLF-LFTLPFWIDYKLKDDWVFGDAMCKILSGFYYTGLY 118
Cdd:cd14993   6 LYVVVFLLALVGNSLVIAVVLRNKHMRTVTNYFLVNLAVADLLVsLFCMPLTLLENVYRPWVFGEVLCKAVPYLQGVSVS 85
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802   119 SEIFFIILLTIDRYLAIVHAVFALRARTVTFGVITSIIIWALAILASMPGLYFSKTQ-------WEFTHHTCSLHFPHES 191
Cdd:cd14993  86 ASVLTLVAISIDRYLAICYPLKARRVSTKRRARIIIVAIWVIAIIIMLPLLVVYELEeiissepGTITIYICTEDWPSPE 165
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802   192 LREWklFQALkLNLFGLVLPLLVMIICYTGIIKILLRRPN----------------EKKSKAVRLIFVIMIIFFLFWTPY 255
Cdd:cd14993 166 LRKA--YNVA-LFVVLYVLPLLIISVAYSLIGRRLWRRKPpgdrgsanstssrrilRSKKKVARMLIVVVVLFALSWLPY 242
                       250       260       270       280       290
                ....*....|....*....|....*....|....*....|....*....|....*..
gi 416802   256 NLTILISVFQDFLFTHECEQSRHLDLAVQvteVIAYTHCCVNPVIYAFVGERFRKYL 312
Cdd:cd14993 243 YVLSILLDFGPLSSEESDENFLLILPFAQ---LLGYSNSAINPIIYCFMSKKFRRGF 296
7tmA_RNL3R cd14976
relaxin-3 like peptide receptors, member of the class A family of seven-transmembrane G ...
40-312 8.26e-48

relaxin-3 like peptide receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; This G protein-coupled receptor subfamily is composed of the relaxin-3 like peptide receptors, RNL3R1 and RNL3R2, and similar proteins. The relaxin-3 like peptide family includes relaxin-1, -2, -3, as well as insulin-like (INSL) peptides 3 to 6. RNL3/relaxin-3 and INSL5 are the endogenous ligands for RNL3R1 and RNL3R2, respectively. RNL3R1, also called GPCR135 or RXFP3, is predominantly expressed in the brain and is implicated in stress, anxiety, feeding, and metabolism. Insulin-like peptide 5 (INSL5), the endogenous ligand for RNL3R2 (also called GPCR142 or RXFP4), plays a role in fat and glucose metabolism. INSL5 is highly expressed in human rectal and colon tissues. Both RNL3R1 and RNL3R2 signal through G(i) protein and inhibit adenylate cyclase, thereby inhibit cAMP accumulation. RNL3R1 is shown to activate Erk1/2 signaling pathway.


Pssm-ID: 320107  Cd Length: 290  Bit Score: 163.06  E-value: 8.26e-48
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802    40 LYSLVFVIGLVGNILVVLVLVQYKRLKNMTSI--YLLNLAISDLLFLFTLPFW-IDYKLKDDWVFGDAMCKILSGFYYTG 116
Cdd:cd14976   6 VYMVVFTVGLLGNLLVLYLLKSNKKLRQQSESnkFVFNLALTDLIFVLTLPFWaVEYALDFVWPFGTAMCKVVRYVTKLN 85
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802   117 LYSEIFFIILLTIDRYLAIVHAVFALRARTVTFGVITSIIIWALAILASMPGLYFSKTQWEFTHHT-CSLHFPHESL-RE 194
Cdd:cd14976  86 MYSSIFFLTALSVTRYIAVARALKHGWIRKAFGAFATTIAIWAAAALAAIPEAIFSTDTWSSVNHTlCLLRFPKNSSvTR 165
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802   195 WK----LFQALKLnLFGLVLPLLVMIICYTGIIKILLRR---PNEKKSKAVRLIFVIMIIFFLFWTPYNLTILISVFQDF 267
Cdd:cd14976 166 WYnwlgMYQLQKV-VLGFFLPLGIITLSYLLLLRFLQRKrggSKRRKSRVTKSVFIVVLSFFICWLPNQALSLWSALIKF 244
                       250       260       270       280
                ....*....|....*....|....*....|....*....|....*..
gi 416802   268 LFTHEcEQSRHL--DLAVQVTEVIAYTHCCVNPVIYAFVGERFRKYL 312
Cdd:cd14976 245 DDVPF-SDAFFAfqTYAFPVAICLAHSNSCLNPVLYCLVRREFRDAL 290
7tmA_CysLTR cd15921
cysteinyl leukotriene receptors, member of the class A family of seven-transmembrane G ...
35-312 2.12e-47

cysteinyl leukotriene receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Cysteinyl leukotrienes (LTC4, LTD4, and LTE4) are the most potent inflammatory lipid mediators that play an important role in human asthma. They are synthesized in the leucocytes (cells of immune system) from arachidonic acid by the actions of 5-lipoxygenase and induce bronchial constriction through G protein-coupled receptors, CysLTR1 and CysLTR2. Activation of CysLTR1 by LTD4 induces airway smooth muscle contraction and proliferation, eosinophil migration, and damage to the lung tissue. They belong to the class A GPCR superfamily, which all have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320587 [Multi-domain]  Cd Length: 283  Bit Score: 161.90  E-value: 2.12e-47
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802    35 QLLPPLYSLVFVIGLVGNILVVLVLVQYKRLKNMTSIYLLNLAISDLLFLFTLPFWIDYKL-KDDWVFGDAMCKILSGFY 113
Cdd:cd15921   1 LFYPTAYILIFILGLTGNSISVYVFLSQYRSQTPVSVLMVNLAISDLLLVCTLPLRLTYYVlNSHWPFGDIACRIILYVL 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802   114 YTGLYSEIFFIILLTIDRYLAIVHAVFALRARTVTFGVITSIIIWALAILASMPGLYFSKTQWEFTHHTCsLHFPHESLR 193
Cdd:cd15921  81 YVNMYSSIYFLTALSVFRYLALVWPYLYLRVQTHSVAGIICGLIWILMGLASSPLLFAKSKQHDEGSTRC-LELAHDAVD 159
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802   194 EWKLFQALKLnLFGLVLPLLVMIICYTGIIKILLR-RPNEKKS-----KAVRLIFVIMIIFFLFWTPYNLTILISVFQDF 267
Cdd:cd15921 160 KLLLINYVTL-PVGFVVPFMTVIFCYIFIIKNLLKpSPALGRTrpsrrKACALIIISLGIFLVCFLPYHIVRTIHLITER 238
                       250       260       270       280
                ....*....|....*....|....*....|....*....|....*
gi 416802   268 LFTHECEQSRHLDLAVQVTEVIAYTHCCVNPVIYAFVGERFRKYL 312
Cdd:cd15921 239 QIKESCGYILRVRKAAVITLCLAASNSCFDPLLYFFVGENFRSRL 283
7tmA_P2Y1-like cd15168
P2Y purinoceptors 1, 2, 4, 6, 11 and similar proteins, member of the class A family of ...
36-309 5.90e-47

P2Y purinoceptors 1, 2, 4, 6, 11 and similar proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; The P2Y receptor family is composed of eight subtypes, which are activated by naturally occurring extracellular nucleotides such as ATP, ADP, UTP, UDP, and UDP-glucose. These eight receptors are ubiquitous in human tissues and can be further classified into two subfamilies based on sequence homology and second messenger coupling: a subfamily of five P2Y1-like receptors (P2Y1, P2Y2, P2Y4, P2Y6, and P2Y11Rs) that are coupled to G(q) protein to activate phospholipase C (PLC) and a second subfamily of three P2Y12-like receptors (P2Y12, P2YR13, and P2Y14Rs) that are coupled to G(i) protein to inhibit adenylate cyclase. Several cloned subtypes, such as P2Y3, P2Y5, and P2Y7-10, are not functional mammalian nucleotide receptors. The native agonists for P2Y receptors are: ATP (P2Y2, P2Y12), ADP (P2Y1, P2Y12, and P2Y13), UTP (P2Y2, P2Y4), UDP (P2Y6, P2Y14), and UDP-glucose (P2Y14). This cluster only includes P2Y1-like receptors as well as other closely related orphan receptors, such as GPR91 (a succinate receptor) and GPR80/GPR99 (an alpha-ketoglutarate receptor).


Pssm-ID: 341329 [Multi-domain]  Cd Length: 284  Bit Score: 160.56  E-value: 5.90e-47
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802    36 LLPPLYSLVFVIGLVGNILVVLVLVQYKRLKNMTSIYLLNLAISDLLFLFTLPFWI-DYKLKDDWVFGDAMCKILSGFYY 114
Cdd:cd15168   2 FLPIVYGVVFLVGLLLNSVVLYRFIFHLKPWNSSAIYMFNLAVSDLLYLLSLPFLIyYYANGDHWIFGDFMCKLVRFLFY 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802   115 TGLYSEIFFIILLTIDRYLAIVHAVFALRARTVTFGVITSIIIWALAILASMPGLYFSKTQWEFTHHTCSLHFPHESLRE 194
Cdd:cd15168  82 FNLYGSILFLTCISVHRYLGICHPLRSLGKLKKRHAVAISVAVWILVLLQLLPILFFATTGRKNNRTTCYDTTSPEELND 161
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802   195 WKLFqALKLNLFGLVLPLLVMIICYTGIIKILLRRPNE-----KKSKAVRLIFVIMIIFFLFWTPYNLTILISVfqdFLF 269
Cdd:cd15168 162 YVIY-SMVLTGLGFLLPLLIILACYGLIVRALIRKLGEgvtsaLRRKSIRLVIIVLALFAVCFLPFHVTRTINL---AAR 237
                       250       260       270       280
                ....*....|....*....|....*....|....*....|....
gi 416802   270 THECEQSRHLDLAV----QVTEVIAYTHCCVNPVIYAFVGERFR 309
Cdd:cd15168 238 LLSGTASCATLNGIyvayKVTRPLASLNSCLNPLLYFLAGDKFR 281
7tmA_Kappa_opioid_R cd15091
opioid receptor subtype kappa, member of the class A family of seven-transmembrane G ...
36-310 8.53e-46

opioid receptor subtype kappa, member of the class A family of seven-transmembrane G protein-coupled receptors; The kappa-opioid receptor binds the opioid peptide dynorphin as the primary endogenous ligand. The opioid receptor family is composed of four major subtypes: mu (MOP), delta (DOP), kappa (KOP) opioid receptors, and the nociceptin/orphanin FQ peptide receptor (NOP). They are distributed widely in the central nervous system and respond to classic alkaloid opiates, such as morphine and heroin, as well as to endogenous peptide ligands, which include dynorphins, enkephalins, endorphins, endomorphins, and nociceptin. Opioid receptors are coupled to inhibitory G proteins of the G(i/o) family and involved in regulating a variety of physiological functions such as pain, addiction, mood, stress, epileptic seizure, and obesity, among many others.


Pssm-ID: 320219 [Multi-domain]  Cd Length: 282  Bit Score: 157.42  E-value: 8.53e-46
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802    36 LLPPLYSLVFVIGLVGNILVVLVLVQYKRLKNMTSIYLLNLAISDLLFLFTLPFWIDYKLKDDWVFGDAMCKILSGFYYT 115
Cdd:cd15091   2 IITAVYSVVFVVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADALVTTTMPFQSTVYLMNSWPFGDVLCKIVISIDYY 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802   116 GLYSEIFFIILLTIDRYLAIVHAVFALRARTVTFGVITSIIIWALAILASMPGLYF--SKTQWEFTHHTCSLHFPHESLR 193
Cdd:cd15091  82 NMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKAKIINICIWLLSSSVGISAIVLggTKVREDVDSTECSLQFPDDDYS 161
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802   194 EWKLFQALKLNLFGLVLPLLVMIICYTGIIKIL--------LRRPNEKKSKAVRLIFVIMIIFFLFWTPYNLTILISVFQ 265
Cdd:cd15091 162 WWDTFMKICVFIFAFVIPVLIIIVCYTLMILRLksvrllsgSREKDRNLRRITRLVLVVVAVFVVCWTPIHIFILVEALG 241
                       250       260       270       280
                ....*....|....*....|....*....|....*....|....*
gi 416802   266 DFLFTHECEQSRHLDLAvqvtevIAYTHCCVNPVIYAFVGERFRK 310
Cdd:cd15091 242 SVSHSTAAVSSYYFCIA------LGYTNSSLNPILYAFLDENFKR 280
7tmA_Anaphylatoxin_R-like cd14974
anaphylatoxin receptors and related G protein-coupled chemokine receptors, member of the class ...
39-312 1.31e-45

anaphylatoxin receptors and related G protein-coupled chemokine receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; This subfamily of G-protein coupled receptors includes anaphylatoxin receptors, formyl peptide receptors (FPR), prostaglandin D2 receptor 2, GPR1, and related chemokine receptors. The anaphylatoxin receptors are a group of G-protein coupled receptors that bind anaphylatoxins. The members of this group include C3a and C5a receptors. The formyl peptide receptors (FPRs) are chemoattractant GPCRs that involved in mediating immune responses to infection. They are expressed mainly on polymorphonuclear and mononuclear phagocytes and bind N-formyl-methionyl peptides (FMLP), which are derived from the mitochondrial proteins of ruptured host cells or invading pathogens. Chemokine receptor-like 1 (also known as chemerin receptor 23) is a GPCR for the chemoattractant adipokine chemerin, also known as retinoic acid receptor responder protein 2 (RARRES2), and for the omega-3 fatty acid derived molecule resolvin E1. Interaction with chemerin induces activation of the MAPK and PI3K signaling pathways leading to downstream functional effects, such as a decrease in immune responses, stimulation of adipogenesis, and angiogenesis. On the other hand, resolvin E1 negatively regulates the cytokine production in macrophages by reducing the activation of MAPK1/3 and NF-kB pathways. Prostaglandin D2 receptor, also known as CRTH2, is a chemoattractant G-protein coupled receptor expressed on T helper type 2 cells that binds prostaglandin D2 (PGD2). PGD2 functions as a mast cell-derived mediator to trigger asthmatic responses and also causes vasodilation. PGD2 exerts its inflammatory effects by binding to two G-protein coupled receptors, the D-type prostanoid receptor (DP) and PD2R2 (CRTH2). PD2R2 couples to the G protein G(i/o) type which leads to a reduction in intracellular cAMP levels and an increase in intracellular calcium. GPR1 is an orphan receptor that can be activated by the leukocyte chemattractant chemerin, thereby suggesting that some of the anti-inflammatory actions of chemerin may be mediated through GPR1.


Pssm-ID: 320105 [Multi-domain]  Cd Length: 274  Bit Score: 156.69  E-value: 1.31e-45
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802    39 PLYSLVFVIGLVGNILVVLVlVQYKRLKNMTSIYLLNLAISDLLFLFTLPFWIDYKLKD-DWVFGDAMCKILSGFYYTGL 117
Cdd:cd14974   5 VLYALIFLLGLPGNGLVIWV-AGFKMKRTVNTVWFLNLALADFLFCLFLPFLIVYIAMGhHWPFGSVLCKLNSFVISLNM 83
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802   118 YSEIFFIILLTIDRYLAIVHAVFALRARTVTFGVITSIIIWALAILASMPGLYFSKTQWEFTHHTCSL-HFPHESLREWK 196
Cdd:cd14974  84 FASVFLLTAISLDRCLLVLHPVWAQNHRTVRLASVVCVGIWILALVLSVPYFVFRDTVTHHNGRSCNLtCVEDYDLRRSR 163
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802   197 LfQALKLN--LFGLVLPLLVMIICYTGIIKILLRRPNEKKSKAVRLIFVIMIIFFLFWTPYNLTILISvfqdflFTHECE 274
Cdd:cd14974 164 H-KALTVIrfLCGFLLPLLIIAICYSVIAVKLRRKRLAKSSKPLRVLLAVVVAFFLCWLPYHVFALLE------LVAAAG 236
                       250       260       270
                ....*....|....*....|....*....|....*...
gi 416802   275 QSRHLDLAVQVTEVIAYTHCCVNPVIYAFVGERFRKYL 312
Cdd:cd14974 237 LPEVVLLGLPLATGLAYFNSCLNPILYVFMGQDFRKRL 274
7tmA_Proton-sensing_R cd15160
proton-sensing G protein-coupled receptors, member of the class A family of ...
36-309 1.68e-45

proton-sensing G protein-coupled receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Proton/pH-sensing G-protein coupled receptors sense pH of 7.6 to 6.0. They mediate a variety of biological activities in neutral and mildly acidic pH conditions, whereas the acid-sensing ionotropic ion channels typically sense strong acidic pH. The proton/pH-sensing receptor family includes the G2 accumulation receptor (G2A, also known as GPR132), the T cell death associated gene-8 (TDAG8, GPR65) receptor, ovarian cancer G-protein receptor 1 (OGR-1, GPR68), and G-protein-coupled receptor 4 (GPR4).


Pssm-ID: 320288 [Multi-domain]  Cd Length: 280  Bit Score: 156.78  E-value: 1.68e-45
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802    36 LLPPLYSLVFVIGLVGNILVVLVLVQYKRLKNMTSIYLLNLAISDLLFLFTLPFWIDYKL-KDDWVFGDAMCKILSGFYY 114
Cdd:cd15160   2 FLPVVYSFVFVVGLPANCLALWVLYLQIKKENVLGVYLLNLSLSDLLYILTLPLWIDYTAnHHNWTFGPLSCKVVGFFFY 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802   115 TGLYSEIFFIILLTIDRYLAIVHAVFALRARTVTFGVITSIIIWALAILASMPGLYFSKTQWEFTHHT-CSLHFPHESlr 193
Cdd:cd15160  82 TNIYASIGFLCCIAVDRYLAVVHPLRFRGLRTRRFALKVSASIWVLELGTHSVFLGHDELFRDEPNHTlCYEKYPMEG-- 159
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802   194 eWKLFQALKLNLFGLVLPLLVMIICYTGIIKILLRRP---NEKKSKAVRLIFVIMIIFFLFWTPYNLTILISVFQDFLFT 270
Cdd:cd15160 160 -WQASYNYARFLVGFLIPLSLILFFYRRVLRAVRQSPsleREEKRKIIGLLLSIVVIFLLCFLPYHVVLLVRSVIELVQN 238
                       250       260       270
                ....*....|....*....|....*....|....*....
gi 416802   271 HECEQSRHLDLAVQVTEVIAYTHCCVNPVIYAFVGERFR 309
Cdd:cd15160 239 GLCGFEKRVFTAYQISLCLTSLNCVADPILYIFVTEDVR 277
7tmA_P2Y1-like cd15967
P2Y purinoceptor 1-like; P2Y1-like is an uncharacterized group that is phylogenetically ...
35-308 7.48e-45

P2Y purinoceptor 1-like; P2Y1-like is an uncharacterized group that is phylogenetically related to a family of purinergic G protein-coupled receptors. The P2Y receptor family is composed of eight subtypes, which are activated by naturally occurring extracellular nucleotides such as ATP, ADP, UTP, UDP, and UDP-glucose. These eight receptors are ubiquitous in human tissues and can be further classified into two subfamilies based on sequence homology and second messenger coupling: a subfamily of five P2Y1-like receptors (P2Y1, P2Y2, P2Y4, P2Y6, and P2Y11Rs) that are coupled to G(q) protein to activate phospholipase C (PLC) and a second subfamily of three P2Y12-like receptors (P2Y12, P2YR13, and P2Y14Rs) that are coupled to G(i) protein to inhibit adenylate cyclase. Several cloned subtypes, such as P2Y3, P2Y5, and P2Y7-10, are not functional mammalian nucleotide receptors. The native agonists for P2Y receptors are: ATP (P2Y2, P2Y12), ADP (P2Y1, P2Y12, and P2Y13), UTP (P2Y2, P2Y4), UDP (P2Y6, P2Y14), and UDP-glucose (P2Y14).


Pssm-ID: 320633  Cd Length: 281  Bit Score: 154.85  E-value: 7.48e-45
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802    35 QLLPPLYSLVFVIGLVGNILVVLVLVQ-YKRLKNMtSIYLLNLAISDLLFLFTLPFWIDYKLKDD-WVFGDAMCKILSGF 112
Cdd:cd15967   1 QFLPPVYILVFVVGLVGNVWGLKSLLAnWKKLGNI-NVFVLNLGLADLLYLLTLPFLVVYYLKGRkWIFGQVFCKITRFC 79
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802   113 YYTGLYSEIFFIILLTIDRYLAIVHAVFALRARTVTFGVITSIIIWALAILASMPGLYFSKTQWEFT--HHTCSlhfpHE 190
Cdd:cd15967  80 FNLNLYGSIGFLTCISVYRYLAIVHPMRVMGRITTTHSVVISALVWLLVVIQSLPDLFFSKTNSNGTkcFDTTF----ND 155
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802   191 SLREWkLFQALKLNLFGLVLPLLVMIICYTGIIKILLRRPNEK---KSKAVRLIFVIMIIFFLFWTPY----NLTILISV 263
Cdd:cd15967 156 YLESY-LTYSLGWTVTGFVIPLLIILGCYGHVVVVLCRNNNVDkglKQRCLKLVIILIVLFSVCYIPYhvfrNLNLLSRI 234
                       250       260       270       280
                ....*....|....*....|....*....|....*....|....*.
gi 416802   264 FQDflfTHECEQ-SRHLDLAVQVTEVIAYTHCCVNPVIYAFVGERF 308
Cdd:cd15967 235 LQK---QGSCTQwFRGIYIAHQVSRGLVCLNSALNPLVYLMGSEDI 277
7tmA_BK-1 cd15380
bradykinin receptor B1, member of the class A family of seven-transmembrane G protein-coupled ...
36-309 1.53e-44

bradykinin receptor B1, member of the class A family of seven-transmembrane G protein-coupled receptors; The bradykinin receptor family is a group of the seven transmembrane G-protein coupled receptors, whose endogenous ligand is the pro-inflammatory nonapeptide bradykinin that mediates various vascular and pain responses. Two major bradykinin receptor subtypes, B1 and B2, have been identified based on their pharmacological properties. The B1 receptor is rapidly induced by tissue injury and inflammation, whereas the B2 receptor is ubiquitously expressed on many tissue types. Both receptors contain three consensus sites for N-linked glycosylation in extracellular domains and couple to G(q) protein to activate phospholipase C, leading to phosphoinositide hydrolysis and intracellular calcium mobilization. They can also interact with G(i) protein to inhibit adenylate cyclase and activate the MAPK (mitogen-activated protein kinase) pathways.


Pssm-ID: 320502  Cd Length: 286  Bit Score: 154.57  E-value: 1.53e-44
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802    36 LLPPLYSLVFVIGLVGNILVVLVLVQYKRLKNMTSIYLLNLAISDLLFLFTLPFWID-YKLKDDWVFGDAMCKILSGFYY 114
Cdd:cd15380   2 VLPTFIIAICFFGLLGNLFVLFVFLLPRRRLTIAEIYLANLAASDLVFVLGLPFWAEnIRNQFNWPFGNFLCRVISGVIK 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802   115 TGLYSEIFFIILLTIDRYLAIVHAVFALRARTVTFGVITSIIIWALAILASMPGLYFS--KTQWEFTHHTCSLHFPHESl 192
Cdd:cd15380  82 ANLFISIFLVVAISQDRYRTLVHTMTSRRQRSRRQAQVICLLIWVFGGLLSIPTFLFRsvKHVPDLNISACILLFPHEA- 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802   193 reWKLFQALKLNLFGLVLPLLVMIICYTGIIKILLRRPNE--------KKSKAVRLIFVIMIIFFLFWTPYNLTIlisvF 264
Cdd:cd15380 161 --WHFARRVELNIVGFLLPLAAIVFFNFHIIASLRERTEEsrkrcgglKDTKATRLILTLVLMFLVCWTPYHFFA----F 234
                       250       260       270       280
                ....*....|....*....|....*....|....*....|....*....
gi 416802   265 QDFLFTHE----CEQSRHLDLAVQVTEVIAYTHCCVNPVIYAFVGERFR 309
Cdd:cd15380 235 LDFLFQVEviqgCFWEEFIDLGLQLANFFAFANSCLNPVIYVFAGKLFR 283
7tmA_Gal1_R cd15098
galanin receptor subtype 1, member of the class A family of seven-transmembrane G ...
36-310 2.82e-44

galanin receptor subtype 1, member of the class A family of seven-transmembrane G protein-coupled receptors; The G protein-coupled galanin receptors bind galanin, a neuropeptide that is widely expressed in the brain, peripheral tissues, and endocrine glands. Three receptors subtypes have been so far identified: GAL1, GAL2, and GAL3. The specific functions of each subtype remains mostly unknown, although galanin is thought to be involved in a variety of neuronal functions such as hormone release and food intake. Galanin is implicated in numerous neurological and psychiatric diseases including Alzheimer's disease, depression, eating disorders, epilepsy and stroke, among many others.


Pssm-ID: 320226 [Multi-domain]  Cd Length: 282  Bit Score: 153.73  E-value: 2.82e-44
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802    36 LLPPLYSLVFVIGLVGNILVVLVLVQYKRLK--NMTSIYLLNLAISDLLFL-FTLPFWIDYKLKDDWVFGDAMCKILSGF 112
Cdd:cd15098   2 IVPVVFGLIFCLGVLGNSLVITVLARVKPGKrrSTTNVFILNLSIADLFFLlFCVPFQATIYSLPEWVFGAFMCKFVHYF 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802   113 YYTGLYSEIFFIILLTIDRYLAIVHAVFALRARTVTFGVITSIIIWALAILASMPGLYfskTQWEFTHHTCSLH---FPH 189
Cdd:cd15098  82 FTVSMLVSIFTLVAMSVDRYIAVVHSRTSSSLRTRRNALLGVLVIWVLSLAMASPVAV---HQDLVHHWTASNQtfcWEN 158
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802   190 ESLREWKLFQALKLNLFGLVLPLLVMIICYTGIIKILLRRPNEK-------KSKAVRLIFVIMIIFFLFWTPYNLTILIS 262
Cdd:cd15098 159 WPEKQQKPVYVVCTFVFGYLLPLLLITFCYAKVLNHLHKKLKNMskksersKKKTAQTVLVVVVVFGISWLPHHIIHLWV 238
                       250       260       270       280
                ....*....|....*....|....*....|....*....|....*...
gi 416802   263 VFQDFLFTHECEQSRhldlavQVTEVIAYTHCCVNPVIYAFVGERFRK 310
Cdd:cd15098 239 EFGDFPLTQASFVLR------ITAHCLAYANSCVNPIIYAFLSENFRK 280
7tmA_NPYR-like cd15203
neuropeptide Y receptors and related proteins, member of the class A family of ...
40-310 1.81e-43

neuropeptide Y receptors and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; NPY is a 36-amino acid peptide neurotransmitter with a C-terminal tyrosine amide residue that is widely distributed in the brain and the autonomic nervous system of many mammalian species. NPY exerts its functions through five, G-protein coupled receptor subtypes including NPY1R, NPY2R, NPY4R, NPY5R, and NPY6R; however, NPY6R is not functional in humans. NYP receptors are also activated by its two other family members, peptide YY (PYY) and pancreatic polypeptide (PP). They typically couple to Gi or Go proteins, which leads to a decrease in adenylate cyclase activity, thereby decreasing intracellular cAMP levels, and are involved in diverse physiological roles including appetite regulation, circadian rhythm, and anxiety. Also included in this subgroup is prolactin-releasing peptide (PrRP) receptor (previously known as GPR10), which is activated by its endogenous ligand PrRP, a neuropeptide possessing C-terminal Arg-Phe-amide motif. There are two active isoforms of PrRP in mammals: one consists of 20 amino acid residues (PrRP-20) and the other consists of 31 amino acid residues (PrRP-31). PrRP receptor shows significant sequence homology to the NPY receptors, and a micromolar level of NPY can bind and completely inhibit the PrRP-evoked intracellular calcium response in PrRP receptor-expressing cells, suggesting that the PrRP receptor shares a common ancestor with the NPY receptors.


Pssm-ID: 320331 [Multi-domain]  Cd Length: 293  Bit Score: 151.60  E-value: 1.81e-43
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 416802    40 LYSLVFVIGLVGNILVVLVLVQYKRLKNMTSIYLLNLAISDLLF-LFTLPFWIDYKLKDDWVFGDAMCKILSGFYYTGLY 118
Cdd:cd15203   6 LYGLIIVLGVVGNLLVIYVVLRNKSMQTVTNIFILNLAV</