NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|470252872|ref|XP_004359533|]
View 

Protein Classification

SEC14 family lipid-binding protein (domain architecture ID 10661233)

SEC14 family lipid-binding protein contains a lipid-binding domain that is found in secretory proteins and in lipid regulated proteins; similar to Homo sapiens SEC14-like protein 6, clavesin-1 and alpha-tocopherol transfer protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
CRAL_TRIO pfam00650
CRAL/TRIO domain;
90-234 1.25e-47

CRAL/TRIO domain;


:

Pssm-ID: 395525  Cd Length: 152  Bit Score: 154.73  E-value: 1.25e-47
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 470252872   90 SGKSFFHGTDKEGRPVCIVRTRKHDGTNRDIDEAQRYCVYVMESGKQMLK-PGIETCTLIFDMSSFSTKNMD---YPLVK 165
Cdd:pfam00650   1 GGKGYLHGRDKEGRPVLYLRPGRHDPKKSSLEELIRFLVLVLERAILLLPePQVEGLTVIIDLKGLSLSNMDwwsISILK 80
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 470252872  166 FMVDMFQKYYPESLAKCLILNAPWIFMGFWHIIKHWLDPYTVSKVNFVKTKQ---LADFIPTENLLQSYGGS 234
Cdd:pfam00650  81 KIIKILQDNYPERLGKILIVNAPWIFNVIWKLIKPFLDPKTREKIKFHKNSNleeLKKHIPPEQLPKEYGGT 152
CRAL_TRIO_N smart01100
CRAL/TRIO, N-terminal domain;
13-63 1.37e-09

CRAL/TRIO, N-terminal domain;


:

Pssm-ID: 215024  Cd Length: 48  Bit Score: 52.17  E-value: 1.37e-09
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|.
gi 470252872    13 EKALQEVKDLVNKNmtdaTKEEAEKLDDSMILRFCRARKWVVKDAYEMLNN 63
Cdd:smart01100   1 EEALEELRELLEKH----PDLLPPRLDDAFLLRFLRARKFDVEKAKEMLEK 47
 
Name Accession Description Interval E-value
CRAL_TRIO pfam00650
CRAL/TRIO domain;
90-234 1.25e-47

CRAL/TRIO domain;


Pssm-ID: 395525  Cd Length: 152  Bit Score: 154.73  E-value: 1.25e-47
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 470252872   90 SGKSFFHGTDKEGRPVCIVRTRKHDGTNRDIDEAQRYCVYVMESGKQMLK-PGIETCTLIFDMSSFSTKNMD---YPLVK 165
Cdd:pfam00650   1 GGKGYLHGRDKEGRPVLYLRPGRHDPKKSSLEELIRFLVLVLERAILLLPePQVEGLTVIIDLKGLSLSNMDwwsISILK 80
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 470252872  166 FMVDMFQKYYPESLAKCLILNAPWIFMGFWHIIKHWLDPYTVSKVNFVKTKQ---LADFIPTENLLQSYGGS 234
Cdd:pfam00650  81 KIIKILQDNYPERLGKILIVNAPWIFNVIWKLIKPFLDPKTREKIKFHKNSNleeLKKHIPPEQLPKEYGGT 152
SEC14 smart00516
Domain in homologues of a S. cerevisiae phosphatidylinositol transfer protein (Sec14p); Domain ...
87-236 1.25e-36

Domain in homologues of a S. cerevisiae phosphatidylinositol transfer protein (Sec14p); Domain in homologues of a S. cerevisiae phosphatidylinositol transfer protein (Sec14p) and in RhoGAPs, RhoGEFs and the RasGAP, neurofibromin (NF1). Lipid-binding domain. The SEC14 domain of Dbl is known to associate with G protein beta/gamma subunits.


Pssm-ID: 214706  Cd Length: 158  Bit Score: 126.65  E-value: 1.25e-36
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 470252872    87 ELKSGKSFFHGTDKEGRPVCIVRTRKHDGTNRDIDEAQRYCVYVMESG--KQMLKPGIETCTLIFDMSSFSTKNMDYPLV 164
Cdd:smart00516   4 LLKAYIPGGRGYDKDGRPVLIERAGRFDLKSVTLEELLRYLVYVLEKIlqEEKKTGGIEGFTVIFDLKGLSMSNPDLSVL 83
                           90       100       110       120       130       140       150
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 470252872   165 KFMVDMFQKYYPESLAKCLILNAPWIFMGFWHIIKHWLDPYTVSKVNFVKTKQ---LADFIPTENLLQSYGGSSQ 236
Cdd:smart00516  84 RKILKILQDHYPERLGKVYIINPPWFFRVLWKIIKPFLDEKTREKIRFVGNDSkeeLLEYIDKEQLPEELGGTLD 158
SEC14 cd00170
Sec14p-like lipid-binding domain. Found in secretory proteins, such as S. cerevisiae ...
94-233 1.55e-34

Sec14p-like lipid-binding domain. Found in secretory proteins, such as S. cerevisiae phosphatidylinositol transfer protein (Sec14p), and in lipid regulated proteins such as RhoGAPs, RhoGEFs and neurofibromin (NF1). SEC14 domain of Dbl is known to associate with G protein beta/gamma subunits.


Pssm-ID: 238099  Cd Length: 157  Bit Score: 121.34  E-value: 1.55e-34
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 470252872  94 FFHGTDKEGRPVCIVRTRKHDGTNR-DIDEAQRYCVYVMESGKQMLKPGIETCTLIFDMSSFSTKNM--DYPLVKFMVDM 170
Cdd:cd00170   12 YLGGRDKEGRPVLIIRAGNKDLSKSlDSEELLRYLVYTLEKLLQEDDEQVEGFVVIIDLKGLSLSHLlpDPSLLKKILKI 91
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 470252872 171 FQKYYPESLAKCLILNAPWIFMGFWHIIKHWLDPYTVSKVNFVKT--KQLADFIPTENLLQSYGG 233
Cdd:cd00170   92 LQDNYPERLKAVYIINPPWFFKVLWKIVKPFLSEKTRKKIVFLGSdkEELLKYIDKEQLPEEYGG 156
CRAL_TRIO_N smart01100
CRAL/TRIO, N-terminal domain;
13-63 1.37e-09

CRAL/TRIO, N-terminal domain;


Pssm-ID: 215024  Cd Length: 48  Bit Score: 52.17  E-value: 1.37e-09
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|.
gi 470252872    13 EKALQEVKDLVNKNmtdaTKEEAEKLDDSMILRFCRARKWVVKDAYEMLNN 63
Cdd:smart01100   1 EEALEELRELLEKH----PDLLPPRLDDAFLLRFLRARKFDVEKAKEMLEK 47
CRAL_TRIO_N pfam03765
CRAL/TRIO, N-terminal domain; This all-alpha domain is found to the N-terminus of pfam00650.
15-61 1.11e-08

CRAL/TRIO, N-terminal domain; This all-alpha domain is found to the N-terminus of pfam00650.


Pssm-ID: 397711  Cd Length: 53  Bit Score: 49.97  E-value: 1.11e-08
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|.
gi 470252872   15 ALQEVKDLVNKNMTDATKEEA----EKLDDSMILRFCRARKWVVKDAYEML 61
Cdd:pfam03765   1 AYDELLELLKDEDEETDREKFwltrEDHPDACLLRFLRARKWDVEKAIKML 51
 
Name Accession Description Interval E-value
CRAL_TRIO pfam00650
CRAL/TRIO domain;
90-234 1.25e-47

CRAL/TRIO domain;


Pssm-ID: 395525  Cd Length: 152  Bit Score: 154.73  E-value: 1.25e-47
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 470252872   90 SGKSFFHGTDKEGRPVCIVRTRKHDGTNRDIDEAQRYCVYVMESGKQMLK-PGIETCTLIFDMSSFSTKNMD---YPLVK 165
Cdd:pfam00650   1 GGKGYLHGRDKEGRPVLYLRPGRHDPKKSSLEELIRFLVLVLERAILLLPePQVEGLTVIIDLKGLSLSNMDwwsISILK 80
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 470252872  166 FMVDMFQKYYPESLAKCLILNAPWIFMGFWHIIKHWLDPYTVSKVNFVKTKQ---LADFIPTENLLQSYGGS 234
Cdd:pfam00650  81 KIIKILQDNYPERLGKILIVNAPWIFNVIWKLIKPFLDPKTREKIKFHKNSNleeLKKHIPPEQLPKEYGGT 152
SEC14 smart00516
Domain in homologues of a S. cerevisiae phosphatidylinositol transfer protein (Sec14p); Domain ...
87-236 1.25e-36

Domain in homologues of a S. cerevisiae phosphatidylinositol transfer protein (Sec14p); Domain in homologues of a S. cerevisiae phosphatidylinositol transfer protein (Sec14p) and in RhoGAPs, RhoGEFs and the RasGAP, neurofibromin (NF1). Lipid-binding domain. The SEC14 domain of Dbl is known to associate with G protein beta/gamma subunits.


Pssm-ID: 214706  Cd Length: 158  Bit Score: 126.65  E-value: 1.25e-36
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 470252872    87 ELKSGKSFFHGTDKEGRPVCIVRTRKHDGTNRDIDEAQRYCVYVMESG--KQMLKPGIETCTLIFDMSSFSTKNMDYPLV 164
Cdd:smart00516   4 LLKAYIPGGRGYDKDGRPVLIERAGRFDLKSVTLEELLRYLVYVLEKIlqEEKKTGGIEGFTVIFDLKGLSMSNPDLSVL 83
                           90       100       110       120       130       140       150
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 470252872   165 KFMVDMFQKYYPESLAKCLILNAPWIFMGFWHIIKHWLDPYTVSKVNFVKTKQ---LADFIPTENLLQSYGGSSQ 236
Cdd:smart00516  84 RKILKILQDHYPERLGKVYIINPPWFFRVLWKIIKPFLDEKTREKIRFVGNDSkeeLLEYIDKEQLPEELGGTLD 158
SEC14 cd00170
Sec14p-like lipid-binding domain. Found in secretory proteins, such as S. cerevisiae ...
94-233 1.55e-34

Sec14p-like lipid-binding domain. Found in secretory proteins, such as S. cerevisiae phosphatidylinositol transfer protein (Sec14p), and in lipid regulated proteins such as RhoGAPs, RhoGEFs and neurofibromin (NF1). SEC14 domain of Dbl is known to associate with G protein beta/gamma subunits.


Pssm-ID: 238099  Cd Length: 157  Bit Score: 121.34  E-value: 1.55e-34
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 470252872  94 FFHGTDKEGRPVCIVRTRKHDGTNR-DIDEAQRYCVYVMESGKQMLKPGIETCTLIFDMSSFSTKNM--DYPLVKFMVDM 170
Cdd:cd00170   12 YLGGRDKEGRPVLIIRAGNKDLSKSlDSEELLRYLVYTLEKLLQEDDEQVEGFVVIIDLKGLSLSHLlpDPSLLKKILKI 91
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 470252872 171 FQKYYPESLAKCLILNAPWIFMGFWHIIKHWLDPYTVSKVNFVKT--KQLADFIPTENLLQSYGG 233
Cdd:cd00170   92 LQDNYPERLKAVYIINPPWFFKVLWKIVKPFLSEKTRKKIVFLGSdkEELLKYIDKEQLPEEYGG 156
CRAL_TRIO_N smart01100
CRAL/TRIO, N-terminal domain;
13-63 1.37e-09

CRAL/TRIO, N-terminal domain;


Pssm-ID: 215024  Cd Length: 48  Bit Score: 52.17  E-value: 1.37e-09
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|.
gi 470252872    13 EKALQEVKDLVNKNmtdaTKEEAEKLDDSMILRFCRARKWVVKDAYEMLNN 63
Cdd:smart01100   1 EEALEELRELLEKH----PDLLPPRLDDAFLLRFLRARKFDVEKAKEMLEK 47
CRAL_TRIO_N pfam03765
CRAL/TRIO, N-terminal domain; This all-alpha domain is found to the N-terminus of pfam00650.
15-61 1.11e-08

CRAL/TRIO, N-terminal domain; This all-alpha domain is found to the N-terminus of pfam00650.


Pssm-ID: 397711  Cd Length: 53  Bit Score: 49.97  E-value: 1.11e-08
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|.
gi 470252872   15 ALQEVKDLVNKNMTDATKEEA----EKLDDSMILRFCRARKWVVKDAYEML 61
Cdd:pfam03765   1 AYDELLELLKDEDEETDREKFwltrEDHPDACLLRFLRARKWDVEKAIKML 51
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH