NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|4557922]
View 

Protein Classification

pyruvate kinase (domain architecture ID 10084586)

pyruvate kinase catalyzes the phosphorylation of pyruvate to form phosphoenolpyruvate and functions in regulating glycolysis

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Pyruvate_Kinase cd00288
Pyruvate kinase (PK): Large allosteric enzyme that regulates glycolysis through binding of ...
41-529 0e+00

Pyruvate kinase (PK): Large allosteric enzyme that regulates glycolysis through binding of the substrate, phosphoenolpyruvate, and one or more allosteric effectors. Like other allosteric enzymes, PK has a high substrate affinity R state and a low affinity T state. PK exists as several different isozymes, depending on organism and tissue type. In mammals, there are four PK isozymes: R, found in red blood cells, L, found in liver, M1, found in skeletal muscle, and M2, found in kidney, adipose tissue, and lung. PK forms a homotetramer, with each subunit containing three domains. The T state to R state transition of PK is more complex than in most allosteric enzymes, involving a concerted rotation of all 3 domains of each monomer in the homotetramer.


:

Pssm-ID: 238178 [Multi-domain]  Cd Length: 480  Bit Score: 821.56  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922   41 ARNTGIICTIGPASRSVETLKEMIKSGMNVARMNFSHGTHEYHAETIKNVRTATESFAsdpilyRPVAVALDTKGPEIRT 120
Cdd:cd00288   1 LRRTKIVCTIGPATDSVENLKKLIKAGMNVARMNFSHGSHEYHQSRIDNVREAAEKTG------GPVAIALDTKGPEIRT 74
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922  121 GLIKGSgtAEVELKKGATLKITLDNAyMEKCDENILWLDYKNICKVVDVGSKVYVDDGLISLQVKQKGPD-FLVTEVENG 199
Cdd:cd00288  75 GLFKGG--KDISLKAGDKFLVTTDPA-AKKGTKEKIYVDYKNLTKDVSPGNTILVDDGLLSLKVLSKDDDkTLVCEVLNG 151
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922  200 GFLGSKKGVNLPGAAVDLPAVSEKDIQDLKFGVEQDVDMVFASFIRKAADVHEVRKILGEKGKNIKIISKIENHEGVRRF 279
Cdd:cd00288 152 GVLGSRKGVNLPGTDVDLPALSEKDKADLRFGVEQGVDMIFASFVRKASDVLEIREVLGEKGKDIKIIAKIENQEGVNNF 231
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922  280 DEILEASDGIMVARGDLGIEIPAEKVFLAQKMIIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIM 359
Cdd:cd00288 232 DEILEASDGIMVARGDLGVEIPAEEVFLAQKMLIAKCNLAGKPVITATQMLESMIYNPRPTRAEVSDVANAVLDGTDCVM 311
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922  360 LSGETAKGDYPLEAVRMQHLIAREAEAAMFHRKLFEELARSSSHSTDLMEAMAMGSVEASYKCLAAALIVLTESGRSAHQ 439
Cdd:cd00288 312 LSGETAKGKYPVEAVKAMARICLEAEKALSHRVLFNEMRRLTPRPTSTTEAVAMSAVRAAFELGAKAIVVLTTSGRTARL 391
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922  440 VARYRPRAPIIAVTRNHQTARQAHLYRGIFPVVCKDPVQEaWAEDVDLRVNLAMNVGKARGFFKKGDVVIVLTGWRPGSG 519
Cdd:cd00288 392 VSKYRPNAPIIAVTRNEQTARQLHLYRGVYPVLFEEPKPG-WQEDTDARLKAAVNVAKEKGLLKKGDLVVVVQGWPVGSG 470
                       490
                ....*....|
gi 4557922  520 FTNTMRVVPV 529
Cdd:cd00288 471 STNTMRILTV 480
 
Name Accession Description Interval E-value
Pyruvate_Kinase cd00288
Pyruvate kinase (PK): Large allosteric enzyme that regulates glycolysis through binding of ...
41-529 0e+00

Pyruvate kinase (PK): Large allosteric enzyme that regulates glycolysis through binding of the substrate, phosphoenolpyruvate, and one or more allosteric effectors. Like other allosteric enzymes, PK has a high substrate affinity R state and a low affinity T state. PK exists as several different isozymes, depending on organism and tissue type. In mammals, there are four PK isozymes: R, found in red blood cells, L, found in liver, M1, found in skeletal muscle, and M2, found in kidney, adipose tissue, and lung. PK forms a homotetramer, with each subunit containing three domains. The T state to R state transition of PK is more complex than in most allosteric enzymes, involving a concerted rotation of all 3 domains of each monomer in the homotetramer.


Pssm-ID: 238178 [Multi-domain]  Cd Length: 480  Bit Score: 821.56  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922   41 ARNTGIICTIGPASRSVETLKEMIKSGMNVARMNFSHGTHEYHAETIKNVRTATESFAsdpilyRPVAVALDTKGPEIRT 120
Cdd:cd00288   1 LRRTKIVCTIGPATDSVENLKKLIKAGMNVARMNFSHGSHEYHQSRIDNVREAAEKTG------GPVAIALDTKGPEIRT 74
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922  121 GLIKGSgtAEVELKKGATLKITLDNAyMEKCDENILWLDYKNICKVVDVGSKVYVDDGLISLQVKQKGPD-FLVTEVENG 199
Cdd:cd00288  75 GLFKGG--KDISLKAGDKFLVTTDPA-AKKGTKEKIYVDYKNLTKDVSPGNTILVDDGLLSLKVLSKDDDkTLVCEVLNG 151
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922  200 GFLGSKKGVNLPGAAVDLPAVSEKDIQDLKFGVEQDVDMVFASFIRKAADVHEVRKILGEKGKNIKIISKIENHEGVRRF 279
Cdd:cd00288 152 GVLGSRKGVNLPGTDVDLPALSEKDKADLRFGVEQGVDMIFASFVRKASDVLEIREVLGEKGKDIKIIAKIENQEGVNNF 231
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922  280 DEILEASDGIMVARGDLGIEIPAEKVFLAQKMIIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIM 359
Cdd:cd00288 232 DEILEASDGIMVARGDLGVEIPAEEVFLAQKMLIAKCNLAGKPVITATQMLESMIYNPRPTRAEVSDVANAVLDGTDCVM 311
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922  360 LSGETAKGDYPLEAVRMQHLIAREAEAAMFHRKLFEELARSSSHSTDLMEAMAMGSVEASYKCLAAALIVLTESGRSAHQ 439
Cdd:cd00288 312 LSGETAKGKYPVEAVKAMARICLEAEKALSHRVLFNEMRRLTPRPTSTTEAVAMSAVRAAFELGAKAIVVLTTSGRTARL 391
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922  440 VARYRPRAPIIAVTRNHQTARQAHLYRGIFPVVCKDPVQEaWAEDVDLRVNLAMNVGKARGFFKKGDVVIVLTGWRPGSG 519
Cdd:cd00288 392 VSKYRPNAPIIAVTRNEQTARQLHLYRGVYPVLFEEPKPG-WQEDTDARLKAAVNVAKEKGLLKKGDLVVVVQGWPVGSG 470
                       490
                ....*....|
gi 4557922  520 FTNTMRVVPV 529
Cdd:cd00288 471 STNTMRILTV 480
pyruv_kin TIGR01064
pyruvate kinase; This enzyme is a homotetramer. Some forms are active only in the presence of ...
42-526 0e+00

pyruvate kinase; This enzyme is a homotetramer. Some forms are active only in the presence of fructose-1,6-bisphosphate or similar phosphorylated sugars. [Energy metabolism, Glycolysis/gluconeogenesis]


Pssm-ID: 273424 [Multi-domain]  Cd Length: 472  Bit Score: 753.35  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922     42 RNTGIICTIGPASRSVETLKEMIKSGMNVARMNFSHGTHEYHAETIKNVRTATESFAsdpilyRPVAVALDTKGPEIRTG 121
Cdd:TIGR01064   1 RRTKIVCTIGPATNSPEMLKKLLDAGMNVARLNFSHGSHEEHGKRIENVREAAEKLG------RPVAILLDTKGPEIRTG 74
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922    122 LIKGSgtaEVELKKGATLKITLDNAYMEkCDENILWLDYKNICKVVDVGSKVYVDDGLISLQVKQKGPDFLVTEVENGGF 201
Cdd:TIGR01064  75 EIKGG---EVKLKKGDKVIITTDDIKGE-GDEEKVYVDYKGLTKDVVEGDKILVDDGKISLVVVSVEGDKVICEVLNGGT 150
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922    202 LGSKKGVNLPGAAVDLPAVSEKDIQDLKFGVEQDVDMVFASFIRKAADVHEVRKILGEKG-KNIKIISKIENHEGVRRFD 280
Cdd:TIGR01064 151 LKSKKGVNLPGADVDLPALSEKDKKDLKFGVEQGVDMVAASFVRTAEDVLEVREVLGEKGaKDVKIIAKIENQEGVDNID 230
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922    281 EILEASDGIMVARGDLGIEIPAEKVFLAQKMIIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIML 360
Cdd:TIGR01064 231 EIAEASDGIMVARGDLGVEIPAEEVPIAQKKMIRKCNRAGKPVITATQMLDSMIKNPRPTRAEVSDVANAVLDGTDAVML 310
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922    361 SGETAKGDYPLEAVRMQHLIAREAEAAMFHRKLFEELARSSSHSTDLMEAMAMGSVEASYKCLAAALIVLTESGRSAHQV 440
Cdd:TIGR01064 311 SGETAKGKYPVEAVQMMAKIAKEAEKALAYLTNFNDRKNSDPKPSTITEAIALSAVEAAEKLDAKAIVVLTESGRTARLL 390
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922    441 ARYRPRAPIIAVTRNHQTARQAHLYRGIFPVVCKDpvqeaWAEDVDLRVNLAMNVGKARGFFKKGDVVIVLTG-WRPGSG 519
Cdd:TIGR01064 391 SKYRPNAPIIAVTPNERVARQLALYWGVFPFLVDE-----EPSDTDARVNKALELLKEKGIVKKGDLVVVIQGgPIGGEG 465

                  ....*..
gi 4557922    520 FTNTMRV 526
Cdd:TIGR01064 466 GTNTIRV 472
PK pfam00224
Pyruvate kinase, barrel domain; This domain of the is actually a small beta-barrel domain ...
41-394 0e+00

Pyruvate kinase, barrel domain; This domain of the is actually a small beta-barrel domain nested within a larger TIM barrel. The active site is found in a cleft between the two domains.


Pssm-ID: 333937  Cd Length: 348  Bit Score: 622.85  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922     41 ARNTGIICTIGPASRSVETLKEMIKSGMNVARMNFSHGTHEYHAETIKNVRTATESFASDpilyrpVAVALDTKGPEIRT 120
Cdd:pfam00224   1 LRRTKIVCTIGPASNSVETLVKLIEAGMNVARMNFSHGSHEYHQSRIDNVREAEEKTGGR------VAIALDTKGPEIRT 74
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922    121 GLIKGsGTAEVELKKGATLKITLDNAYMEKCDENILWLDYKNICKVVDVGSKVYVDDGLISLQVKQKGPDF-LVTEVENG 199
Cdd:pfam00224  75 GNTKD-GADDIELKEGDKMIVSTDEKYKGACDPEIIYVDYKNITKDVSVGRIILVDDGLLSLKVLSKDDDKtLVTEVLNG 153
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922    200 GFLGSKKGVNLPGAAVDLPAVSEKDIQDLKFGVEQDVDMVFASFIRKAADVHEVRKILGEKGKNIKIISKIENHEGVRRF 279
Cdd:pfam00224 154 GVLGSRKGVNLPGTDVDLPALSEKDKADLRFGVKQGVDMIFASFVRKASDVLEIREVLGEAGKNIQIIAKIENQEGVNNF 233
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922    280 DEILEASDGIMVARGDLGIEIPAEKVFLAQKMIIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIM 359
Cdd:pfam00224 234 DEILEASDGIMVARGDLGIEIPAEEVFLAQKMLIAKCNLAGKPVITATQMLESMIYNPRPTRAEVSDVANAVLDGTDCVM 313
                         330       340       350
                  ....*....|....*....|....*....|....*
gi 4557922    360 LSGETAKGDYPLEAVRMQHLIAREAEAAMFHRKLF 394
Cdd:pfam00224 314 LSGETAKGNYPVEAVKTMHEIALEAEKALPHRNLF 348
PykF COG0469
Pyruvate kinase [Carbohydrate transport and metabolism];
42-529 0e+00

Pyruvate kinase [Carbohydrate transport and metabolism];


Pssm-ID: 223545 [Multi-domain]  Cd Length: 477  Bit Score: 620.72  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922   42 RNTGIICTIGPASRSVETLKEMIKSGMNVARMNFSHGTHEYHAETIKNVRTAtesfasDPILYRPVAVALDTKGPEIRTG 121
Cdd:COG0469   5 RKTKIVATLGPATESEEMLEKLIEAGMNVVRLNFSHGDHEEHKKRIDNVREA------AEKLGRPVAILLDLKGPKIRTG 78
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922  122 LIKGsgtAEVELKKGATLKITLDNAYMEKcDENILWLDYKNICKVVDVGSKVYVDDGLISLQVKQKGPDFLVTEVENGGF 201
Cdd:COG0469  79 KFKG---GAVELEKGEKFTLTTDDKVGEG-DEERVSVDYKDLAKDVKPGDRILLDDGKIELRVVEVDGDAVITRVLNGGV 154
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922  202 LGSKKGVNLPGAAVDLPAVSEKDIQDLKFGVEQDVDMVFASFIRKAADVHEVRKILGEK-GKNIKIISKIENHEGVRRFD 280
Cdd:COG0469 155 LSSNKGVNLPGVDLSLPALTEKDKEDLKFGLEQGVDFVALSFVRNAEDVEEVREILAETgGRDVKIIAKIENQEAVDNLD 234
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922  281 EILEASDGIMVARGDLGIEIPAEKVFLAQKMIIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIML 360
Cdd:COG0469 235 EIIEASDGIMVARGDLGVEIPLEEVPIIQKRIIRKARRAGKPVITATQMLESMIENPRPTRAEVSDVANAVLDGTDAVML 314
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922  361 SGETAKGDYPLEAVRMQHLIAREAEAAMFHRKLFEelARSSSHSTDLMEAMAMGSVEASYKCLAAALIVLTESGRSAHQV 440
Cdd:COG0469 315 SGETAAGKYPVEAVATMARIAKEAEKELPDNQLLR--FRVDPPDSSITEAIALAAVDIAEKLDAKAIVTLTESGRTARLL 392
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922  441 ARYRPRAPIIAVTRNHQTARQAHLYRGIFPVVCkdpvqEAWAEDVDLRVNLAMNVGKARGFFKKGDVVIVLTGWRPG-SG 519
Cdd:COG0469 393 SKYRPEAPIIALTPNERVARRLALVWGVYPLLV-----EEKPTSTDEMVEEAVEKLLESGLVKKGDLVVITAGVPMGtVG 467
                       490
                ....*....|
gi 4557922  520 FTNTMRVVPV 529
Cdd:COG0469 468 TTNTIKVLTV 477
PRK05826 PRK05826
pyruvate kinase; Provisional
42-513 0e+00

pyruvate kinase; Provisional


Pssm-ID: 235619 [Multi-domain]  Cd Length: 465  Bit Score: 572.87  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922    42 RNTGIICTIGPASRSVETLKEMIKSGMNVARMNFSHGTHEYHAETIKNVRTATESfasdpiLYRPVAVALDTKGPEIRTG 121
Cdd:PRK05826   4 RRTKIVATLGPASDSPENLEKLIEAGVNVVRLNFSHGSHEEHGKRAALVREIAAK------LGRPVAILLDLKGPKIRVG 77
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922   122 LIKGSgtaEVELKKGAtlKITLDNAYMEKCDENILWLDYKNICKVVDVGSKVYVDDGLISLQVKQKGPDFLVTEVENGGF 201
Cdd:PRK05826  78 KFKEG---KITLKTGD--KFTLDTDQKEEGDKERVGVDYKGLPKDVKPGDILLLDDGKLQLKVVEVDGDEVETEVKNGGP 152
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922   202 LGSKKGVNLPGAAVDLPAVSEKDIQDLKFGVEQDVDMVFASFIRKAADVHEVRKILGEKG-KNIKIISKIENHEGVRRFD 280
Cdd:PRK05826 153 LSNNKGINIPGGGLSLPALTEKDKADIKFAAEQGVDYIAVSFVRSAEDVEEARRLLREAGcPHAKIIAKIERAEAVDNID 232
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922   281 EILEASDGIMVARGDLGIEIPAEKVFLAQKMIIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIML 360
Cdd:PRK05826 233 EIIEASDGIMVARGDLGVEIPDEEVPGLQKKIIRKAREAGKPVITATQMLESMIENPRPTRAEVSDVANAVLDGTDAVML 312
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922   361 SGETAKGDYPLEAVRMQHLIAREAEaAMFHRKLFEElaRSSSHSTDLMEAMAMGSVEASYK-CLAAALIVLTESGRSAHQ 439
Cdd:PRK05826 313 SGETAAGKYPVEAVEAMARICKGAE-KEFSINLSKH--RLDRQFDRIDEAIAMSAMYAANHlKGVKAIVALTESGRTARL 389
                        410       420       430       440       450       460       470
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 4557922   440 VARYRPRAPIIAVTRNHQTARQAHLYRGIFPVvckdPVQEAWAEDVDLRVnlAMNVGKARGFFKKGDVVIVLTG 513
Cdd:PRK05826 390 ISRFRPGAPIFAVTRDEKTQRRLALYRGVYPV----LFDSAADTDDAAEE--ALRLLLEKGLVESGDLVVVTSG 457
 
Name Accession Description Interval E-value
Pyruvate_Kinase cd00288
Pyruvate kinase (PK): Large allosteric enzyme that regulates glycolysis through binding of ...
41-529 0e+00

Pyruvate kinase (PK): Large allosteric enzyme that regulates glycolysis through binding of the substrate, phosphoenolpyruvate, and one or more allosteric effectors. Like other allosteric enzymes, PK has a high substrate affinity R state and a low affinity T state. PK exists as several different isozymes, depending on organism and tissue type. In mammals, there are four PK isozymes: R, found in red blood cells, L, found in liver, M1, found in skeletal muscle, and M2, found in kidney, adipose tissue, and lung. PK forms a homotetramer, with each subunit containing three domains. The T state to R state transition of PK is more complex than in most allosteric enzymes, involving a concerted rotation of all 3 domains of each monomer in the homotetramer.


Pssm-ID: 238178 [Multi-domain]  Cd Length: 480  Bit Score: 821.56  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922   41 ARNTGIICTIGPASRSVETLKEMIKSGMNVARMNFSHGTHEYHAETIKNVRTATESFAsdpilyRPVAVALDTKGPEIRT 120
Cdd:cd00288   1 LRRTKIVCTIGPATDSVENLKKLIKAGMNVARMNFSHGSHEYHQSRIDNVREAAEKTG------GPVAIALDTKGPEIRT 74
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922  121 GLIKGSgtAEVELKKGATLKITLDNAyMEKCDENILWLDYKNICKVVDVGSKVYVDDGLISLQVKQKGPD-FLVTEVENG 199
Cdd:cd00288  75 GLFKGG--KDISLKAGDKFLVTTDPA-AKKGTKEKIYVDYKNLTKDVSPGNTILVDDGLLSLKVLSKDDDkTLVCEVLNG 151
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922  200 GFLGSKKGVNLPGAAVDLPAVSEKDIQDLKFGVEQDVDMVFASFIRKAADVHEVRKILGEKGKNIKIISKIENHEGVRRF 279
Cdd:cd00288 152 GVLGSRKGVNLPGTDVDLPALSEKDKADLRFGVEQGVDMIFASFVRKASDVLEIREVLGEKGKDIKIIAKIENQEGVNNF 231
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922  280 DEILEASDGIMVARGDLGIEIPAEKVFLAQKMIIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIM 359
Cdd:cd00288 232 DEILEASDGIMVARGDLGVEIPAEEVFLAQKMLIAKCNLAGKPVITATQMLESMIYNPRPTRAEVSDVANAVLDGTDCVM 311
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922  360 LSGETAKGDYPLEAVRMQHLIAREAEAAMFHRKLFEELARSSSHSTDLMEAMAMGSVEASYKCLAAALIVLTESGRSAHQ 439
Cdd:cd00288 312 LSGETAKGKYPVEAVKAMARICLEAEKALSHRVLFNEMRRLTPRPTSTTEAVAMSAVRAAFELGAKAIVVLTTSGRTARL 391
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922  440 VARYRPRAPIIAVTRNHQTARQAHLYRGIFPVVCKDPVQEaWAEDVDLRVNLAMNVGKARGFFKKGDVVIVLTGWRPGSG 519
Cdd:cd00288 392 VSKYRPNAPIIAVTRNEQTARQLHLYRGVYPVLFEEPKPG-WQEDTDARLKAAVNVAKEKGLLKKGDLVVVVQGWPVGSG 470
                       490
                ....*....|
gi 4557922  520 FTNTMRVVPV 529
Cdd:cd00288 471 STNTMRILTV 480
pyruv_kin TIGR01064
pyruvate kinase; This enzyme is a homotetramer. Some forms are active only in the presence of ...
42-526 0e+00

pyruvate kinase; This enzyme is a homotetramer. Some forms are active only in the presence of fructose-1,6-bisphosphate or similar phosphorylated sugars. [Energy metabolism, Glycolysis/gluconeogenesis]


Pssm-ID: 273424 [Multi-domain]  Cd Length: 472  Bit Score: 753.35  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922     42 RNTGIICTIGPASRSVETLKEMIKSGMNVARMNFSHGTHEYHAETIKNVRTATESFAsdpilyRPVAVALDTKGPEIRTG 121
Cdd:TIGR01064   1 RRTKIVCTIGPATNSPEMLKKLLDAGMNVARLNFSHGSHEEHGKRIENVREAAEKLG------RPVAILLDTKGPEIRTG 74
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922    122 LIKGSgtaEVELKKGATLKITLDNAYMEkCDENILWLDYKNICKVVDVGSKVYVDDGLISLQVKQKGPDFLVTEVENGGF 201
Cdd:TIGR01064  75 EIKGG---EVKLKKGDKVIITTDDIKGE-GDEEKVYVDYKGLTKDVVEGDKILVDDGKISLVVVSVEGDKVICEVLNGGT 150
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922    202 LGSKKGVNLPGAAVDLPAVSEKDIQDLKFGVEQDVDMVFASFIRKAADVHEVRKILGEKG-KNIKIISKIENHEGVRRFD 280
Cdd:TIGR01064 151 LKSKKGVNLPGADVDLPALSEKDKKDLKFGVEQGVDMVAASFVRTAEDVLEVREVLGEKGaKDVKIIAKIENQEGVDNID 230
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922    281 EILEASDGIMVARGDLGIEIPAEKVFLAQKMIIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIML 360
Cdd:TIGR01064 231 EIAEASDGIMVARGDLGVEIPAEEVPIAQKKMIRKCNRAGKPVITATQMLDSMIKNPRPTRAEVSDVANAVLDGTDAVML 310
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922    361 SGETAKGDYPLEAVRMQHLIAREAEAAMFHRKLFEELARSSSHSTDLMEAMAMGSVEASYKCLAAALIVLTESGRSAHQV 440
Cdd:TIGR01064 311 SGETAKGKYPVEAVQMMAKIAKEAEKALAYLTNFNDRKNSDPKPSTITEAIALSAVEAAEKLDAKAIVVLTESGRTARLL 390
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922    441 ARYRPRAPIIAVTRNHQTARQAHLYRGIFPVVCKDpvqeaWAEDVDLRVNLAMNVGKARGFFKKGDVVIVLTG-WRPGSG 519
Cdd:TIGR01064 391 SKYRPNAPIIAVTPNERVARQLALYWGVFPFLVDE-----EPSDTDARVNKALELLKEKGIVKKGDLVVVIQGgPIGGEG 465

                  ....*..
gi 4557922    520 FTNTMRV 526
Cdd:TIGR01064 466 GTNTIRV 472
PK pfam00224
Pyruvate kinase, barrel domain; This domain of the is actually a small beta-barrel domain ...
41-394 0e+00

Pyruvate kinase, barrel domain; This domain of the is actually a small beta-barrel domain nested within a larger TIM barrel. The active site is found in a cleft between the two domains.


Pssm-ID: 333937  Cd Length: 348  Bit Score: 622.85  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922     41 ARNTGIICTIGPASRSVETLKEMIKSGMNVARMNFSHGTHEYHAETIKNVRTATESFASDpilyrpVAVALDTKGPEIRT 120
Cdd:pfam00224   1 LRRTKIVCTIGPASNSVETLVKLIEAGMNVARMNFSHGSHEYHQSRIDNVREAEEKTGGR------VAIALDTKGPEIRT 74
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922    121 GLIKGsGTAEVELKKGATLKITLDNAYMEKCDENILWLDYKNICKVVDVGSKVYVDDGLISLQVKQKGPDF-LVTEVENG 199
Cdd:pfam00224  75 GNTKD-GADDIELKEGDKMIVSTDEKYKGACDPEIIYVDYKNITKDVSVGRIILVDDGLLSLKVLSKDDDKtLVTEVLNG 153
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922    200 GFLGSKKGVNLPGAAVDLPAVSEKDIQDLKFGVEQDVDMVFASFIRKAADVHEVRKILGEKGKNIKIISKIENHEGVRRF 279
Cdd:pfam00224 154 GVLGSRKGVNLPGTDVDLPALSEKDKADLRFGVKQGVDMIFASFVRKASDVLEIREVLGEAGKNIQIIAKIENQEGVNNF 233
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922    280 DEILEASDGIMVARGDLGIEIPAEKVFLAQKMIIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIM 359
Cdd:pfam00224 234 DEILEASDGIMVARGDLGIEIPAEEVFLAQKMLIAKCNLAGKPVITATQMLESMIYNPRPTRAEVSDVANAVLDGTDCVM 313
                         330       340       350
                  ....*....|....*....|....*....|....*
gi 4557922    360 LSGETAKGDYPLEAVRMQHLIAREAEAAMFHRKLF 394
Cdd:pfam00224 314 LSGETAKGNYPVEAVKTMHEIALEAEKALPHRNLF 348
PykF COG0469
Pyruvate kinase [Carbohydrate transport and metabolism];
42-529 0e+00

Pyruvate kinase [Carbohydrate transport and metabolism];


Pssm-ID: 223545 [Multi-domain]  Cd Length: 477  Bit Score: 620.72  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922   42 RNTGIICTIGPASRSVETLKEMIKSGMNVARMNFSHGTHEYHAETIKNVRTAtesfasDPILYRPVAVALDTKGPEIRTG 121
Cdd:COG0469   5 RKTKIVATLGPATESEEMLEKLIEAGMNVVRLNFSHGDHEEHKKRIDNVREA------AEKLGRPVAILLDLKGPKIRTG 78
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922  122 LIKGsgtAEVELKKGATLKITLDNAYMEKcDENILWLDYKNICKVVDVGSKVYVDDGLISLQVKQKGPDFLVTEVENGGF 201
Cdd:COG0469  79 KFKG---GAVELEKGEKFTLTTDDKVGEG-DEERVSVDYKDLAKDVKPGDRILLDDGKIELRVVEVDGDAVITRVLNGGV 154
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922  202 LGSKKGVNLPGAAVDLPAVSEKDIQDLKFGVEQDVDMVFASFIRKAADVHEVRKILGEK-GKNIKIISKIENHEGVRRFD 280
Cdd:COG0469 155 LSSNKGVNLPGVDLSLPALTEKDKEDLKFGLEQGVDFVALSFVRNAEDVEEVREILAETgGRDVKIIAKIENQEAVDNLD 234
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922  281 EILEASDGIMVARGDLGIEIPAEKVFLAQKMIIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIML 360
Cdd:COG0469 235 EIIEASDGIMVARGDLGVEIPLEEVPIIQKRIIRKARRAGKPVITATQMLESMIENPRPTRAEVSDVANAVLDGTDAVML 314
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922  361 SGETAKGDYPLEAVRMQHLIAREAEAAMFHRKLFEelARSSSHSTDLMEAMAMGSVEASYKCLAAALIVLTESGRSAHQV 440
Cdd:COG0469 315 SGETAAGKYPVEAVATMARIAKEAEKELPDNQLLR--FRVDPPDSSITEAIALAAVDIAEKLDAKAIVTLTESGRTARLL 392
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922  441 ARYRPRAPIIAVTRNHQTARQAHLYRGIFPVVCkdpvqEAWAEDVDLRVNLAMNVGKARGFFKKGDVVIVLTGWRPG-SG 519
Cdd:COG0469 393 SKYRPEAPIIALTPNERVARRLALVWGVYPLLV-----EEKPTSTDEMVEEAVEKLLESGLVKKGDLVVITAGVPMGtVG 467
                       490
                ....*....|
gi 4557922  520 FTNTMRVVPV 529
Cdd:COG0469 468 TTNTIKVLTV 477
PRK05826 PRK05826
pyruvate kinase; Provisional
42-513 0e+00

pyruvate kinase; Provisional


Pssm-ID: 235619 [Multi-domain]  Cd Length: 465  Bit Score: 572.87  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922    42 RNTGIICTIGPASRSVETLKEMIKSGMNVARMNFSHGTHEYHAETIKNVRTATESfasdpiLYRPVAVALDTKGPEIRTG 121
Cdd:PRK05826   4 RRTKIVATLGPASDSPENLEKLIEAGVNVVRLNFSHGSHEEHGKRAALVREIAAK------LGRPVAILLDLKGPKIRVG 77
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922   122 LIKGSgtaEVELKKGAtlKITLDNAYMEKCDENILWLDYKNICKVVDVGSKVYVDDGLISLQVKQKGPDFLVTEVENGGF 201
Cdd:PRK05826  78 KFKEG---KITLKTGD--KFTLDTDQKEEGDKERVGVDYKGLPKDVKPGDILLLDDGKLQLKVVEVDGDEVETEVKNGGP 152
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922   202 LGSKKGVNLPGAAVDLPAVSEKDIQDLKFGVEQDVDMVFASFIRKAADVHEVRKILGEKG-KNIKIISKIENHEGVRRFD 280
Cdd:PRK05826 153 LSNNKGINIPGGGLSLPALTEKDKADIKFAAEQGVDYIAVSFVRSAEDVEEARRLLREAGcPHAKIIAKIERAEAVDNID 232
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922   281 EILEASDGIMVARGDLGIEIPAEKVFLAQKMIIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIML 360
Cdd:PRK05826 233 EIIEASDGIMVARGDLGVEIPDEEVPGLQKKIIRKAREAGKPVITATQMLESMIENPRPTRAEVSDVANAVLDGTDAVML 312
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922   361 SGETAKGDYPLEAVRMQHLIAREAEaAMFHRKLFEElaRSSSHSTDLMEAMAMGSVEASYK-CLAAALIVLTESGRSAHQ 439
Cdd:PRK05826 313 SGETAAGKYPVEAVEAMARICKGAE-KEFSINLSKH--RLDRQFDRIDEAIAMSAMYAANHlKGVKAIVALTESGRTARL 389
                        410       420       430       440       450       460       470
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 4557922   440 VARYRPRAPIIAVTRNHQTARQAHLYRGIFPVvckdPVQEAWAEDVDLRVnlAMNVGKARGFFKKGDVVIVLTG 513
Cdd:PRK05826 390 ISRFRPGAPIFAVTRDEKTQRRLALYRGVYPV----LFDSAADTDDAAEE--ALRLLLEKGLVESGDLVVVTSG 457
PLN02461 PLN02461
Probable pyruvate kinase
44-511 0e+00

Probable pyruvate kinase


Pssm-ID: 215255 [Multi-domain]  Cd Length: 511  Bit Score: 529.16  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922    44 TGIICTIGPASRSVETLKEMIKSGMNVARMNFSHGTHEYHAETIKNVRTATesfASDPILyrpVAVALDTKGPEIRTGLI 123
Cdd:PLN02461  23 TKIVCTLGPASRSVPMLEKLLRAGMNVARFNFSHGSHEYHQETLDNLRQAM---ANTGIL---CAVMLDTKGPEIRTGFL 96
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922   124 KGSGTaeVELKKGATLKITLDnaYMEKCDENILWLDYKNICKVVDVGSKVYVDDGLISLQV----KQKGpdfLVT-EVEN 198
Cdd:PLN02461  97 KDGKP--VQLKQGQEITITTD--YSIKGDENMIAMSYKKLAVDVKPGSVILCADGTITLTVlscdVEAG---TVRcRCEN 169
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922   199 GGFLGSKKGVNLPGAAVDLPAVSEKDIQD-LKFGVEQDVDMVFASFIRKAADVHEVRKILGEKGKNIKIISKIENHEGVR 277
Cdd:PLN02461 170 SAMLGERKNVNLPGVVVDLPTLTEKDKEDiLQWGVPNKIDFIALSFVRKGSDLVEVRKVLGEHAKSILLISKVENQEGLD 249
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922   278 RFDEILEASDGIMVARGDLGIEIPAEKVFLAQKMIIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADC 357
Cdd:PLN02461 250 NFDDILAESDAFMVARGDLGMEIPIEKIFLAQKMMIYKCNLAGKPVVTATQMLESMIKSPRPTRAEATDVANAVLDGTDC 329
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922   358 IMLSGETAKGDYPLEAVRMQHLIAREAEAAMFHRKLFEELARSSSHSTDLMEAMAMGSVEASYKCLAAALIVLTESGRSA 437
Cdd:PLN02461 330 VMLSGETAAGAYPELAVKTMARICREAEASLDYGALFKEIMRSAPLPMSPLESLASSAVRTANKVKASLIVVLTRGGTTA 409
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922   438 HQVARYRPRAPIIAV-----TRNHQT--------ARQAHLYRGIFPVVCKDPVQEAWAEDVDLRVNLAMNVGKARGFFKK 504
Cdd:PLN02461 410 RLVAKYRPAVPILSVvvpeiTTDSFDwscsdeapARHSLIYRGLIPVLAEGSAKATDSESTEEILEAAIEHAKKKGLCKP 489

                 ....*..
gi 4557922   505 GDVVIVL 511
Cdd:PLN02461 490 GDSVVAL 496
PRK09206 PRK09206
pyruvate kinase; Provisional
42-526 0e+00

pyruvate kinase; Provisional


Pssm-ID: 181699 [Multi-domain]  Cd Length: 470  Bit Score: 528.86  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922    42 RNTGIICTIGPASRSVETLKEMIKSGMNVARMNFSHGTHEYHAETIKNVRTATESFAsdpilyRPVAVALDTKGPEIRTg 121
Cdd:PRK09206   2 KKTKIVCTIGPKTESEEMLTKLLDAGMNVMRLNFSHGDYAEHGQRIKNLRNVMSKTG------KKAAILLDTKGPEIRT- 74
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922   122 lIKGSGTAEVELKKGATLKITLDNAYMEkcDENILWLDYKNICKVVDVGSKVYVDDGLISLQVKQKGPDFLVTEVENGGF 201
Cdd:PRK09206  75 -MKLEGGNDVSLKAGQTFTFTTDKSVVG--NKERVAVTYEGFTADLSVGNTVLVDDGLIGMEVTAITGNEVICKVLNNGD 151
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922   202 LGSKKGVNLPGAAVDLPAVSEKDIQDLKFGVEQDVDMVFASFIRKAADVHEVRKILGE-KGKNIKIISKIENHEGVRRFD 280
Cdd:PRK09206 152 LGENKGVNLPGVSIALPALAEKDKQDLIFGCEQGVDFVAASFIRKRSDVLEIREHLKAhGGENIQIISKIENQEGLNNFD 231
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922   281 EILEASDGIMVARGDLGIEIPAEKVFLAQKMIIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIML 360
Cdd:PRK09206 232 EILEASDGIMVARGDLGVEIPVEEVIFAQKMMIEKCNRARKVVITATQMLDSMIKNPRPTRAEAGDVANAILDGTDAVML 311
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922   361 SGETAKGDYPLEAVRMQHLIAREAEAAMfHRKLFEELArssSHSTDLMEAMAMGSVEASYKcLAAALIVL-TESGRSAHQ 439
Cdd:PRK09206 312 SGESAKGKYPLEAVSIMATICERTDRVM-NSRLESNND---NRKLRITEAVCRGAVETAEK-LDAPLIVVaTQGGKSARS 386
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922   440 VARYRPRAPIIAVTRNHQTARQAHLYRGIFPVVCKDPvqeawaEDVDLRVNLAMNVGKARGFFKKGDVVIVLTGWRPGSG 519
Cdd:PRK09206 387 VRKYFPDATILALTTNEKTARQLVLSKGVVPQLVKEI------ASTDDFYRLGKELALQSGLAQKGDVVVMVSGALVPSG 460

                 ....*..
gi 4557922   520 FTNTMRV 526
Cdd:PRK09206 461 TTNTASV 467
PRK06354 PRK06354
pyruvate kinase; Provisional
29-526 9.30e-177

pyruvate kinase; Provisional


Pssm-ID: 235784 [Multi-domain]  Cd Length: 590  Bit Score: 510.24  E-value: 9.30e-177
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922    29 MCRLDidsapiTARNTGIICTIGPASRSVETLKEMIKSGMNVARMNFSHGTHEYHAETIKNVRTATEsfasdpILYRPVA 108
Cdd:PRK06354   1 MSLRD------LMRRTKIVATIGPASESPEKLRQLIEAGATTARLNFSHGDHEEHGARIKNIREASK------KLGKTVG 68
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922   109 VALDTKGPEIRTGLIKGSGtaeVELKKGATLKITLDNAymeKCDENILWLDYKNICKVVDVGSKVYVDDGLISLQVKQKG 188
Cdd:PRK06354  69 ILQDLQGPKIRLGRFEDGP---IELKTGDEFILTSREV---LGTQEKFSVTYDGLADEVPVGSRILLDDGLIELEVEEVD 142
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922   189 PD--FLVTEVENGGFLGSKKGVNLPGAAVDLPAVSEKDIQDLKFGVEQDVDMVFASFIRKAADVHEVRKILGEK-GKNIK 265
Cdd:PRK06354 143 KAdgELHCKVLVGGVLSNKKGVNFPGVSLSLPAITEKDREDLIFGLEQGVDWIALSFVRNPSDVLEIRELIEEHnGKHIP 222
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922   266 IISKIENHEGVRRFDEILEASDGIMVARGDLGIEIPAEKVFLAQKMIIGRCNRAGKPVICATQMLESMIKKPRPTRAEGS 345
Cdd:PRK06354 223 IIAKIEKQEAIDNIDAILELCDGLMVARGDLGVEIPAEEVPLLQKRLIKKANRLGKPVITATQMLDSMQRNPRPTRAEAS 302
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922   346 DVANAVLDGADCIMLSGETAKGDYPLEAVRMQHLIAREAEAAMFHRKLFEELARSSSHSTDLMEAmAMGSVEASYKclAA 425
Cdd:PRK06354 303 DVANAILDGTDAVMLSNETAAGDYPVEAVQTMATIAVRIEKDLPYRDILSKRPEFTTTITNAISQ-AVSHIALQLD--AA 379
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922   426 ALIVLTESGRSAHQVARYRPRAPIIAVTRNHQTARQAHLYRGIFPVVCKDpvqeawAEDVDLRVNLAMNVGKARGFFKKG 505
Cdd:PRK06354 380 AIVTLTKSGATARNVSKYRPKTPILAVTPNESVARRLQLVWGVTPLLVLD------APSTDETFDAAINVAQESGLLKQG 453
                        490       500
                 ....*....|....*....|..
gi 4557922   506 DVVIVLTGWRPG-SGFTNTMRV 526
Cdd:PRK06354 454 DLVVITAGTLVGeSGSTDLMKV 475
PTZ00300 PTZ00300
pyruvate kinase; Provisional
68-529 1.77e-170

pyruvate kinase; Provisional


Pssm-ID: 140321 [Multi-domain]  Cd Length: 454  Bit Score: 489.56  E-value: 1.77e-170
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922    68 MNVARMNFSHGTHEYHAETIKNVRTATESFASDpilyrpVAVALDTKGPEIRTGLIKGSGTAeveLKKGATLKITLDNAY 147
Cdd:PTZ00300   1 MSVARMNFSHGSHEYHQTTINNVRQAAAELGVN------IAIALDTKGPEIRTGLFVGGEAV---MERGATCYVTTDPAF 71
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922   148 MEKCDENILWLDYKNICKVVDVGSKVYVDDGLISLQVKQKGPDF-LVTEVENGGFLGSKKGVNLPGAAVDLPAVSEKDIQ 226
Cdd:PTZ00300  72 ADKGTKDKFYIDYQNLSKVVRPGGYIYIDDGILILHVQSHEDEQtLKCTVTNAHTISDRRGVNLPGCDVDLPAVSAKDCA 151
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922   227 DLKFGVEQDVDMVFASFIRKAADVHEVRKILGEKGKNIKIISKIENHEGVRRFDEILEASDGIMVARGDLGIEIPAEKVF 306
Cdd:PTZ00300 152 DLQFGVEQGVDMIFASFIRSAEQVGEVRKALGAKGGDIMIICKIENHQGVQNIDSIIEESDGIMVARGDLGVEIPAEKVV 231
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922   307 LAQKMIIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRMQHLIAREAEA 386
Cdd:PTZ00300 232 VAQKILISKCNVAGKPVICATQMLESMTYNPRPTRAEVSDVANAVFNGADCVMLSGETAKGKYPNEVVQYMARICLEAQS 311
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922   387 AMFHRKLFEELARSSSHSTDLMEAMAMGSVEASYKCLAAALIVLTESGRSAHQVARYRPRAPIIAVTRNHQTARQAHLYR 466
Cdd:PTZ00300 312 AVNEYVFFNSIKKLQPIPMSAEEAVCSSAVNSVYETKAKALVVLSNTGRSARLVAKYRPNCPIVCVTTRLQTCRQLNITQ 391
                        410       420       430       440       450       460
                 ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 4557922   467 GIFPVVCkDPVQEAWAEDVDLRVNLAMNVGKARGFFKKGDVVIVLTGWRPGSGFTNTMRVVPV 529
Cdd:PTZ00300 392 GVESVFF-DAERLGHDEGKEQRVAMGVGFAKSKGYVQSGDLMVVVHADHKVKGYANQTRIILV 453
PTZ00066 PTZ00066
pyruvate kinase; Provisional
12-530 2.36e-170

pyruvate kinase; Provisional


Pssm-ID: 173361 [Multi-domain]  Cd Length: 513  Bit Score: 491.20  E-value: 2.36e-170
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922    12 IQTQQLHAAmADTFLEHMCRlDIDSAPITARNTGIICTIGPASRSVETLKEMIKSGMNVARMNFSHGTHEYHAETIKNVR 91
Cdd:PTZ00066  10 VMGCSLGKA-TNISLDKILE-PISDNDLRQKKTHIVCTMGPACKNVETLVKLIDAGMNICRFNFSHGDHESHKKTLNNVR 87
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922    92 TATESfasdpilyRP---VAVALDTKGPEIRTGLIKGSgtAEVELKKGATLKITLDnaYMEKCDENILWLDYKNICKVVD 168
Cdd:PTZ00066  88 EAAKA--------RPnanLGILLDTKGPEIRTGFLKNH--KPITLKEGQTLKITTD--YTFLGDETCISCSYKKLPQSVK 155
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922   169 VGSKVYVDDGLISLQVKQKGPDFLVTEVENGGFLGSKKGVNLPGAAVDLPAVSEKDIQD-LKFGVEQDVDMVFASFIRKA 247
Cdd:PTZ00066 156 VGNIILIADGSLSCKVLEVHDDYIITKVLNNATIGERKNMNLPGVKVELPVIGEKDKNDiLNFAIPMGCDFIALSFVQSA 235
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922   248 ADVHEVRKILGEKGKNIKIISKIENHEGVRRFDEILEASDGIMVARGDLGIEIPAEKVFLAQKMIIGRCNRAGKPVICAT 327
Cdd:PTZ00066 236 DDVRLCRQLLGERGRHIKIIPKIENIEGLINFDEILAESDGIMVARGDLGMEIPPEKVFLAQKMMISKCNVAGKPVITAT 315
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922   328 QMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRMQHLIAREAEAAMFHRKLFEELARSSSHSTDL 407
Cdd:PTZ00066 316 QMLESMIKNPRPTRAESTDVANAVLDGTDCVMLSGETANGKFPVEAVNIMAKICFEAETCIDYRVLYHAIHLAVPTPVSV 395
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922   408 MEAMAMGSVEASYKCLAAALIVLTESGRSAHQVARYRPRAPIIAVTRNHQTARQAHLYRGIfPVVCKDPVQeawaeDVDL 487
Cdd:PTZ00066 396 QEAVARSAVETAEDINAKLIIALTETGNTARLISKYRPSCTILALSASPSVVKSLSVARGV-TTYVVNSFQ-----GTDV 469
                        490       500       510       520
                 ....*....|....*....|....*....|....*....|....
gi 4557922   488 RVNLAMNVGKARGFFKKGDVVIVLTGWRPG-SGFTNTMRVVPVP 530
Cdd:PTZ00066 470 VIRNAIALAKERGLVESGDSAIAVHGVKEEvAGSSNLMKVVKIP 513
PRK06247 PRK06247
pyruvate kinase; Provisional
41-526 5.32e-153

pyruvate kinase; Provisional


Pssm-ID: 180487 [Multi-domain]  Cd Length: 476  Bit Score: 445.52  E-value: 5.32e-153
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922    41 ARNTGIICTIGPASRSVETLKEMIKSGMNVARMNFSHGTHEYHAETIKNVRTATESfasdpiLYRPVAVALDTKGPEIRT 120
Cdd:PRK06247   4 NRRVKILATLGPASSSEDMIRKLVEAGADVFRLNFSHGDHDDHRELYKRIREVEDE------TGRPIGILADLQGPKLRL 77
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922   121 GLIKGSgtaEVELKKGATLKITLDNAymeKCDENILWLDYKNICKVVDVGSKVYVDDGLISLQVKQKGPDFLVTEVENGG 200
Cdd:PRK06247  78 GRFADG---KVQLANGQTFRLDVDDA---PGDHDRVSLPHPEIAAALKPGDRLLVDDGKVRLVVEACDGDDVVCRVVEGG 151
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922   201 FLGSKKGVNLPGAAVDLPAVSEKDIQDLKFGVEQDVDMVFASFIRKAADVHEVRKILGEKgknIKIISKIENHEGVRRFD 280
Cdd:PRK06247 152 PVSDRKGVSLPGTVLSVSALTEKDRADLEFALELGVDWVALSFVQRPEDVEEVRKIIGGR---VPVMAKIEKPQAIDRLE 228
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922   281 EILEASDGIMVARGDLGIEIPAEKVFLAQKMIIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIML 360
Cdd:PRK06247 229 AIVEASDAIMVARGDLGVEVPLEQVPLIQKRIIRAARRAGKPVVVATQMLESMIENPVPTRAEVSDVATAVLDGADAVML 308
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922   361 SGETAKGDYPLEAVRMQHLIAREAEAAMFHRKLFeELARSSSHSTdLMEAMAMGSVEASYKCLAAALIVLTESGRSAHQV 440
Cdd:PRK06247 309 SAETASGKYPVEAVRTMARIIRQVERDPTYPPLI-HAQRPQPEAT-KRDAISYAARDIAERLDLAALVAYTSSGDTALRA 386
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922   441 ARYRPRAPIIAVTRNHQTARQAHLYRGIFPVVCKDpvqeawAEDVDLRVNLAMNVGKARGFFKKGDVVIVLTGWRPG-SG 519
Cdd:PRK06247 387 ARERPPLPILALTPNPETARRLALTWGVHCVVVDD------ARDTDDMVRRADRIALAEGFYKRGDRVVIVAGVPPGtPG 460

                 ....*..
gi 4557922   520 FTNTMRV 526
Cdd:PRK06247 461 STNMLRI 467
PLN02765 PLN02765
pyruvate kinase
44-510 3.09e-117

pyruvate kinase


Pssm-ID: 215409  Cd Length: 526  Bit Score: 355.90  E-value: 3.09e-117
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922    44 TGIICTIGPASRSVETLKEMIKSGMNVARMNFSHGTHEYHAETIKNVRTATESfasdpiLYRPVAVALDTKGPEIRtglI 123
Cdd:PLN02765  30 TKIVGTLGPKSRSVEVIEACLKAGMSVARFDFSWGDAEYHQETLENLKIAVKN------TKKLCAVMLDTVGPELQ---V 100
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922   124 KGSGTAEVELKKGATLKITLDNayMEKCDENILWLDYKNICKVVDVGSKVYVDDGLIS--------LQVKQ-KGPDfLVT 194
Cdd:PLN02765 101 INKTEKPISLKAGNTVTLTPDQ--SKEASSEVLPINFPGLAKAVKPGDTIFVGQYLFTgsettsvwLEVDEvKGDD-VVC 177
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922   195 EVENGGFL-GSKKGVNLPGAAVDLPAVSEKDIQDLK-FGVEQDVDMVFASFIRKAADVHEVRKILGEKG-KNIKIISKIE 271
Cdd:PLN02765 178 TVKNSATLaGSLFTLHVSQVRIDLPTLSEKDKEVIStWGVPNKIDFLSLSYTRHAEDVREAREFLSSLGlSQTQIFAKIE 257
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922   272 NHEGVRRFDEILEASDGIMVARGDLGIEIPAEKVFLAQKMIIGRCNRAGKPVIcATQMLESMIKKPRPTRAEGSDVANAV 351
Cdd:PLN02765 258 NVEGLTHFDEILQEADGIILSRGNLGIDLPPEKVFLFQKAALYKCNMAGKPAV-VTRVVDSMTDNLRPTRAEATDVANAV 336
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922   352 LDGADCIMLSGETAKGDYPLEAVRMQHLIAREAEA----AMFHRKLFEELARSSSHStdlmEAMAMGSVEASYKCLAAAL 427
Cdd:PLN02765 337 LDGADAILLGAETLRGLYPVETISTVGRICAEAEKvfnqDLYFKKTVKYVGEPMSHL----ESIASSAVRAAIKVKASVI 412
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922   428 IVLTESGRSAHQVARYRPRAPIIAV-----TRNH--------QTARQAHLYRGIFPVVCkDPVQEA----WAEDVDLRVn 490
Cdd:PLN02765 413 IVFTSSGRAARLIAKYRPTMPVLSVviprlKTNQlkwsftgaFQARQCLIVRGLFPMLA-DPRHSAestsATNESVLKV- 490
                        490       500
                 ....*....|....*....|
gi 4557922   491 lAMNVGKARGFFKKGDVVIV 510
Cdd:PLN02765 491 -ALDHGKAAGVIKSHDRVVV 509
PLN02623 PLN02623
pyruvate kinase
36-516 2.25e-110

pyruvate kinase


Pssm-ID: 215334 [Multi-domain]  Cd Length: 581  Bit Score: 339.98  E-value: 2.25e-110
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922    36 SAPITARNTGIICTIGPASRSVETLKEMIKSGMNVARMNFSHGTHEYHAETIKNVRTATESFASDPIlyrpvAVALDTKG 115
Cdd:PLN02623 104 SKPSVRRKTKIVCTIGPSTNTREMIWKLAEAGMNVARLNMSHGDHASHQKVIDLVKEYNAQSKDNVI-----AIMLDTKG 178
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922   116 PEIRTGLIKgsgtAEVELKKGATLKITLDNAY-MEKCdeniLWLDYKNICKVVDVGSKVYVDDGLISLQVKQKGPDFLVT 194
Cdd:PLN02623 179 PEVRSGDLP----QPIMLEEGQEFTFTIKRGVsTEDC----VSVNYDDFVNDVEVGDMLLVDGGMMSLAVKSKTSDSVKC 250
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922   195 EVENGGFLGSKKGVNLPGAAVDLPAVSEKDIQDLKFGVEQDVDMVFASFIRKAADVHEVRKILGEKGKNIKIISKIENHE 274
Cdd:PLN02623 251 EVVDGGELKSRRHLNVRGKSATLPSITEKDWEDIKFGVENKVDFYAVSFVKDAQVVHELKDYLKSCNADIHVIVKIESAD 330
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922   275 GVRRFDEILEASDGIMVARGDLGIEIPAEKVFLAQKMIIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDG 354
Cdd:PLN02623 331 SIPNLHSIITASDGAMVARGDLGAELPIEEVPLLQEEIIRRCRSMGKPVIVATNMLESMIVHPTPTRAEVSDIAIAVREG 410
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922   355 ADCIMLSGETAKGDYPLEAVRMQHLIAREAEAAMFHRKLFEELARSSSHSTDLM---EAMAMGSVeasykcLAAALIVLT 431
Cdd:PLN02623 411 ADAVMLSGETAHGKFPLKAVKVMHTVALRTEATLPEGTTPPNLGQAFKNHMSEMfafHATMMANT------LGTSIIVFT 484
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922   432 ESGRSAHQVARYRPRAPIIAVTRNHQTARQAHLYRGIFPVVCKdpvqeaWAEDVDLRVNLAMNVGKARGFFKKGD-VVIV 510
Cdd:PLN02623 485 RTGFMAILLSHYRPSGTIFAFTNEKRIQQRLALYQGVCPIYMQ------FSDDAEETFARALSLLLNKGMVKEGEeVALV 558

                 ....*.
gi 4557922   511 LTGWRP 516
Cdd:PLN02623 559 QSGRQP 564
PRK06739 PRK06739
pyruvate kinase; Validated
47-385 1.71e-99

pyruvate kinase; Validated


Pssm-ID: 180676  Cd Length: 352  Bit Score: 304.17  E-value: 1.71e-99
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922    47 ICTIGPASRSVETLKEMIKSGMNVARMNFSHGTHEYHAETIKNVRTATESfasdpilyrpVAVALDTKGPEIRTGLIKGS 126
Cdd:PRK06739   6 ICTIGPASNNKETLAQLINNGMKIVRLNLSHGTHESHKDIIRLVKSLDDS----------IKILGDVQGPKIRLGEIKGE 75
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922   127 gtaEVELKKGATLKITLDNAYMEKCDENIlwlDYKNICKVVDVGSKVYVDDGLISLQVKQKGPDFLVTEVENGGFLGSKK 206
Cdd:PRK06739  76 ---QITLQAGDSFILHTQPVTGSSTEASV---DYEGIANDVKVGSRILMNDGEVELIVEKVSTDKIETKVKTGGNISSHK 149
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922   207 GVNLPGAAVDLPAVSEKDIQDLKFGVEQDVDMVFASFIRKAADVHEVRKILGEKGKNI-KIISKIENHEGVRRFDEILEA 285
Cdd:PRK06739 150 GVNLPGAIVRLPAITEKDKKDIQFLLEEDVDFIACSFVRKPSHIKEIRDFIQQYKETSpNLIAKIETMEAIENFQDICKE 229
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922   286 SDGIMVARGDLGIEIPAEKVFLAQKMIIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETA 365
Cdd:PRK06739 230 ADGIMIARGDLGVELPYQFIPLLQKMMIQECNRTNTYVITATQMLQSMVDHSIPTRAEVTDVFQAVLDGTNAVMLSAESA 309
                        330       340
                 ....*....|....*....|
gi 4557922   366 KGDYPLEAVRMQHLIAREAE 385
Cdd:PRK06739 310 SGEHPIESVSTLRLVSEFAE 329
PLN02762 PLN02762
pyruvate kinase complex alpha subunit
41-530 2.31e-90

pyruvate kinase complex alpha subunit


Pssm-ID: 215407 [Multi-domain]  Cd Length: 509  Bit Score: 285.87  E-value: 2.31e-90
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922    41 ARNTGIICTIGPASRSVETLKEMIKSGMNVARMNFSHGTHEYHAETIKNVR--TATESFAsdpilyrpVAVALDTKGPEI 118
Cdd:PLN02762  24 TRRTKLVCTIGPACCGFEQLEALAMGGMNVARLNMCHGTREWHRDVIRRVRrlNEEKGFA--------VAVMMDTEGSEI 95
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922   119 RTGLIKGSGTAEVElkKGATLKITLdNAYMEKCDENILWLDYKNICKVVDVGSKVYVDDGLISLQVKQK-GPDFLVTEVE 197
Cdd:PLN02762  96 HMGDLGGASSAKAE--DGEEWTFTV-RKFDGSRPEFTIQVNYDGFAEDVKVGDELVVDGGMVRFEVIEKiGPDVKCKCTD 172
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922   198 NGGFLGSKK------GVNLPGAAVDLPAVSEKDIQDLKFGVEQDVDMVFASFIRKAADVHEVRKILGEKGKN--IKIISK 269
Cdd:PLN02762 173 PGLLLPRANltfwrdGSLVRERNAMLPTISSKDWLDIDFGISEGVDFIAVSFVKSAEVIKHLKSYIAARSRDsdIGVIAK 252
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922   270 IENHEGVRRFDEILEASDGIMVARGDLGIEIPAEKVFLAQKMIIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVAN 349
Cdd:PLN02762 253 IESLDSLKNLEEIIRASDGAMVARGDLGAQIPLEQVPSVQEKIVRLCRQLNKPVIVASQLLESMIEYPTPTRAEVADVSE 332
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922   350 AVLDGADCIMLSGETAKGDYPLEAV--------RMQHLIAREAEAAMFHRKlfeELARSSSHSTDlmEAMAMGSVEASYK 421
Cdd:PLN02762 333 AVRQRADALMLSGESAMGLYPEKALsvlrsvslRMELWSREEKRHEALELP---QLSSSLSDRIS--EEICNSAAKMANN 407
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922   422 CLAAALIVLTESGRSAHQVARYRPRAPIIAVTRNHQTARQAHLYRGIFpvvckdPVQEAWAEDVDLRVNLAMNVGKARGF 501
Cdd:PLN02762 408 LGVDAIFVYTKHGHMASLLSRNRPDCPIFAFTDTTSVRRRLNLQWGLI------PFRLDFSDDMESNLNKTFSLLKARGM 481
                        490       500
                 ....*....|....*....|....*....
gi 4557922   502 FKKGDVVIVLTGWRPgSGFTNTMRVVPVP 530
Cdd:PLN02762 482 IKSGDLVIAVSDLTP-SSMLQSIQVRNVP 509
PRK08187 PRK08187
pyruvate kinase; Validated
37-377 1.12e-51

pyruvate kinase; Validated


Pssm-ID: 236178  Cd Length: 493  Bit Score: 183.29  E-value: 1.12e-51
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922    37 APITARNTGIICTI-GPASRSVETLKEMIKSGMNVARMNFSHGTHEYHAETIKNVRTATESFAsdpilyRPVAVALDTKG 115
Cdd:PRK08187 128 PRPAARRTRIMVTLpSEAADDPDFVLRLAERGMDCARINCAHDDPAAWQAMIGHLRQAERATG------RRCKILMDLAG 201
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922   116 PEIRTGLIKGsGTAEVELKKGATLKITLDNAyMEKCDENILWLDykniCKV------VDVGSKVYVDDGLISLQVKQKGP 189
Cdd:PRK08187 202 PKIRTGAVAG-PLGKTRLYTGDRLALVAQGP-PRRIDEEHFQVT----CTLpeilarLAVGARVWIDDGKLGARVERVGP 275
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922   190 DFLVTEV----ENGGFLGSKKGVNLPGAAVDLPAVSEKDIQDLKFGVEQdVDMVFASFIRKAADVHEVRKILGEKGKN-- 263
Cdd:PRK08187 276 GGALLEVtharPKGLKLKPEKGLNFPDTALDLPALTEKDRADLDFVARH-ADLVGYSFVQSPGDVEALQAALAARRPDdw 354
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922   264 --IKIISKIENHEGVRRFDEILEASDG-----IMVARGDLGIEIPAEKVFLAQKMIIGRCNRAGKPVICATQMLESMIKK 336
Cdd:PRK08187 355 rkLGLVLKIETPRAVANLPELIVQAAGrqpfgVMIARGDLAVEIGFERLAEMQEEILWLCEAAHVPVIWATQVLEGLVKK 434
                        330       340       350       360
                 ....*....|....*....|....*....|....*....|....*....
gi 4557922   337 PRPTRAEGSDVANAvlDGADCIMLSgetaKGDYPLEAV--------RMQ 377
Cdd:PRK08187 435 GLPSRAEMTDAAMA--ARAECVMLN----KGPYLVEAVtflddllaRMD 477
PRK14725 PRK14725
pyruvate kinase; Provisional
167-399 4.19e-40

pyruvate kinase; Provisional


Pssm-ID: 237804  Cd Length: 608  Bit Score: 153.18  E-value: 4.19e-40
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922   167 VDVGSKVYVDDGLISLQVKQKGPDFLVTEVENGGFLGSK----KGVNLPGAAVDLPAVSEKDIQDLKFGVEQdVDMVFAS 242
Cdd:PRK14725 373 ARVGERVWFDDGKIGAVVVKVEADEVELRITHARPGGSKlkagKGINLPDSHLPLPALTDKDLEDLAFVAKH-ADIVALS 451
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922   243 FIRKAADVHEVRKILGE-KGKNIKIISKIENHEGVRRFDEI-LEA----SDGIMVARGDLGIEIPAEKVFLAQKMIIGRC 316
Cdd:PRK14725 452 FVRSPEDVRLLLDALEKlGADDLGVVLKIETRRAFENLPRIlLEAmrhpRFGVMIARGDLAVEVGFERLAEVQEEILWLC 531
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922   317 NRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLdgADCIMLSgetaKGDYPLEAVRMQHLIAREAEAamFHRKLFEE 396
Cdd:PRK14725 532 EAAHVPVIWATQVLESLAKKGLPSRAEITDAAMALR--AECVMLN----KGPHIVEAVRVLDDILRRMEE--HQRKKRSL 603

                 ...
gi 4557922   397 LAR 399
Cdd:PRK14725 604 LRR 606
PK_C pfam02887
Pyruvate kinase, alpha/beta domain; As well as being found in pyruvate kinase this family is ...
409-527 9.70e-40

Pyruvate kinase, alpha/beta domain; As well as being found in pyruvate kinase this family is found as an isolated domain in some bacterial proteins.


Pssm-ID: 335141 [Multi-domain]  Cd Length: 114  Bit Score: 139.90  E-value: 9.70e-40
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557922    409 EAMAMGSVEASYKCLAAALIVLTESGRSAHQVARYRPRAPIIAVTRNHQTARQAHLYRGIFPVVCKDpvqeawAEDVDLR 488
Cdd:pfam02887   1 EAIAHAAVEAANELGAKAIVVLTESGYTARLVSRYRPGVPIIAVTPNELTARQLALYWGVYPVLFDK------AESTDEL 74
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|
gi 4557922    489 VNLAMNVGKARGFFKKGDVVIVLTGWRPG-SGFTNTMRVV 527
Cdd:pfam02887  75 LRLAVKVAKEAGLIKKGDLVVITAGVPVGvSGTTNTLKVI 114
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.17
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH