NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|482677334]
View 

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
7tmF_SMO_homolog cd15030
class F smoothened family membrane region, a homolog of frizzled receptors; This group ...
140-470 0e+00

class F smoothened family membrane region, a homolog of frizzled receptors; This group represents smoothened (SMO), a transmembrane G protein-coupled receptor that acts as the transducer of the hedgehog (HH) signaling pathway. SMO is activated by the hedgehog (HH) family of proteins acting on the 12-transmembrane domain receptor patched (PTCH), which constitutively inhibits SMO. Thus, in the absence of HH proteins, PTCH inhibits SMO signaling. On the other hand, binding of HH to the PTCH receptor activates its internalization and degradation, thereby releasing the PTCH inhibition of SMO. This allows SMO to trigger intracellular signaling and the subsequent activation of the Gli family of zinc finger transcriptional factors and induction of HH target gene expression (PTCH, Gli1, cyclin, Bcl-2, etc). SMO is closely related to the frizzled (FZD) family of seven transmembrane-spanning proteins, which constitute a novel and separate family of G-protein coupled receptors. The FZDs are activated by the wingless/int-1 (WNT) family of secreted lipoglycoproteins and preferentially couple to stimulatory G proteins of the Gs family, which activate adenylate cyclase, but can also couple to G proteins of the Gi/Gq families. In the WNT/beta-catenin signaling pathway, the WNT ligand binds to FZD and a lipoprotein receptor-related protein (LRP) co-receptor. This leads to the stabilization and translocation of beta-catenin to the nucleus, where it induces the activation of TCF/LEF family transcription factors. The WNT and HH signaling pathways play critical roles in many developmental processes, such as cell-fate determination, cell proliferation, neural patterning, stem cell renewal, tissue homeostasis and repair, and tumorigenesis, among many others.


:

Pssm-ID: 320158  Cd Length: 331  Bit Score: 651.28  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334 140 PLFTEAEHQDMHSYIAAFGAVTGLCTLFTLATFVADWRNSNRYPAVILFYVNACFFVGSIGWLAQFMDGARREIVCRADG 219
Cdd:cd15030    1 PLFTEDEHRQIHKFIAVFASVCLLCTLFTVLTFFIDWKNSNRYPAVILFYINACFFIGSIGWLAQFLPGAREDIVCRKDG 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334 220 TMRLGEPTSNETLSCVIIFVIVYYALMAGVVWFVVLTYAWHTSFKALGTTYQPLSGKTSYFHLLTWSLPFVLTVAILAVA 299
Cdd:cd15030   81 TMRLGEPSAGENLSCVVIFVLVYYFLMAGCVWFVILTYAWHMSFKALGTIQDRLDKKTAYFHLIAWSLPLVLTITIMALG 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334 300 QVDGDSVSGICFVGYKNYRYRAGFVLAPIGLVLIVGGYFLIRGVMTLFSIKSNHPGLLSEKAASKINETMLRLGIFGFLA 379
Cdd:cd15030  161 QVDGDSVSGICFVGYKNHMYRAGFVLAPVGLVLVIGGYFLVRGLYTLIKLKISSPEILSEKASSKIRETIVRLGIFAFLA 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334 380 FGFVLITFSCHFYDFFNQAEWERSFRDYVLCQANVTIGLPTKQPIPDCEIKNRPSLLVEKINLFAMFGTGIAMSTWVWTK 459
Cdd:cd15030  241 LGFVLITFACHVYEFFNQAEWEKSFRDYIVCEANVTIAEQTNGDIPECELKSRPSLAMLQLHLLALFGAGIAMSSWVWTR 320
                        330
                 ....*....|.
gi 482677334 460 ATLLIWRRTWC 470
Cdd:cd15030  321 ATLETWKRFWR 331
PRK15058 PRK15058
cytochrome b562; Provisional
3-108 2.44e-71

cytochrome b562; Provisional


:

Pssm-ID: 185018  Cd Length: 128  Bit Score: 221.82  E-value: 2.44e-71
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334   3 TADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLA 82
Cdd:PRK15058  22 AADLEDNMETLNDNLKVVEKTDNAAEVKDALTKMRAAALDAQKATPPKLEDKAPDSPEMKDFRHGFDILVGQIDGALKLA 101
                         90       100
                 ....*....|....*....|....*.
gi 482677334  83 NEGKVKEAQAAAEQLKTTRNAYIQKY 108
Cdd:PRK15058 102 NEGKVKEAQAAAEQLKTTRNAYHKKY 127
 
Name Accession Description Interval E-value
7tmF_SMO_homolog cd15030
class F smoothened family membrane region, a homolog of frizzled receptors; This group ...
140-470 0e+00

class F smoothened family membrane region, a homolog of frizzled receptors; This group represents smoothened (SMO), a transmembrane G protein-coupled receptor that acts as the transducer of the hedgehog (HH) signaling pathway. SMO is activated by the hedgehog (HH) family of proteins acting on the 12-transmembrane domain receptor patched (PTCH), which constitutively inhibits SMO. Thus, in the absence of HH proteins, PTCH inhibits SMO signaling. On the other hand, binding of HH to the PTCH receptor activates its internalization and degradation, thereby releasing the PTCH inhibition of SMO. This allows SMO to trigger intracellular signaling and the subsequent activation of the Gli family of zinc finger transcriptional factors and induction of HH target gene expression (PTCH, Gli1, cyclin, Bcl-2, etc). SMO is closely related to the frizzled (FZD) family of seven transmembrane-spanning proteins, which constitute a novel and separate family of G-protein coupled receptors. The FZDs are activated by the wingless/int-1 (WNT) family of secreted lipoglycoproteins and preferentially couple to stimulatory G proteins of the Gs family, which activate adenylate cyclase, but can also couple to G proteins of the Gi/Gq families. In the WNT/beta-catenin signaling pathway, the WNT ligand binds to FZD and a lipoprotein receptor-related protein (LRP) co-receptor. This leads to the stabilization and translocation of beta-catenin to the nucleus, where it induces the activation of TCF/LEF family transcription factors. The WNT and HH signaling pathways play critical roles in many developmental processes, such as cell-fate determination, cell proliferation, neural patterning, stem cell renewal, tissue homeostasis and repair, and tumorigenesis, among many others.


Pssm-ID: 320158  Cd Length: 331  Bit Score: 651.28  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334 140 PLFTEAEHQDMHSYIAAFGAVTGLCTLFTLATFVADWRNSNRYPAVILFYVNACFFVGSIGWLAQFMDGARREIVCRADG 219
Cdd:cd15030    1 PLFTEDEHRQIHKFIAVFASVCLLCTLFTVLTFFIDWKNSNRYPAVILFYINACFFIGSIGWLAQFLPGAREDIVCRKDG 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334 220 TMRLGEPTSNETLSCVIIFVIVYYALMAGVVWFVVLTYAWHTSFKALGTTYQPLSGKTSYFHLLTWSLPFVLTVAILAVA 299
Cdd:cd15030   81 TMRLGEPSAGENLSCVVIFVLVYYFLMAGCVWFVILTYAWHMSFKALGTIQDRLDKKTAYFHLIAWSLPLVLTITIMALG 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334 300 QVDGDSVSGICFVGYKNYRYRAGFVLAPIGLVLIVGGYFLIRGVMTLFSIKSNHPGLLSEKAASKINETMLRLGIFGFLA 379
Cdd:cd15030  161 QVDGDSVSGICFVGYKNHMYRAGFVLAPVGLVLVIGGYFLVRGLYTLIKLKISSPEILSEKASSKIRETIVRLGIFAFLA 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334 380 FGFVLITFSCHFYDFFNQAEWERSFRDYVLCQANVTIGLPTKQPIPDCEIKNRPSLLVEKINLFAMFGTGIAMSTWVWTK 459
Cdd:cd15030  241 LGFVLITFACHVYEFFNQAEWEKSFRDYIVCEANVTIAEQTNGDIPECELKSRPSLAMLQLHLLALFGAGIAMSSWVWTR 320
                        330
                 ....*....|.
gi 482677334 460 ATLLIWRRTWC 470
Cdd:cd15030  321 ATLETWKRFWR 331
Frizzled pfam01534
Frizzled/Smoothened family membrane region. This family contains the membrane spanning region ...
141-470 3.60e-132

Frizzled/Smoothened family membrane region. This family contains the membrane spanning region of frizzled and smoothened receptors. This membrane region is predicted to contain seven transmembrane alpha helices. Proteins related to Drosophila frizzled are receptors for Wnt (mediating the beta-catenin signalling pathway), but also the planar cell polarity (PCP) pathway and the Wnt/calcium pathway. The predominantly alpha-helical Cys-rich ligand-binding region (CRD) of Frizzled is both necessary and sufficient for Wnt binding. The smoothened receptor mediates hedgehog signalling.


Pssm-ID: 366694  Cd Length: 319  Bit Score: 384.66  E-value: 3.60e-132
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334  141 LFTEAEHQDMHSYIAAFGAVTGLCTLFTLATFVADWrNSNRYPAVILFYVNACFFVGSIGWLAQFMDGaRREIVCRADGT 220
Cdd:pfam01534   1 FFTEEEKRFARVWIALWSSLCFVSTLFTVLTFLIDW-SRFRYPERPIIFLSLCYLVVSLGYLIRFVLG-RESIACRKDGT 78
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334  221 MRLGEPT--SNETLSCVIIFVIVYYALMAGVVWFVVLTYAWHTS-FKALGttYQPLSGKTSYFHLLTWSLPFVLTVAILA 297
Cdd:pfam01534  79 GRSSYLItqGTENASCTVVFLLLYYFGMASSIWWVILTLTWFLAaGLKWG--SEAIEKKSSYFHLAAWGIPAVLTITVLA 156
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334  298 VAQVDGDSVSGICFVGYKNYRYRAGFVLAPIGLVLIVGGYFLIRGVMTLFSI----KSNHPgllseKAASKINETMLRLG 373
Cdd:pfam01534 157 LGKVDGDELTGICFVGNQNSDALRGFVLAPLLVYLLVGTYFLLAGFVSLFRIrrviKLDGP-----KATDKLEKLMVRIG 231
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334  374 IFGFLAFGFVLITFSCHFYDFFNQAEWERSFRDYVLcqanvtiglptKQPIPDC--EIKNRPSLLVEKINLFAMFGTGIA 451
Cdd:pfam01534 232 IFSVLYTVPALIVIACYFYEFFNRDEWERSWREYVC-----------KKYICPCppEIKSRPSVEVFMLKYFMSLVVGIT 300
                         330
                  ....*....|....*....
gi 482677334  452 MSTWVWTKATLLIWRRTWC 470
Cdd:pfam01534 301 SGFWVWSGKTLESWRRFFR 319
PRK15058 PRK15058
cytochrome b562; Provisional
3-108 2.44e-71

cytochrome b562; Provisional


Pssm-ID: 185018  Cd Length: 128  Bit Score: 221.82  E-value: 2.44e-71
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334   3 TADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLA 82
Cdd:PRK15058  22 AADLEDNMETLNDNLKVVEKTDNAAEVKDALTKMRAAALDAQKATPPKLEDKAPDSPEMKDFRHGFDILVGQIDGALKLA 101
                         90       100
                 ....*....|....*....|....*.
gi 482677334  83 NEGKVKEAQAAAEQLKTTRNAYIQKY 108
Cdd:PRK15058 102 NEGKVKEAQAAAEQLKTTRNAYHKKY 127
CybC COG3783
Soluble cytochrome b562 [Energy production and conversion];
11-108 2.09e-52

Soluble cytochrome b562 [Energy production and conversion];


Pssm-ID: 226306  Cd Length: 100  Bit Score: 172.00  E-value: 2.09e-52
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334  11 ETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEA 90
Cdd:COG3783    2 ETLNDNMKVVEKADKAAVIKAALEKMRAAALDAQKATPPKLEGKYPDSPEMKDYRHGFDILIGQIDKADKLAQEGNLDEA 81
                         90
                 ....*....|....*...
gi 482677334  91 QAAAEQLKTTRNAYIQKY 108
Cdd:COG3783   82 KAAAKTLKDTRNTYHKKY 99
Cytochrom_B562 pfam07361
Cytochrome b562. This family contains the bacterial cytochrome b562. This forms a four-helix ...
6-108 1.17e-35

Cytochrome b562. This family contains the bacterial cytochrome b562. This forms a four-helix bundle that non-covalently binds a single heme prosthetic group..


Pssm-ID: 377821  Cd Length: 101  Bit Score: 127.78  E-value: 1.17e-35
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334    6 LEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDkspDSPEMKDFRHGFDILVGQIDDALKLANEG 85
Cdd:pfam07361   1 LKEDMKQMKLAYKQAAKADDAAEFKKALAQLRAAAEDAKEATPPKLEG---DSEEQKDYQEGMDKLIDQLDKADALADAG 77
                          90       100
                  ....*....|....*....|...
gi 482677334   86 KVKEAQAAAEQLKTTRNAYIQKY 108
Cdd:pfam07361  78 KLDEAKAALKELDDLRKEYHKKF 100
 
Name Accession Description Interval E-value
7tmF_SMO_homolog cd15030
class F smoothened family membrane region, a homolog of frizzled receptors; This group ...
140-470 0e+00

class F smoothened family membrane region, a homolog of frizzled receptors; This group represents smoothened (SMO), a transmembrane G protein-coupled receptor that acts as the transducer of the hedgehog (HH) signaling pathway. SMO is activated by the hedgehog (HH) family of proteins acting on the 12-transmembrane domain receptor patched (PTCH), which constitutively inhibits SMO. Thus, in the absence of HH proteins, PTCH inhibits SMO signaling. On the other hand, binding of HH to the PTCH receptor activates its internalization and degradation, thereby releasing the PTCH inhibition of SMO. This allows SMO to trigger intracellular signaling and the subsequent activation of the Gli family of zinc finger transcriptional factors and induction of HH target gene expression (PTCH, Gli1, cyclin, Bcl-2, etc). SMO is closely related to the frizzled (FZD) family of seven transmembrane-spanning proteins, which constitute a novel and separate family of G-protein coupled receptors. The FZDs are activated by the wingless/int-1 (WNT) family of secreted lipoglycoproteins and preferentially couple to stimulatory G proteins of the Gs family, which activate adenylate cyclase, but can also couple to G proteins of the Gi/Gq families. In the WNT/beta-catenin signaling pathway, the WNT ligand binds to FZD and a lipoprotein receptor-related protein (LRP) co-receptor. This leads to the stabilization and translocation of beta-catenin to the nucleus, where it induces the activation of TCF/LEF family transcription factors. The WNT and HH signaling pathways play critical roles in many developmental processes, such as cell-fate determination, cell proliferation, neural patterning, stem cell renewal, tissue homeostasis and repair, and tumorigenesis, among many others.


Pssm-ID: 320158  Cd Length: 331  Bit Score: 651.28  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334 140 PLFTEAEHQDMHSYIAAFGAVTGLCTLFTLATFVADWRNSNRYPAVILFYVNACFFVGSIGWLAQFMDGARREIVCRADG 219
Cdd:cd15030    1 PLFTEDEHRQIHKFIAVFASVCLLCTLFTVLTFFIDWKNSNRYPAVILFYINACFFIGSIGWLAQFLPGAREDIVCRKDG 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334 220 TMRLGEPTSNETLSCVIIFVIVYYALMAGVVWFVVLTYAWHTSFKALGTTYQPLSGKTSYFHLLTWSLPFVLTVAILAVA 299
Cdd:cd15030   81 TMRLGEPSAGENLSCVVIFVLVYYFLMAGCVWFVILTYAWHMSFKALGTIQDRLDKKTAYFHLIAWSLPLVLTITIMALG 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334 300 QVDGDSVSGICFVGYKNYRYRAGFVLAPIGLVLIVGGYFLIRGVMTLFSIKSNHPGLLSEKAASKINETMLRLGIFGFLA 379
Cdd:cd15030  161 QVDGDSVSGICFVGYKNHMYRAGFVLAPVGLVLVIGGYFLVRGLYTLIKLKISSPEILSEKASSKIRETIVRLGIFAFLA 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334 380 FGFVLITFSCHFYDFFNQAEWERSFRDYVLCQANVTIGLPTKQPIPDCEIKNRPSLLVEKINLFAMFGTGIAMSTWVWTK 459
Cdd:cd15030  241 LGFVLITFACHVYEFFNQAEWEKSFRDYIVCEANVTIAEQTNGDIPECELKSRPSLAMLQLHLLALFGAGIAMSSWVWTR 320
                        330
                 ....*....|.
gi 482677334 460 ATLLIWRRTWC 470
Cdd:cd15030  321 ATLETWKRFWR 331
Frizzled pfam01534
Frizzled/Smoothened family membrane region. This family contains the membrane spanning region ...
141-470 3.60e-132

Frizzled/Smoothened family membrane region. This family contains the membrane spanning region of frizzled and smoothened receptors. This membrane region is predicted to contain seven transmembrane alpha helices. Proteins related to Drosophila frizzled are receptors for Wnt (mediating the beta-catenin signalling pathway), but also the planar cell polarity (PCP) pathway and the Wnt/calcium pathway. The predominantly alpha-helical Cys-rich ligand-binding region (CRD) of Frizzled is both necessary and sufficient for Wnt binding. The smoothened receptor mediates hedgehog signalling.


Pssm-ID: 366694  Cd Length: 319  Bit Score: 384.66  E-value: 3.60e-132
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334  141 LFTEAEHQDMHSYIAAFGAVTGLCTLFTLATFVADWrNSNRYPAVILFYVNACFFVGSIGWLAQFMDGaRREIVCRADGT 220
Cdd:pfam01534   1 FFTEEEKRFARVWIALWSSLCFVSTLFTVLTFLIDW-SRFRYPERPIIFLSLCYLVVSLGYLIRFVLG-RESIACRKDGT 78
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334  221 MRLGEPT--SNETLSCVIIFVIVYYALMAGVVWFVVLTYAWHTS-FKALGttYQPLSGKTSYFHLLTWSLPFVLTVAILA 297
Cdd:pfam01534  79 GRSSYLItqGTENASCTVVFLLLYYFGMASSIWWVILTLTWFLAaGLKWG--SEAIEKKSSYFHLAAWGIPAVLTITVLA 156
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334  298 VAQVDGDSVSGICFVGYKNYRYRAGFVLAPIGLVLIVGGYFLIRGVMTLFSI----KSNHPgllseKAASKINETMLRLG 373
Cdd:pfam01534 157 LGKVDGDELTGICFVGNQNSDALRGFVLAPLLVYLLVGTYFLLAGFVSLFRIrrviKLDGP-----KATDKLEKLMVRIG 231
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334  374 IFGFLAFGFVLITFSCHFYDFFNQAEWERSFRDYVLcqanvtiglptKQPIPDC--EIKNRPSLLVEKINLFAMFGTGIA 451
Cdd:pfam01534 232 IFSVLYTVPALIVIACYFYEFFNRDEWERSWREYVC-----------KKYICPCppEIKSRPSVEVFMLKYFMSLVVGIT 300
                         330
                  ....*....|....*....
gi 482677334  452 MSTWVWTKATLLIWRRTWC 470
Cdd:pfam01534 301 SGFWVWSGKTLESWRRFFR 319
7tmF_Frizzled_SMO cd13951
class F frizzled/smoothened family, member of the 7-transmembrane G protein-coupled receptor ...
140-470 6.44e-121

class F frizzled/smoothened family, member of the 7-transmembrane G protein-coupled receptor superfamily; The class F G protein-coupled receptors includes the frizzled (FZD) family of seven-transmembrane proteins consisting of 10 isoforms (FZD1-10) in mammals. The FZDs are activated by the wingless/int-1 (WNT) family of secreted lipoglycoproteins and preferentially couple to stimulatory G proteins of the Gs family, which activate adenylate cyclase, but can also couple to G proteins of the Gi/Gq families. In the WNT/beta-catenin signaling pathway, the WNT ligand binds to FZD and a lipoprotein receptor-related protein (LRP) co-receptor. This leads to the stabilization and translocation of beta-catenin to the nucleus, where it induces the activation of TCF/LEF family transcription factors. The conserved cytoplasmic motif of FZD, Lys-Thr-X-X-X-Trp, is required for activation of the WNT/beta-catenin pathway, and for membrane localization and phosphorylation of Dsh (dishevelled) protein, a key component of the WNT pathway that relays the WNT signals from the activated receptor to downstream effector proteins. Also included in the class F family is the closely related smoothened (SMO), which is a transmembrane G protein-coupled receptor that acts as the transducer of the hedgehog (HH) signaling pathway. SMO is activated by the hedgehog (HH) family of proteins acting on the 12-transmembrane domain receptor patched (PTCH), which constitutively inhibits SMO. Thus, in the absence of HH proteins, PTCH inhibits SMO signaling. On the other hand, binding of HH to the PTCH receptor activates its internalization and degradation, thereby releasing the PTCH inhibition of SMO. This allows SMO to trigger intracellular signaling and the subsequent activation of the Gli family of zinc finger transcriptional factors and induction of HH target gene expression (PTCH, Gli1, cyclin, Bcl-2, etc). The WNT and HH signaling pathways play critical roles in many developmental processes, such as cell-fate determination, cell proliferation, neural patterning, stem cell renewal, tissue homeostasis and repair, and tumorigenesis, among many others.


Pssm-ID: 320089  Cd Length: 314  Bit Score: 355.86  E-value: 6.44e-121
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334 140 PLFTEAEHQDMHSYIAAFGAVTGLCTLFTLATFVADWRNsNRYPAVILFYVNACFFVGSIGWLAQFMDGaRREIVCRADG 219
Cdd:cd13951    1 GLFTSSEKKFAEIWISAWSALCFLLTLFTLLTFLIDPSR-FRYPERPIIFLALCYNFYSLGYLVRLVVG-REGIACGKDE 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334 220 TM-RLGEPTSNETLSCVIIFVIVYYALMAGVVWFVVLTYAWHTSFKALGTTyQPLSGKTSYFHLLTWSLPFVLTVAILAV 298
Cdd:cd13951   79 GKpYLLLVDGSGNAPCAIVFLLTYYFGMAASIWWVILTLTWFLSAGLKWSS-EAIEKKSSYFHLVAWGLPAVLTIAVLVL 157
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334 299 AQVDGDSVSGICFVGYKNYRYRAGFVLAPIGLVLIVGGYFLIRGVMTLFSIKSNHPGllSEKAASKINETMLRLGIFGFL 378
Cdd:cd13951  158 RKVDGDELTGICFVGNQNLDALRGFVLAPLFLYLILGTVFLLCGFLSLFRIRSILSN--DGKKTDKLEKLMLRIGIFAVL 235
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334 379 AFGFVLITFSCHFYDFFNQAEWERSFRDYVLCqanvtiglptkqpIPDCEIKNRPSLLVEKINLFAMFGTGIAMSTWVWT 458
Cdd:cd13951  236 YTLPALIVIACYFYEYANRPDWLRSWEPHSCC-------------SPDCEILSRPSLAVFLLKYFMQLVIGITTGVWVWS 302
                        330
                 ....*....|..
gi 482677334 459 KATLLIWRRTWC 470
Cdd:cd13951  303 KKTLLSWRRLLR 314
PRK15058 PRK15058
cytochrome b562; Provisional
3-108 2.44e-71

cytochrome b562; Provisional


Pssm-ID: 185018  Cd Length: 128  Bit Score: 221.82  E-value: 2.44e-71
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334   3 TADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLA 82
Cdd:PRK15058  22 AADLEDNMETLNDNLKVVEKTDNAAEVKDALTKMRAAALDAQKATPPKLEDKAPDSPEMKDFRHGFDILVGQIDGALKLA 101
                         90       100
                 ....*....|....*....|....*.
gi 482677334  83 NEGKVKEAQAAAEQLKTTRNAYIQKY 108
Cdd:PRK15058 102 NEGKVKEAQAAAEQLKTTRNAYHKKY 127
cybC PRK09720
cytochrome b562; Provisional
11-108 3.72e-65

cytochrome b562; Provisional


Pssm-ID: 182047  Cd Length: 100  Bit Score: 205.09  E-value: 3.72e-65
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334  11 ETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEA 90
Cdd:PRK09720   2 ETLNDNLKVVEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEA 81
                         90
                 ....*....|....*...
gi 482677334  91 QAAAEQLKTTRNAYIQKY 108
Cdd:PRK09720  82 QAAAEQLKTTRNSYHKKY 99
7tmF_FZD5_FZD8-like cd15035
class F frizzled subfamilies 5, 8 and related proteins; member of 7-transmembrane G ...
140-470 6.02e-57

class F frizzled subfamilies 5, 8 and related proteins; member of 7-transmembrane G protein-coupled receptors; This group includes subfamilies 5 and 8 of the frizzled (FZD) family of seven transmembrane-spanning proteins, which constitute a novel and separate class of GPCRs, as well as their closely related proteins. This class F protein family consists of 10 isoforms (FZD1-10) in mammals. The FZDs are activated by the wingless/int-1 (WNT) family of secreted lipoglycoproteins and preferentially couple to stimulatory G proteins of the Gs family, which activate adenylate cyclase, but can also couple to G proteins of the Gi/Gq families. In the WNT/beta-catenin signaling pathway, the WNT ligand binds to FZD and a lipoprotein receptor-related protein (LRP) co-receptor. This leads to the stabilization and translocation of beta-catenin to the nucleus, where it induces the activation of TCF/LEF family transcription factors. The conserved cytoplasmic motif of FZD, Lys-Thr-X-X-X-Trp, is required for activation of the WNT/beta-catenin pathway, and for membrane localization and phosphorylation of Dsh (dishevelled) protein, a key component of the WNT pathway that relays the WNT signals from the activated receptor to downstream effector proteins. The WNT pathway plays a critical role in many developmental processes, such as cell-fate determination, cell proliferation, neural patterning, stem cell renewal, tissue homeostasis and repair, and tumorigenesis, among many others.


Pssm-ID: 320163  Cd Length: 307  Bit Score: 190.95  E-value: 6.02e-57
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334 140 PLFTEAEHQDMHSYIAAFGAVTGLCTLFTLATFVADwRNSNRYPAVILFYVNACFFVGSIGWLAQFMDGaRREIVCRADg 219
Cdd:cd15035    1 PFFSEDEKTFATFWIGLWSILCFISTLITVLTFLID-MQRFQYPERPIIFLSFCYFMVSVGYIIRLIVG-HEAVACDGG- 77
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334 220 TMRLGeptSNETLSCVIIFVIVYYALMAGVVWFVVLTYAWhtsFKALGTTYQP--LSGKTSYFHLLTWSLPFVLTVAILA 297
Cdd:cd15035   78 IIRYA---TTGPALCTVVFLLTYFFGMASSIWWVILSLTW---FLAAGLKWGNeaISSYSQYFHLVAWLIPAVQTIAILA 151
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334 298 VAQVDGDSVSGICFVGYKNYRYRAGFVLAPIGLVLIVGGYFLIRGVMTLFSIKsNHPGLLSEKAASKINETMLRLGIFGF 377
Cdd:cd15035  152 LSAVDGDPISGICYVGNQNLNNLRGFVLAPLVVYLILGTSFLLAGFVSLFRIR-NVIKQQGGDKTDKLEKLMIRIGIFSV 230
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334 378 LAFGFVLITFSCHFYDFFNQAEWERSfrdyVLCqanvtiglptkqPIPDCEIKNRPSLLVEKINLFAMFGTGIAMSTWVW 457
Cdd:cd15035  231 LYTVPATIVIACYFYEQHYREIWEKS----LNC------------PCSPGSIKSRPEYSIFMLKYFMSLVVGITSGFWIW 294
                        330
                 ....*....|...
gi 482677334 458 TKATLLIWRRTWC 470
Cdd:cd15035  295 SGKTLDSWKRFCR 307
CybC COG3783
Soluble cytochrome b562 [Energy production and conversion];
11-108 2.09e-52

Soluble cytochrome b562 [Energy production and conversion];


Pssm-ID: 226306  Cd Length: 100  Bit Score: 172.00  E-value: 2.09e-52
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334  11 ETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEA 90
Cdd:COG3783    2 ETLNDNMKVVEKADKAAVIKAALEKMRAAALDAQKATPPKLEGKYPDSPEMKDYRHGFDILIGQIDKADKLAQEGNLDEA 81
                         90
                 ....*....|....*...
gi 482677334  91 QAAAEQLKTTRNAYIQKY 108
Cdd:COG3783   82 KAAAKTLKDTRNTYHKKY 99
7tmF_FZD1_insect cd15248
class F insect frizzled subfamily 1, member of 7-transmembrane G protein-coupled receptors; ...
142-472 8.42e-50

class F insect frizzled subfamily 1, member of 7-transmembrane G protein-coupled receptors; This group includes subfamily 1 of the frizzled (FZD) family of seven transmembrane-spanning proteins, which constitute a novel and separate class of G-protein coupled receptors, found in insects such as Drosophila melanogaster. This class F protein family consists of 10 isoforms (FZD1-10) in mammals. The FZDs are activated by the wingless/int-1 (WNT) family of secreted lipoglycoproteins and preferentially couple to stimulatory G proteins of the Gs family, which activate adenylate cyclase, but can also couple to G proteins of the Gi/Gq families. In the WNT/beta-catenin signaling pathway, the WNT ligand binds to FZD and a lipoprotein receptor-related protein (LRP) co-receptor. This leads to the stabilization and translocation of beta-catenin to the nucleus, where it induces the activation of TCF/LEF family transcription factors. The conserved cytoplasmic motif of FZD, Lys-Thr-X-X-X-Trp, is required for activation of the WNT/beta-catenin pathway, and for membrane localization and phosphorylation of Dsh (dishevelled) protein, a key component of the WNT pathway that relays the WNT signals from the activated receptor to downstream effector proteins. The WNT pathway plays a critical role in many developmental processes, such as cell-fate determination, cell proliferation, neural patterning, stem cell renewal, tissue homeostasis and repair, and tumorigenesis, among many others.


Pssm-ID: 320376  Cd Length: 332  Bit Score: 172.69  E-value: 8.42e-50
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334 142 FTEAEHQDMHSYIAAFGAVTGLCTLFTLATFVADWRNSnRYPAVILFYVNACFFVGSIGWLAQFMDGarREIVCRA--DG 219
Cdd:cd15248    3 FPERERTFSRYWIGSWAAVCMASCLFTVLTFLIDSSRF-RYPERPIVFLSVCYLMVAAAYVAGLGAG--DSVSCNEpfPP 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334 220 TMRLGEPTSNETL-------SCVIIFVIVYYALMAGVVWFVVLTYAWhtsFKALGTTY--QPLSGKTSYFHLLTWSLPFV 290
Cdd:cd15248   80 PVKLGRLQMVSTItqgtkteSCTVLFMVLYFFSMAASIWWVVLTLTW---FLAAGLKWghEAIEAKSHYFHLVAWAVPAL 156
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334 291 LTVAILAVAQVDGDSVSGICFVGYKNYRYRAGFVLAPIGLVLIVGGYFLIRGVMTLFSIKS--NHPGllseKAASKINET 368
Cdd:cd15248  157 KTISILAMGKVEGDVLSGVCYVGLWDMHALRGFVLAPLCVYLSLGTIFLLAGFISLFRIRTvmKHDG----TKTDKLEKL 232
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334 369 MLRLGIFGFLAFGFVLITFSCHFYDFFNQAEWERSFRDYVLCQANVTI--GLPTKQPIPdceiknRPSLLVEKINLFAMF 446
Cdd:cd15248  233 MLRIGIFSFLYTLPALIVLACLFYEQAHFDSWMLQWHRDICKPPSWSIpaCRATGSPEA------RPEFQVFMIKYLMSM 306
                        330       340
                 ....*....|....*....|....*.
gi 482677334 447 GTGIAMSTWVWTKATLLIWRRTWCRL 472
Cdd:cd15248  307 IVGITSSVWIWSSKTLVSWRNFYERL 332
7tmF_FZD4_9_10-like cd15909
class F frizzled subfamilies 4, 9, 10, and related proteins; member of 7-transmembrane G ...
163-470 2.37e-49

class F frizzled subfamilies 4, 9, 10, and related proteins; member of 7-transmembrane G protein-coupled receptors; This group includes subfamilies 4, 9 and 10 of the frizzled (FZD) family of seven transmembrane-spanning proteins, which constitute a novel and separate class of GPCRs, and their closely related proteins. This class F protein family consists of 10 isoforms (FZD1-10) in mammals. The FZDs are activated by the wingless/int-1 (WNT) family of secreted lipoglycoproteins and preferentially couple to stimulatory G proteins of the Gs family, which activate adenylate cyclase, but can also couple to G proteins of the Gi/Gq families. In the WNT/beta-catenin signaling pathway, the WNT ligand binds to FZD and a lipoprotein receptor-related protein (LRP) co-receptor. This leads to the stabilization and translocation of beta-catenin to the nucleus, where it induces the activation of TCF/LEF family transcription factors. The conserved cytoplasmic motif of FZD, Lys-Thr-X-X-X-Trp, is required for activation of the WNT/beta-catenin pathway, and for membrane localization and phosphorylation of Dsh (dishevelled) protein, a key component of the WNT pathway that relays the WNT signals from the activated receptor to downstream effector proteins. The WNT pathway plays a critical role in many developmental processes, such as cell-fate determination, cell proliferation, neural patterning, stem cell renewal, tissue homeostasis and repair, and tumorigenesis, among many others.


Pssm-ID: 320575  Cd Length: 320  Bit Score: 171.33  E-value: 2.37e-49
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334 163 LCTLFTLATFVADwRNSNRYPAVILFYVNACFFVGSIGWLAQFMDGaRREIVCRAD--GTMRLGEPTSNETLsCVIIFVI 240
Cdd:cd15909   24 ASTAFTVLTFLID-TSRFRYPERPIIFLSMCYFIYSLGYLIRLFLG-RERIACDSLnsGVSYLIQEGLESTW-CTIVFLL 100
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334 241 VYYALMAGVVWFVVLTYAWHTSfKALGTTYQPLSGKTSYFHLLTWSLPFVLTVAILAVAQVDGDSVSGICFVGYKNYRYR 320
Cdd:cd15909  101 LYYFGMASALWWVILTFTWYLA-AGRKWGPEAIEAASSYFHLVAWALPAVKTIVILIMHKVDADELTGLCYVGNHDSDAL 179
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334 321 AGFVLAPIGLVLIVGGYFLIRGVMTLFSIKSN--HPGLlsekAASKINETMLRLGIFGFLAFGFVLITFSCHFYDFFNQA 398
Cdd:cd15909  180 LGFVLVPLAIYLLIGTLFILAGFVSMFRIRRNlkTRGT----DTSKLEKLMVKIGVFSVLYTVPATCVIACYFYEYLNMD 255
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 482677334 399 EWERSFRDyVLCQANVTIGLPTkqpipdCEIKNRPSLLVEKINLFAMFGTGIAMSTWVWTKATLLIWRRTWC 470
Cdd:cd15909  256 QWRIAAIE-CKCQSPNAIGSDC------CLQPSIPSVEIYMLKIFMSLVVGITSGMWVWSSKTLQSWQRFIC 320
7tm_GPCRs cd14964
seven-transmembrane G protein-coupled receptor superfamily. This hierarchical evolutionary ...
150-455 5.33e-49

seven-transmembrane G protein-coupled receptor superfamily. This hierarchical evolutionary model represents the seven-transmembrane (7TM) receptors, often referred to as G protein-coupled receptors (GPCRs), which transmit physiological signals from the outside of the cell to the inside via G proteins. GPCRs constitute the largest known superfamily of transmembrane receptors across the three kingdoms of life that respond to a wide variety of extracellular stimuli including peptides, lipids, neurotransmitters, amino acids, hormones, and sensory stimuli such as light, smell and taste. All GPCRs share a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes. However, some 7TM receptors, such as the type 1 microbial rhodopsins, do not activate G proteins. Based on sequence similarity, GPCRs can be divided into six major classes: class A (the rhodopsin-like family), class B (the Methuselah-like, adhesion and secretin-like receptor family), class C (the metabotropic glutamate receptor family), class D (the fungal mating pheromone receptors), class E (the cAMP receptor family), and class F (the frizzled/smoothened receptor family). Nearly 800 human GPCR genes have been identified and are involved essentially in all major physiological processes. Approximately 40% of clinically marketed drugs mediate their effects through modulation of GPCR function for the treatment of a variety of human diseases including bacterial infections.


Pssm-ID: 341315  Cd Length: 268  Bit Score: 168.78  E-value: 5.33e-49
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334 150 MHSYIAAFGAVTGLCTLFTLATFVADWRNSnRYPAVILFYVNACFFVGSIGWLAQFMDGARREIvcradgtmrlgepTSN 229
Cdd:cd14964    1 TQIILILFTVLGLLGTLFVLLSFVKDRKTP-RSTRLLLASLAACFLLASLVVLVLTFGLGLTEV-------------SSR 66
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334 230 ETLSCVIIFVIVYYALMAGVVWFVVLTYAWHTSFKALGT-TYQPLSGKTSYFHLLTWSLPFVLTVAILAVAQVDGDSV-- 306
Cdd:cd14964   67 NTFLCYLVALLWYLGLLASILTLLVLSYHRHFMLKGRKKkTSFKRIGKTLVIILGTWGVSMLLSVLPLVGKGAIGRYNgs 146
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334 307 -SGICFVGYKNYRYRAGFVLAPIGLVLIVGGYFLIRGVMTLFSIKSNhpgllSEKAASKINETMLRLGIFGFLAFGFVLI 385
Cdd:cd14964  147 lTGSCYLICTTIALTVGFLLVSFVLPLVACLYIFVRIVLRLSRRVQK-----GRSSASKNTDKNLRAAKSLLILIITFLL 221
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334 386 TFSCHFYDFFNQAEWErsfrdyvlcqanvtiglptkqpipDCEIKNRPSLLVEKINLFAMFGTGIAMSTW 455
Cdd:cd14964  222 CWLPFSIVFILQALLR------------------------AGQILNLLTILVELLSVLASTLTPFILLLG 267
7tmF_FZD1_2_7-like cd15034
class F frizzled subfamilies 1, 2 and 7; member of 7-transmembrane G protein-coupled receptors; ...
158-467 5.98e-49

class F frizzled subfamilies 1, 2 and 7; member of 7-transmembrane G protein-coupled receptors; This group includes subfamilies 1, 2 and 7 of the frizzled (FZD) family of seven transmembrane-spanning proteins, which constitute a novel and separate class of G-protein coupled receptors, as well as their closely related proteins. This class F protein family consists of 10 isoforms (FZD1-10) in mammals. The FZDs are activated by the wingless/int-1 (WNT) family of secreted lipoglycoproteins and preferentially couple to stimulatory G proteins of the Gs family, which activate adenylate cyclase, but can also couple to G proteins of the Gi/Gq families. In the WNT/beta-catenin signaling pathway, the WNT ligand binds to FZD and a lipoprotein receptor-related protein (LRP) co-receptor. This leads to the stabilization and translocation of beta-catenin to the nucleus, where it induces the activation of TCF/LEF family transcription factors. The conserved cytoplasmic motif of FZD, Lys-Thr-X-X-X-Trp, is required for activation of the WNT/beta-catenin pathway, and for membrane localization and phosphorylation of Dsh (dishevelled) protein, a key component of the WNT pathway that relays the WNT signals from the activated receptor to downstream effector proteins. The WNT pathway plays a critical role in many developmental processes, such as cell-fate determination, cell proliferation, neural patterning, stem cell renewal, tissue homeostasis and repair, and tumorigenesis, among many others.


Pssm-ID: 320162  Cd Length: 322  Bit Score: 170.21  E-value: 5.98e-49
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334 158 GAVTGLC---TLFTLATFVADwRNSNRYPAVILFYVNACFFVGSIGWLAQFMdgARREIVCR----ADGTMRLGEPTSNE 230
Cdd:cd15034   16 GIWSVLCaasTLFTVLTFLID-MDRFRYPERPIIFLSGCYFMVSIAYIVGFF--LGDKVACNgpfpPGGPKTVTQGTKKE 92
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334 231 tlSCVIIFVIVYYALMAGVVWFVVLTYAWhtsFKALGTTY--QPLSGKTSYFHLLTWSLPFVLTVAILAVAQVDGDSVSG 308
Cdd:cd15034   93 --GCTILFMMLYFFSMASSIWWVILTLTW---FLAAGLKWghEAIEANSQYFHLAAWAVPAIKTIAILAMGKVDGDVLSG 167
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334 309 ICFVGYKNYRYRAGFVLAPIGLVLIVGGYFLIRGVMTLFSIKS--NHPGLLSEkaasKINETMLRLGIFGFLAFGFVLIT 386
Cdd:cd15034  168 VCFVGLSDVDALRGFVLAPLFVYLLIGTSFLLAGFVSLFRIRTvmKHDGTKTD----KLEKLMVRIGVFSVLYTVPATIV 243
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334 387 FSCHFYDFFNQAEWERSFRDYVLCQANVTIGLPtkqpiPDCEIKNRPSLLVEKINLFAMFGTGIAMSTWVWTKATLLIWR 466
Cdd:cd15034  244 IACYFYEQANRESWEKSWLSQNCKKYEDPCPCP-----PTPHPLDRPDFTVFMIKYLMTLIVGITSGFWIWSGKTLQSWR 318

                 .
gi 482677334 467 R 467
Cdd:cd15034  319 Q 319
7tmF_FZD7 cd15246
class F frizzled subfamily 7, member of 7-transmembrane G protein-coupled receptors; This ...
142-473 6.63e-48

class F frizzled subfamily 7, member of 7-transmembrane G protein-coupled receptors; This group includes subfamily 7 of the frizzled (FZD) family of seven transmembrane-spanning proteins, which constitute a novel and separate class of G-protein coupled receptors. This class F protein family consists of 10 isoforms (FZD1-10) in mammals. The FZDs are activated by the wingless/int-1 (WNT) family of secreted lipoglycoproteins and preferentially couple to stimulatory G proteins of the Gs family, which activate adenylate cyclase, but can also couple to G proteins of the Gi/Gq families. In the WNT/beta-catenin signaling pathway, the WNT ligand binds to FZD and a lipoprotein receptor-related protein (LRP) co-receptor. This leads to the stabilization and translocation of beta-catenin to the nucleus, where it induces the activation of TCF/LEF family transcription factors. The conserved cytoplasmic motif of FZD, Lys-Thr-X-X-X-Trp, is required for activation of the WNT/beta-catenin pathway, and for membrane localization and phosphorylation of Dsh (dishevelled) protein, a key component of the WNT pathway that relays the WNT signals from the activated receptor to downstream effector proteins. The WNT pathway plays a critical role in many developmental processes, such as cell-fate determination, cell proliferation, neural patterning, stem cell renewal, tissue homeostasis and repair, and tumorigenesis, among many others


Pssm-ID: 320374  Cd Length: 331  Bit Score: 167.89  E-value: 6.63e-48
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334 142 FTEAEHQDMHSYIAAFGAVTGLCTLFTLATFVADWRNSNrYPAVILFYVNACFFVGSIGWLAQFMDGARreIVC----RA 217
Cdd:cd15246    3 FKEEEVRFARLWVGIWSILCCASTLFTVLTYLVDMRRFS-YPERPIIFLSGCYFMVAVAYAAGFLLEDR--VVCverfSD 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334 218 DGTMRLGEPTSNEtlSCVIIFVIVYYALMAGVVWFVVLTYAWhtsFKALGTTY--QPLSGKTSYFHLLTWSLPFVLTVAI 295
Cdd:cd15246   80 DGYRTVAQGTKKE--GCTILFMVLYFFGMASSIWWVILSLTW---FLSAGMKWghEAIEANSQYFHLAAWAVPAVKTITI 154
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334 296 LAVAQVDGDSVSGICFVGYKNYRYRAGFVLAPIGLVLIVGGYFLIRGVMTLFSIKS--NHPGLLSEkaasKINETMLRLG 373
Cdd:cd15246  155 LAMGQVDGDLLSGVCYVGIYSVDALRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTimKHDGTKTE----KLEKLMVRIG 230
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334 374 IFGFLAFGFVLITFSCHFYDFFNQAEWERSFrdyvLCQANVTIGLPtkqpipdCEIKN----RPSLLVEKINLFAMFGTG 449
Cdd:cd15246  231 VFSVLYTVPATIVLACYFYEQAFRETWEKTW----LLQTCKRYAVP-------CPNNNfapmSPDFTVFMIKYLMTMIVG 299
                        330       340
                 ....*....|....*....|....
gi 482677334 450 IAMSTWVWTKATLLIWRRTWCRLT 473
Cdd:cd15246  300 ITSGFWIWSGKTLQSWRRFYHRLS 323
7tmF_FZD2 cd15245
class F frizzled subfamily 2, member of 7-transmembrane G protein-coupled receptors; This ...
141-473 2.23e-47

class F frizzled subfamily 2, member of 7-transmembrane G protein-coupled receptors; This group includes subfamily 2 of the frizzled (FZD) family of seven transmembrane-spanning proteins, which constitute a novel and separate class of G-protein coupled receptors. This class F protein family consists of 10 isoforms (FZD1-10) in mammals. The FZDs are activated by the wingless/int-1 (WNT) family of secreted lipoglycoproteins and preferentially couple to stimulatory G proteins of the Gs family, which activate adenylate cyclase, but can also couple to G proteins of the Gi/Gq families. In the WNT/beta-catenin signaling pathway, the WNT ligand binds to FZD and a lipoprotein receptor-related protein (LRP) co-receptor. This leads to the stabilization and translocation of beta-catenin to the nucleus, where it induces the activation of TCF/LEF family transcription factors. The conserved cytoplasmic motif of FZD, Lys-Thr-X-X-X-Trp, is required for activation of the WNT/beta-catenin pathway, and for membrane localization and phosphorylation of Dsh (dishevelled) protein, a key component of the WNT pathway that relays the WNT signals from the activated receptor to downstream effector proteins. The WNT pathway plays a critical role in many developmental processes, such as cell-fate determination, cell proliferation, neural patterning, stem cell renewal, tissue homeostasis and repair, and tumorigenesis, among many others.


Pssm-ID: 320373  Cd Length: 330  Bit Score: 166.35  E-value: 2.23e-47
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334 141 LFTEAEHQDMHSYIAAFGAVTGLCTLFTLATFVADWRNSnRYPAVILFYVNACFFVGSIGWLAQFMDGARreIVCR---- 216
Cdd:cd15245    2 FFSQDEIRFARIWILIWSVLCCASTFFTVTTYLVDMQRF-RYPERPIIFLSGCYTMVSVAYIAGFVLGDK--VVCNerfs 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334 217 ADGTMRLGEPTSNEtlSCVIIFVIVYYALMAGVVWFVVLTYAWhtsFKALGTTY--QPLSGKTSYFHLLTWSLPFVLTVA 294
Cdd:cd15245   79 EDGYKTVVQGTKKE--GCTILFMMLYFFSMASSIWWVILSLTW---FLAAGMKWghEAIEANSQYFHLAAWAVPAVKTIT 153
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334 295 ILAVAQVDGDSVSGICFVGYKNYRYRAGFVLAPIGLVLIVGGYFLIRGVMTLFSIKS--NHPGLLSEkaasKINETMLRL 372
Cdd:cd15245  154 ILAMGQIDGDLLSGVCFVGLNNIDPLRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTimKHDGTKTE----KLERLMVRI 229
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334 373 GIFGFLAFGFVLITFSCHFYDFFNQAEWERSFrdyvLCQANVTIGLPTK-QPIPdceiKNRPSLLVEKINLFAMFGTGIA 451
Cdd:cd15245  230 GVFSVLYTVPATIVIACYFYEQAFRQHWERSW----ISQNCKSLAIPCPlQYTP----RMTPDFTVYMIKYLMTLIVGIT 301
                        330       340
                 ....*....|....*....|..
gi 482677334 452 MSTWVWTKATLLIWRRTWCRLT 473
Cdd:cd15245  302 SGFWIWSGKTLHSWRKFYTRLT 323
7tmF_FZD1 cd15247
class F mammalian frizzled subfamily 1, member of 7-transmembrane G protein-coupled receptors; ...
142-473 2.24e-46

class F mammalian frizzled subfamily 1, member of 7-transmembrane G protein-coupled receptors; This group includes subfamily 1 of the frizzled (FZD) family of seven transmembrane-spanning proteins, which constitute a novel and separate class of G-protein coupled receptors. This class F protein family consists of 10 isoforms (FZD1-10) in mammals. The FZDs are activated by the wingless/int-1 (WNT) family of secreted lipoglycoproteins and preferentially couple to stimulatory G proteins of the Gs family, which activate adenylate cyclase, but can also couple to G proteins of the Gi/Gq families. In the WNT/beta-catenin signaling pathway, the WNT ligand binds to FZD and a lipoprotein receptor-related protein (LRP) co-receptor. This leads to the stabilization and translocation of beta-catenin to the nucleus, where it induces the activation of TCF/LEF family transcription factors. The conserved cytoplasmic motif of FZD, Lys-Thr-X-X-X-Trp, is required for activation of the WNT/beta-catenin pathway, and for membrane localization and phosphorylation of Dsh (dishevelled) protein, a key component of the WNT pathway that relays the WNT signals from the activated receptor to downstream effector proteins. The WNT pathway plays a critical role in many developmental processes, such as cell-fate determination, cell proliferation, neural patterning, stem cell renewal, tissue homeostasis and repair, and tumorigenesis, among many others.


Pssm-ID: 320375  Cd Length: 341  Bit Score: 164.06  E-value: 2.24e-46
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334 142 FTEAEHQDMHSYIAAFGAVTGLCTLFTLATFVADWRNSNrYPAVILFYVNACFFVGSIGWLAQFMdgARREIVCR----A 217
Cdd:cd15247   13 FGPEELRFARIWIGIWSVLCCASTLFTVLTYLVDMKRFS-YPERPIIFLSGCYTMVAIAYIAGFL--LEDKVVCNdkfaE 89
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334 218 DGTMRLGEPTSNEtlSCVIIFVIVYYALMAGVVWFVVLTYAWhtsFKALGTTY--QPLSGKTSYFHLLTWSLPFVLTVAI 295
Cdd:cd15247   90 DGIKTVAQGTKKE--GCTILFMMLYFFSMASSIWWVILSLTW---FLAAGMKWghEAIEANSQYFHLAAWAVPAIKTITI 164
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334 296 LAVAQVDGDSVSGICFVGYKNYRYRAGFVLAPIGLVLIVGGYFLIRGVMTLFSIKS--NHPGLLSEkaasKINETMLRLG 373
Cdd:cd15247  165 LAVGQVDGDVLSGVCFVGINNVDALRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTimKHDGTKTE----KLEKLMVRIG 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334 374 IFGFLAFGFVLITFSCHFYDFFNQAEWERSFrdyvLCQANVTIGLPTKQ-PIPDCEiknrPSLLVEKINLFAMFGTGIAM 452
Cdd:cd15247  241 IFSVLYTVPATIVIACYFYEQAFREQWERSW----ISQSCKTYAIPCPAhSHPPMS----PDFTVFMIKYLMTLIVGITS 312
                        330       340
                 ....*....|....*....|.
gi 482677334 453 STWVWTKATLLIWRRTWCRLT 473
Cdd:cd15247  313 GFWIWSGKTLNSWRKFYTRLT 333
7tmF_FZD5 cd15249
class F frizzled subfamily 5, member of 7-transmembrane G protein-coupled receptors; This ...
140-467 7.34e-46

class F frizzled subfamily 5, member of 7-transmembrane G protein-coupled receptors; This group includes subfamily 5 of the frizzled (FZD) family of seven transmembrane-spanning proteins, which constitute a novel and separate class of GPCRs, and its closely related proteins. This class F protein family consists of 10 isoforms (FZD1-10) in mammals. The FZDs are activated by the wingless/int-1 (WNT) family of secreted lipoglycoproteins and preferentially couple to stimulatory G proteins of the Gs family, which activate adenylate cyclase, but can also couple to G proteins of the Gi/Gq families. In the WNT/beta-catenin signaling pathway, the WNT ligand binds to FZD and a lipoprotein receptor-related protein (LRP) co-receptor. This leads to the stabilization and translocation of beta-catenin to the nucleus, where it induces the activation of TCF/LEF family transcription factors. The conserved cytoplasmic motif of FZD, Lys-Thr-X-X-X-Trp, is required for activation of the WNT/beta-catenin pathway, and for membrane localization and phosphorylation of Dsh (dishevelled) protein, a key component of the WNT pathway that relays the WNT signals from the activated receptor to downstream effector proteins. The WNT pathway plays a critical role in many developmental processes, such as cell-fate determination, cell proliferation, neural patterning, stem cell renewal, tissue homeostasis and repair, and tumorigenesis, among many others.


Pssm-ID: 320377  Cd Length: 310  Bit Score: 161.65  E-value: 7.34e-46
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334 140 PLFTEAEHQDMHSYIAAFGAVTGLCTLFTLATFVADWRNSnRYPAVILFYVNACFFVGSIGWLAQFMDGARReIVCRADG 219
Cdd:cd15249    1 PYFSQDERTFATFWIGLWSVLCFISTFTTVATFLIDMERF-RYPERPIIFLSACYLFVSLGYIVRLVVGHES-VACNREH 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334 220 TMRLGEPTSNETlsCVIIFVIVYYALMAGVVWFVVLTYAWhtsFKALGTTY--QPLSGKTSYFHLLTWSLPFVLTVAILA 297
Cdd:cd15249   79 NHIHYETTGPAL--CTIVFLLIYFFGMASSIWWVILSFTW---FLAAGMKWgnEAIAGYSQYFHLAAWLIPSVKSIAVLA 153
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334 298 VAQVDGDSVSGICFVGYKNYRYRAGFVLAPIGLVLIVGGYFLIRGVMTLFSIKS--NHPGLLSEkaasKINETMLRLGIF 375
Cdd:cd15249  154 LSSVDGDPVAGICYVGNQNLNNLRGFVLAPLVVYLFTGTLFLLAGFVSLFRIRSviKQGGTKTD----KLEKLMIRIGIF 229
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334 376 GFLAFGFVLITFSCHFYDFFNQAEWERSfrdyvlcqanvtigLPTKQPIPDCEIKNRPSLLVEKINLFAMFGTGIAMSTW 455
Cdd:cd15249  230 TVLYTVPATIVVACYVYEQHYRESWEAA--------------LNCSCPGDDTQPRARPDYAVFMLKYFMCLVVGITSGVW 295
                        330
                 ....*....|..
gi 482677334 456 VWTKATLLIWRR 467
Cdd:cd15249  296 IWSGKTLESWRR 307
7tmF_FZD8 cd15250
class F frizzled subfamily 8, member of 7-transmembrane G protein-coupled receptors; This ...
140-466 8.70e-44

class F frizzled subfamily 8, member of 7-transmembrane G protein-coupled receptors; This group includes subfamily 8 of the frizzled (FZD) family of seven transmembrane-spanning proteins, which constitute a novel and separate class of GPCRs, and its closely related proteins. This class F protein family consists of 10 isoforms (FZD1-10) in mammals. The FZDs are activated by the wingless/int-1 (WNT) family of secreted lipoglycoproteins and preferentially couple to stimulatory G proteins of the Gs family, which activate adenylate cyclase, but can also couple to G proteins of the Gi/Gq families. In the WNT/beta-catenin signaling pathway, the WNT ligand binds to FZD and a lipoprotein receptor-related protein (LRP) co-receptor. This leads to the stabilization and translocation of beta-catenin to the nucleus, where it induces the activation of TCF/LEF family transcription factors. The conserved cytoplasmic motif of FZD, Lys-Thr-X-X-X-Trp, is required for activation of the WNT/beta-catenin pathway, and for membrane localization and phosphorylation of Dsh (dishevelled) protein, a key component of the WNT pathway that relays the WNT signals from the activated receptor to downstream effector proteins. The WNT pathway plays a critical role in many developmental processes, such as cell-fate determination, cell proliferation, neural patterning, stem cell renewal, tissue homeostasis and repair, and tumorigenesis, among many others.


Pssm-ID: 320378  Cd Length: 314  Bit Score: 156.24  E-value: 8.70e-44
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334 140 PLFTEAEHQDMHSYIAAFGAVTGLCTLFTLATFVADWRNSnRYPAVILFYVNACFFVGSIGWLAQFMDGarREIVCRADG 219
Cdd:cd15250    1 PYFSQEERTFTAFWIGLWSVLCFLSTFATVSTFLIDMERF-KYPERPIIFLSACYLFVSLGYLVRLIAG--HEKVACSRG 77
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334 220 TMRLGEPTSNETLS---CVIIFVIVYYALMAGVVWFVVLTYAWhtsFKALGTTY--QPLSGKTSYFHLLTWSLPFVLTVA 294
Cdd:cd15250   78 ALAEVEHIHYETTGpalCTVVFLLIYFFGMASSIWWVILSLTW---FLAAGMKWgnEAIAGYSQYFHLAAWLIPSVKSIA 154
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334 295 ILAVAQVDGDSVSGICFVGYKNYRYRAGFVLAPIGLVLIVGGYFLIRGVMTLFSIKSnhpgLLSEKAAS--KINETMLRL 372
Cdd:cd15250  155 VLALSSVDGDPVAGICYVGNQNLDNLRGFVLAPLVIYLFIGTMFLLAGFVSLFRIRS----VIKQGGTKtdKLEKLMIRI 230
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334 373 GIFGFLAFGFVLITFSCHFYDFFNQAEWErsfrdyvlcqanVTIGLPTKQPIPDcEIKnRPSLLVEKINLFAMFGTGIAM 452
Cdd:cd15250  231 GIFTVLYTVPATIVVACYFYEQHNRQRWE------------ITHNCNCLRDQPD-QAR-RPDYAVFMLKYFMCLVVGITS 296
                        330
                 ....*....|....
gi 482677334 453 STWVWTKATLLIWR 466
Cdd:cd15250  297 GVWTWSGKTLESWR 310
7tmF_FZD4 cd15038
class F frizzled subfamily 4, member of 7-transmembrane G protein-coupled receptors; This ...
141-467 3.14e-42

class F frizzled subfamily 4, member of 7-transmembrane G protein-coupled receptors; This group includes subfamily 4 of the frizzled (FZD) family of seven transmembrane-spanning proteins, which constitute a novel and separate class of GPCRs, and its closely related proteins. This class F protein family consists of 10 isoforms (FZD1-10) in mammals. The FZDs are activated by the wingless/int-1 (WNT) family of secreted lipoglycoproteins and preferentially couple to stimulatory G proteins of the Gs family, which activate adenylate cyclase, but can also couple to G proteins of the Gi/Gq families. In the WNT/beta-catenin signaling pathway, the WNT ligand binds to FZD and a lipoprotein receptor-related protein (LRP) co-receptor. This leads to the stabilization and translocation of beta-catenin to the nucleus, where it induces the activation of TCF/LEF family transcription factors. The conserved cytoplasmic motif of FZD, Lys-Thr-X-X-X-Trp, is required for activation of the WNT/beta-catenin pathway, and for membrane localization and phosphorylation of Dsh (dishevelled) protein, a key component of the WNT pathway that relays the WNT signals from the activated receptor to downstream effector proteins. The WNT pathway plays a critical role in many developmental processes, such as cell-fate determination, cell proliferation, neural patterning, stem cell renewal, tissue homeostasis and repair, and tumorigenesis, among many others.


Pssm-ID: 320166  Cd Length: 304  Bit Score: 151.84  E-value: 3.14e-42
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334 141 LFTEAEHQDMHSYIAAFGAVTGLCTLFTLATFVADWRNSnRYPAVILFYVNACFFVGSIGWLAQFMDGaRREIVCRADGT 220
Cdd:cd15038    2 LFTQSDKEFADIWMAIWAGLCFISTLFTVLTFLIDSGRF-KYPERPIIFLSMCYNIYSIAYIVRLLAG-RESISCDLDSQ 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334 221 ----MRLGEPTSNetLSCVIIFVIVYYALMAGVVWFVVLTYAWHTSfKALGTTYQPLSGKTSYFHLLTWSLPFVLTVAIL 296
Cdd:cd15038   80 tavsILIQEGLEN--TGCAIVFLLLYFFGMASSIWWVILTLTWFLA-AGLKWGHEAIQMHSSYFHIAAWALPAVKTIVIL 156
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334 297 AVAQVDGDSVSGICFVGYKNYRYRAGFVLAPIGLVLIVGGYFLIRGVMTLFSIKSN--HPGLLSEkaasKINETMLRLGI 374
Cdd:cd15038  157 VMRVVDADELTGLCYVGNQNLDALLGFVVAPLFTYLVIGTLFLIAGFVALFRIRSQlqRDGTKTD----KLERLMVRIGI 232
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334 375 FGFLAFGFVLITFSCHFYDFFNQAEWERSfrdyvlcqanvtiglptkqpipdcEIKNRPSLLVEKINLFAMFGTGIAMST 454
Cdd:cd15038  233 FSVLYTVPATCVIACYFYEYSNRDLWYYG------------------------GSAARPNMEVFMLKIFMSLVVGITSGM 288
                        330
                 ....*....|...
gi 482677334 455 WVWTKATLLIWRR 467
Cdd:cd15038  289 WIWSAKTLSSWRN 301
7tmF_FZD10 cd15037
class F frizzled subfamily 10, member of 7-transmembrane G protein-coupled receptors; This ...
153-466 5.75e-41

class F frizzled subfamily 10, member of 7-transmembrane G protein-coupled receptors; This group includes subfamily 10 of the frizzled (FZD) family of seven transmembrane-spanning proteins, which constitute a novel and separate class of GPCRs, and its closely related proteins. This class F protein family consists of 10 isoforms (FZD1-10) in mammals. The FZDs are activated by the wingless/int-1 (WNT) family of secreted lipoglycoproteins and preferentially couple to stimulatory G proteins of the Gs family, which activate adenylate cyclase, but can also couple to G proteins of the Gi/Gq families. In the WNT/beta-catenin signaling pathway, the WNT ligand binds to FZD and a lipoprotein receptor-related protein (LRP) co-receptor. This leads to the stabilization and translocation of beta-catenin to the nucleus, where it induces the activation of TCF/LEF family transcription factors. The conserved cytoplasmic motif of FZD, Lys-Thr-X-X-X-Trp, is required for activation of the WNT/beta-catenin pathway, and for membrane localization and phosphorylation of Dsh (dishevelled) protein, a key component of the WNT pathway that relays the WNT signals from the activated receptor to downstream effector proteins. The WNT pathway plays a critical role in many developmental processes, such as cell-fate determination, cell proliferation, neural patterning, stem cell renewal, tissue homeostasis and repair, and tumorigenesis, among many others.


Pssm-ID: 320165  Cd Length: 320  Bit Score: 148.98  E-value: 5.75e-41
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334 153 YIAAFGAVTGLCTLFTLATFVADwRNSNRYPAVILFYVNACFFVGSIGWLAQFMDGARrEIVCRADGTMRLGEPTSNETL 232
Cdd:cd15037   14 WIAIWSILCFFSSAFTVLTFLID-PQRFKYPERPIIFLSMCYCVYSVGYIIRLFAGAE-SIACDRDSGQLYVIQEGLEST 91
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334 233 SCVIIFVIVYYALMAGVVWFVVLTYAWhtsFKALGTTY--QPLSGKTSYFHLLTWSLPFVLTVAILAVAQVDGDSVSGIC 310
Cdd:cd15037   92 GCTIVFLILYYFGMASSLWWVILTLTW---FLAAGKKWghEAIEANSSYFHLAAWAIPAVKTIMILVMRRVAGDELTGVC 168
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334 311 FVGYKNYRYRAGFVLAPIGLVLIVGGYFLIRGVMTLFSIKSNHPglLSEKAASKINETMLRLGIFGFLAFGFVLITFSCH 390
Cdd:cd15037  169 YVGSMDVNALTGFVLIPLACYLIIGTSFILSGFVALFHIRRVMK--TGGENTDKLEKLMVRIGVFSVLYTVPATCVIACY 246
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 482677334 391 FYDFFNQAEWErsfrdyvLCQANVTIGLPTKQPIPDCEIKNR-PSLLVEKINLFAMFGTGIAMSTWVWTKATLLIWR 466
Cdd:cd15037  247 FYERLNMDYWK-------ILATQQKCKMDNQTKTLDCVMTSSiPAVEIFMVKIFMLLVVGITSGMWIWTSKTLQSWQ 316
7tmF_FZD9 cd15036
class F frizzled subfamily 9, member of 7-transmembrane G protein-coupled receptors; This ...
153-466 7.08e-39

class F frizzled subfamily 9, member of 7-transmembrane G protein-coupled receptors; This group includes subfamily 9 of the frizzled (FZD) family of seven transmembrane-spanning proteins, which constitute a novel and separate class of GPCRs, and its closely related proteins. This class F protein family consists of 10 isoforms (FZD1-10) in mammals. The FZDs are activated by the wingless/int-1 (WNT) family of secreted lipoglycoproteins and preferentially couple to stimulatory G proteins of the Gs family, which activate adenylate cyclase, but can also couple to G proteins of the Gi/Gq families. In the WNT/beta-catenin signaling pathway, the WNT ligand binds to FZD and a lipoprotein receptor-related protein (LRP) co-receptor. This leads to the stabilization and translocation of beta-catenin to the nucleus, where it induces the activation of TCF/LEF family transcription factors. The conserved cytoplasmic motif of FZD, Lys-Thr-X-X-X-Trp, is required for activation of the WNT/beta-catenin pathway, and for membrane localization and phosphorylation of Dsh (dishevelled) protein, a key component of the WNT pathway that relays the WNT signals from the activated receptor to downstream effector proteins. The WNT pathway plays a critical role in many developmental processes, such as cell-fate determination, cell proliferation, neural patterning, stem cell renewal, tissue homeostasis and repair, and tumorigenesis, among many others.


Pssm-ID: 320164  Cd Length: 320  Bit Score: 143.18  E-value: 7.08e-39
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334 153 YIAAFGAVTGLCTLFTLATFVADwRNSNRYPAVILFYVNACFFVGSIGWLAQFMDGARrEIVCRADGtmrlGEP----TS 228
Cdd:cd15036   14 WMAVWSTLCFVSTAFTVLTFLLD-PHRFQYPERPIIFLSMCYNVYSVAFLIRAVAGAE-SIACDREN----GALyiiqEG 87
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334 229 NETLSCVIIFVIVYYALMAGVVWFVVLTYAWhtsFKALGTTY--QPLSGKTSYFHLLTWSLPFVLTVAILAVAQVDGDSV 306
Cdd:cd15036   88 LESTGCTLVFLILYYFGMASSLWWVVLTLTW---FLAAGKKWghEAIESHGSYFHMAAWGIPALKTIVILTMRKVAGDEL 164
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334 307 SGICFVGYKNYRYRAGFVLAPIGLVLIVGGYFLIRGVMTLFSIKS--NHPGLLSEkaasKINETMLRLGIFGFLAFGFVL 384
Cdd:cd15036  165 TGLCYVGSMDVSALTGFVLVPLSCYLVTGTSFLLTGFVALFHIRKvmKTGGTNTE----KLEKLMVKIGVFSILYTVPAT 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334 385 ITFSCHFYDFFNQAEWERSFRDyvlcQANVTigLPTKQPiPDCEIKNR-PSLLVEKINLFAMFGTGIAMSTWVWTKATLL 463
Cdd:cd15036  241 CVIVCYFYERLNMDYWDLRALE----ESCRT--VPGRRR-PDCSLPHSvPTVAVFMLKIFMSLVVGITSGVWVWSSKTLQ 313

                 ...
gi 482677334 464 IWR 466
Cdd:cd15036  314 TWQ 316
Cytochrom_B562 pfam07361
Cytochrome b562. This family contains the bacterial cytochrome b562. This forms a four-helix ...
6-108 1.17e-35

Cytochrome b562. This family contains the bacterial cytochrome b562. This forms a four-helix bundle that non-covalently binds a single heme prosthetic group..


Pssm-ID: 377821  Cd Length: 101  Bit Score: 127.78  E-value: 1.17e-35
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334    6 LEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDkspDSPEMKDFRHGFDILVGQIDDALKLANEG 85
Cdd:pfam07361   1 LKEDMKQMKLAYKQAAKADDAAEFKKALAQLRAAAEDAKEATPPKLEG---DSEEQKDYQEGMDKLIDQLDKADALADAG 77
                          90       100
                  ....*....|....*....|...
gi 482677334   86 KVKEAQAAAEQLKTTRNAYIQKY 108
Cdd:pfam07361  78 KLDEAKAALKELDDLRKEYHKKF 100
7tmF_FZD3 cd15033
class F frizzled subfamily 3, member of 7-transmembrane G protein-coupled receptors; This ...
158-465 3.70e-35

class F frizzled subfamily 3, member of 7-transmembrane G protein-coupled receptors; This group includes subfamily 3 of the frizzled (FZD) family of seven transmembrane-spanning proteins, which constitute a novel and separate class of GPCRs, and its closely related proteins. This class F protein family consists of 10 isoforms (FZD1-10) in mammals. The FZDs are activated by the wingless/int-1 (WNT) family of secreted lipoglycoproteins and preferentially couple to stimulatory G proteins of the Gs family, which activate adenylate cyclase, but can also couple to G proteins of the Gi/Gq families. In the WNT/beta-catenin signaling pathway, the WNT ligand binds to FZD and a lipoprotein receptor-related protein (LRP) co-receptor. This leads to the stabilization and translocation of beta-catenin to the nucleus, where it induces the activation of TCF/LEF family transcription factors. The conserved cytoplasmic motif of FZD, Lys-Thr-X-X-X-Trp, is required for activation of the WNT/beta-catenin pathway, and for membrane localization and phosphorylation of Dsh (dishevelled) protein, a key component of the WNT pathway that relays the WNT signals from the activated receptor to downstream effector proteins. The WNT pathway plays a critical role in many developmental processes, such as cell-fate determination, cell proliferation, neural patterning, stem cell renewal, tissue homeostasis and repair, and tumorigenesis, among many others.


Pssm-ID: 320161  Cd Length: 321  Bit Score: 133.15  E-value: 3.70e-35
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334 158 GAVTGLC---TLFTLATFVADwRNSNRYPAVILFYVNACFFVGSIGWLAQFMDGARreIVCRADGTMRLGEPT---SNET 231
Cdd:cd15033   16 GVISIVClsaTLFTFLTFLID-VTRFRYPERPIIFYAVCYMMVSLIFFIGFLLEDR--VACNAASPGQYKASTvtqGSHN 92
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334 232 LSCVIIFVIVYYALMAGVVWFVVLTYAWH-TSFKALGTtyQPLSGKTSYFHLLTWSLPFVLTVAILAVAQVDGDSVSGIC 310
Cdd:cd15033   93 KACTMLFMVLYFFTMAGSVWWVILTITWFlAAVPKWGS--EAIEKKALLFHASAWGIPGTLTIILLAMNKIEGDNISGVC 170
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334 311 FVGYKNYRYRAGFVLAPIGLVLIVGGYFLIRGVMTLFSIKSNHPglLSEKAASKINETMLRLGIFGFLAFGFVLITFSCH 390
Cdd:cd15033  171 FVGLYDVDALRYFVLAPLCLDVVVGVSLLLAGIISLNRVRIEIP--LEKENQDKLVKFMIRIGVFSVLYLVPLLVVIGCY 248
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334 391 FYDFFNQAEWERSF-----RDYVLcqanvtiglptkqPIP-DCEIKNRPSLLVEKINLFAMFGTGIAMSTWVWTKATLLI 464
Cdd:cd15033  249 FYEQAYRGVWETTWvqercREYHI-------------PCPyKVTQTSRPDLILFLMKYLMALVVGIPSVFWVGSKKTCFE 315

                 .
gi 482677334 465 W 465
Cdd:cd15033  316 W 316
7tmF_FZD3_FZD6-like cd15910
class F frizzled subfamilies 3, 6 and related proteins; member of 7-transmembrane G ...
152-465 1.47e-33

class F frizzled subfamilies 3, 6 and related proteins; member of 7-transmembrane G protein-coupled receptors; This group includes subfamilies 3 and 6 of the frizzled (FZD) family of seven transmembrane-spanning proteins, which constitute a novel and separate class of GPCRs, and their closely related proteins. This class F protein family consists of 10 isoforms (FZD1-10) in mammals. The FZDs are activated by the wingless/int-1 (WNT) family of secreted lipoglycoproteins and preferentially couple to stimulatory G proteins of the Gs family, which activate adenylate cyclase, but can also couple to G proteins of the Gi/Gq families. In the WNT/beta-catenin signaling pathway, the WNT ligand binds to FZD and a lipoprotein receptor-related protein (LRP) co-receptor. This leads to the stabilization and translocation of beta-catenin to the nucleus, where it induces the activation of TCF/LEF family transcription factors. The conserved cytoplasmic motif of FZD, Lys-Thr-X-X-X-Trp, is required for activation of the WNT/beta-catenin pathway, and for membrane localization and phosphorylation of Dsh (dishevelled) protein, a key component of the WNT pathway that relays the WNT signals from the activated receptor to downstream effector proteins. The WNT pathway plays a critical role in many developmental processes, such as cell-fate determination, cell proliferation, neural patterning, stem cell renewal, tissue homeostasis and repair, and tumorigenesis, among many others.


Pssm-ID: 320576  Cd Length: 321  Bit Score: 128.82  E-value: 1.47e-33
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334 152 SYIAAFGAVTGLCTLFTLATFVADwRNSNRYPAVILFYVNACFFVGSIGWLAQFMDGARreIVCR-ADGTMRLGEPT--S 228
Cdd:cd15910   13 YFIGVVSILCLLATLFTFLTFLID-VNRFRYPERPIIFYAVCYFVVSLIFFVGFLLGDD--VACNhAIMDENNGATVveG 89
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334 229 NETLSCVIIFVIVYYALMAGVVWFVVLTYAWhtsFKALGTTY--QPLSGKTSYFHLLTWSLPFVLTVAILAVAQVDGDSV 306
Cdd:cd15910   90 SRNKACTILFMILYFFTMAGTVWWVILTITW---FLAAGFKWgsEAIEKKALYFHALAWGIPGVLTMVLLATNKIEGDNI 166
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334 307 SGICFVGYKNYRYRAGFVLAPIGLVLIVGGYFLIRGVMTLFSIKSNHPglLSEKAASKINETMLRLGIFGFLAFGFVLIT 386
Cdd:cd15910  167 SGVCFVGLYDSDGLRFFVLLPLCLYVLVGMSLLLAGIICLNRVRKSIH--DDETNQEKLAKFMIRIGVFSILYLVPLLTL 244
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334 387 FSCHFYDFFNQAEWE-----RSFRDYvlcqanvtiGLPTKQPIpdcEIKNRPSLLVEKINLFAMFGTGIAMSTWVWTKAT 461
Cdd:cd15910  245 IGCYAYEQSNRKSWEstwvvRNCRRY---------HIPCPQLA---QGNPRPGLFLFCIKYLMTLIVGIPPVFWVGSKKT 312

                 ....
gi 482677334 462 LLIW 465
Cdd:cd15910  313 CAEW 316
7tmF_FZD6 cd15032
class F frizzled subfamily 6, member of 7-transmembrane G protein-coupled receptors; This ...
142-465 1.09e-31

class F frizzled subfamily 6, member of 7-transmembrane G protein-coupled receptors; This group includes subfamily 6 of the frizzled (FZD) family of seven transmembrane-spanning proteins, which constitute a novel and separate class of GPCRs, and its closely related proteins. This class F protein family consists of 10 isoforms (FZD1-10) in mammals. The FZDs are activated by the wingless/int-1 (WNT) family of secreted lipoglycoproteins and preferentially couple to stimulatory G proteins of the Gs family, which activate adenylate cyclase, but can also couple to G proteins of the Gi/Gq families. In the WNT/beta-catenin signaling pathway, the WNT ligand binds to FZD and a lipoprotein receptor-related protein (LRP) co-receptor. This leads to the stabilization and translocation of beta-catenin to the nucleus, where it induces the activation of TCF/LEF family transcription factors. The conserved cytoplasmic motif of FZD, Lys-Thr-X-X-X-Trp, is required for activation of the WNT/beta-catenin pathway, and for membrane localization and phosphorylation of Dsh (dishevelled) protein, a key component of the WNT pathway that relays the WNT signals from the activated receptor to downstream effector proteins. The WNT pathway plays a critical role in many developmental processes, such as cell-fate determination, cell proliferation, neural patterning, stem cell renewal, tissue homeostasis and repair, and tumorigenesis, among many others.


Pssm-ID: 320160  Cd Length: 321  Bit Score: 123.80  E-value: 1.09e-31
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334 142 FTEAEHQDMHSYIAAFGAVTGLCTLFTLATFVADWRNSnRYPAVILFYVNACFFVGSIGWLAQFMDGARreIVC-RADGT 220
Cdd:cd15032    3 FKSDELDFAKSFIGIVSIFCLCATLFTFLTFLIDVKRF-RYPERPIIYYSVCYSIVSLMYFIGFLLGNS--TACnKADEK 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334 221 MRLGEPT--SNETLSCVIIFVIVYYALMAGVVWFVVLTYAWhtsFKALGTTY--QPLSGKTSYFHLLTWSLPFVLTVAIL 296
Cdd:cd15032   80 LELGDTVvlGSQNKACTVLFMLLYFFTMAGTIWWVILTITW---FLAAGRKWscEAIEQKALWFHAVAWGIPGFLTIMLL 156
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334 297 AVAQVDGDSVSGICFVGYKNYRYRAGFVLAPIGLVLIVGGYFLIRGVMTLFSIKS--NHPGLLSEkaasKINETMLRLGI 374
Cdd:cd15032  157 AMNKVEGDNISGVCFVGLYDLDASRYFVLLPLCLCVFVGLSLLLAGIISLNHVRQviQHDGRNQE----KLKKFMIRIGV 232
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334 375 FGFLAFGFVLITFSCHFYDFFNQAEWERSFRDYVLCQANVTIGLPTKQPipdceikNRPSLLVEKINLFAMFGTGIAMST 454
Cdd:cd15032  233 FSGLYLVPLVTLLGCYVYEQVYRRTWEITWVSDHCQQYHIPCPYQAKAV-------ARPELALFLIKYLMTLIVGISAVF 305
                        330
                 ....*....|.
gi 482677334 455 WVWTKATLLIW 465
Cdd:cd15032  306 WVGSKKTCSEW 316
7tmF_FZD3_insect cd15031
class F insect frizzled subfamily 3, member of 7-transmembrane G protein-coupled receptors; ...
141-467 1.26e-18

class F insect frizzled subfamily 3, member of 7-transmembrane G protein-coupled receptors; This group represents subfamily 3 of the frizzled (FZD) family of seven transmembrane-spanning G protein-coupled proteins that is found in insects such as Drosophila melanogaster. This class F protein family consists of 10 isoforms (FZD1-10) in mammals. The FZDs are activated by the wingless/int-1 (WNT) family of secreted lipoglycoproteins and preferentially couple to stimulatory G proteins of the Gs family, which activate adenylate cyclase, but can also couple to G proteins of the Gi/Gq families. In the WNT/beta-catenin signaling pathway, the WNT ligand binds to FZD and a lipoprotein receptor-related protein (LRP) co-receptor. This leads to the stabilization and translocation of beta-catenin to the nucleus, where it induces the activation of TCF/LEF family transcription factors. The conserved cytoplasmic motif of FZD, Lys-Thr-X-X-X-Trp, is required for activation of the WNT/beta-catenin pathway, and for membrane localization and phosphorylation of Dsh (dishevelled) protein, a key component of the WNT pathway that relays the WNT signals from the activated receptor to downstream effector proteins. The WNT pathway plays a critical role in many developmental processes, such as cell-fate determination, cell proliferation, neural patterning, stem cell renewal, tissue homeostasis and repair, and tumorigenesis, among many others.


Pssm-ID: 320159  Cd Length: 311  Bit Score: 86.36  E-value: 1.26e-18
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334 141 LFTEAEHQDMHSYIAAFGAVTGLCTLFTLATFVADwRNSNRYPAVILFYVNACFFVGSIGWLAQFMDGARREIVCR---A 217
Cdd:cd15031    2 FYTTRQKKLVESWMLVLSAVSFILTLFALVTFWAE-PTRFGYPERPVLFMALCYNLISLCYLERGILGTFTNCSARslaI 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334 218 DGTMRLGEPTSNETLSCVIIFVIVYYALMAGVVWFVVLTYAWH-TSFKALGTTyqPLSGKTSYFHLLTWSLPFVLTVAIL 296
Cdd:cd15031   81 DCDDRYLRQDCLLTPQCLASFIITYYLSLSAASWWLIFALCWYlSSAKKWSSE--ALEKKSGLFHVLAWVPPLAPPIAAL 158
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334 297 AVAQVDGDSVSGICfvgYKNYRYRAGFVLAPIGLVLIVGGYFLIRGVMTLFSIKSNhpglLSEKAASKINETMLRLGIFG 376
Cdd:cd15031  159 LLERVSASELTGTC---TASGFVESSISELPALILLLLGLYLTIAALRSLLSLQQQ----LQSRLAHAPQRILARVSIFS 231
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334 377 FLAF---GFVLITFSChfydffnqaewERSFRDYVLCQANVTIGLPTKQPIPDCEIKnrPSLLveKINLFAMFGTGIAMs 453
Cdd:cd15031  232 LLYLipaAAALICKLC-----------ERWLQPVPECNALQEDCAPPATDNEFLSAL--PALL--RVFFFLIGGTATGL- 295
                        330
                 ....*....|....
gi 482677334 454 tWVWTKATLLIWRR 467
Cdd:cd15031  296 -WLWSRKSCESWRS 308
7tmB2_Adhesion cd15040
adhesion receptors, subfamily B2 of the class B family of seven-transmembrane G ...
152-391 1.56e-10

adhesion receptors, subfamily B2 of the class B family of seven-transmembrane G protein-coupled receptors; The B2 subfamily of class B GPCRs consists of cell-adhesion receptors with 33 members in humans and vertebrates. The adhesion receptors are characterized by the presence of large N-terminal extracellular domains containing a variety of structural motifs, which play critical roles in cell-cell adhesion and cell-matrix interactions, linked to a class B seven-transmembrane domain. These include, for example, EGF (epidermal growth factor)-like domains in CD97, Celsr1 (cadherin family member), Celsr2, Celsr3, EMR1 (EGF-module-containing mucin-like hormone receptor-like 1), EMR2, EMR3, and Flamingo; two laminin A G-type repeats and nine cadherin domains in Flamingo and its human orthologs Celsr1, Celsr2 and Celsr3; olfactomedin-like domains in the latrotoxin receptors; and five or four thrombospondin type 1 repeats in BAI1 (brain-specific angiogenesis inhibitor 1), BAI2 and BAI3. Furthermore, almost all adhesion receptors, except GPR123, contain an evolutionarily conserved GPCR- autoproteolysis inducing (GAIN) domain that undergoes autoproteolytic processing at the GPCR proteolysis site (GPS) motif located immediately N-terminal to the first transmembrane region, to generate N- and C-terminal fragments (NTF and CTF), which may serve important biological functions.


Pssm-ID: 320168  Cd Length: 253  Bit Score: 61.44  E-value: 1.56e-10
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334 152 SYIAAFG-AVTGLCTLFTLATFVADWRNSNRYPAVILFYVNACFFVGSIGWLAqfmdgarreivcradgtmrlGEPTSNE 230
Cdd:cd15040    5 SIITYIGcGLSLLGLLLTIITYILFRKLRKRKPTKILLNLCLALLLANLLFLF--------------------GINSTDN 64
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334 231 TLSCVIIFVIVYYALMAGVVWFVVLtyAWHTSFKALGTTYQPLSGKTSYFHLLTWSLPFVLTVAILAVAQVDGDSVSGIC 310
Cdd:cd15040   65 PVLCTAVAALLHYFLLASFMWMLVE--ALLLYLRLVKVFGTYPRHFILKYALIGWGLPLIIVIITLAVDPDSYGNSSGYC 142
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334 311 FVGYKNYRYraGFVLAPIGLVLIVGGYFLIRGVMTLFSIKSNHPgllsekaASKINETMLRLG-------------IFGF 377
Cdd:cd15040  143 WLSNGNGLY--YAFLGPVLLIILVNLVIFVLVLRKLLRLSAKRN-------KKKRKKTKAQLRaavslffllgltwIFGI 213
                        250
                 ....*....|....
gi 482677334 378 LAFGFVLITFSCHF 391
Cdd:cd15040  214 LAIFGARVVFQYLF 227
7tm_classB cd13952
class B family of seven-transmembrane G protein-coupled receptors. The class B of ...
163-398 3.43e-10

class B family of seven-transmembrane G protein-coupled receptors. The class B of seven-transmembrane GPCRs is classified into three major subfamilies: subfamily B1 (secretin-like receptor family), B2 (adhesion family), and B3 (Methuselah-like family). The class B receptors have been identified in all the vertebrates, from fishes to mammals, as well as invertebrates including Caenorhabditis elegans and Drosophila melanogaster, but are not present in plants, fungi or prokaryotes. The B1 subfamily comprises receptors for polypeptide hormones of 27-141 amino-acid residues such as secretin, glucagon, glucagon-like peptide (GLP), calcitonin gene-related peptide, parathyroid hormone (PTH), and corticotropin-releasing factor. These receptors contain the large N-terminal extracellular domain (ECD), which plays a critical role in hormone recognition by binding to the C-terminal portion of the peptide. On the other hand, the N-terminal segment of the hormone induces receptor activation by interacting with the receptor transmembrane domains and connecting extracellular loops, triggering intracellular signaling pathways. All members of the subfamily B1 receptors preferentially couple to G proteins of G(s) family, which positively stimulate adenylate cyclase, leading to increased intracellular cAMP formation and calcium influx. The subfamily B2 consists of cell-adhesion receptors with 33 members in humans and vertebrates. The adhesion receptors are characterized by the presence of large N-terminal extracellular domains containing a variety of structural motifs, which play critical roles in cell-cell adhesion and cell-matrix interactions, linked to a class B seven-transmembrane domain. These include, for example, EGF (epidermal growth factor)-like domains in CD97, Celsr1 (cadherin family member), Celsr2, Celsr3, EMR1 (EGF-module-containing mucin-like hormone receptor-like 1), EMR2, EMR3, and Flamingo; two laminin A G-type repeats and nine cadherin domains in Flamingo and its human orthologs Celsr1, Celsr2 and Celsr3; olfactomedin-like domains in the latrotoxin receptors; and five or four thrombospondin type 1 repeats in BAI1 (brain-specific angiogenesis inhibitor 1), BAI2 and BAI3. Almost all adhesion receptors, except GPR123, contain an evolutionarily conserved GPCR- autoproteolysis inducing (GAIN) domain that undergoes autoproteolytic processing at the GPCR proteolysis site (GPS) motif located immediately N-terminal to the first transmembrane region, to generate N- and C-terminal fragments (NTF and CTF), which may serve important biological functions. Furthermore, the subfamily B3 includes Methuselah (Mth) protein, which was originally identified in Drosophila as a GPCR affecting stress resistance and aging, and its closely related proteins.


Pssm-ID: 341314  Cd Length: 260  Bit Score: 60.31  E-value: 3.43e-10
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334 163 LCTLFTLATFVA--DWRNsnrYPAVILFYVNACFFVGSIGWLAqfmdgarreivcradgtmRLGEPTSNETLSCVIIFVI 240
Cdd:cd13952   17 VGLLLTIITYLLfpKLRN---LRGKILINLCLSLLLAQLLFLI------------------GQLLTSSDRPVLCKALAIL 75
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334 241 VYYALMAGVVWFVVLT-YAWHTSFKALGTTYqplSGKTSYFHLLTWSLPFVLTVAILAVAQVDGDSV----SGICFVGYK 315
Cdd:cd13952   76 LHYFLLASFFWMLVEAfDLYRTFVKVFGSSE---RRRFLKYSLYGWGLPLLIVIITAIVDFSLYGPSpgygGEYCWLSNG 152
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334 316 NYRYraGFVLAPIGLVLIVGGYFLIRGVMTLFSIKSNHPgllsekAASKINETMLRLGIFGFLafgFVL--ITFSCHFYD 393
Cdd:cd13952  153 NALL--WYFYGPVLLILLVNLVFFILTVRIILRKLRETP------KQSERKSDRKQLRAYLKL---FPLmgLTWIFGILA 221

                 ....*
gi 482677334 394 FFNQA 398
Cdd:cd13952  222 PFVGG 226
7tmB3_Methuselah-like cd15039
Methuselah-like subfamily B3, member of the class B family of seven-transmembrane G ...
227-380 2.44e-05

Methuselah-like subfamily B3, member of the class B family of seven-transmembrane G protein-coupled receptors. The subfamily B3 of class B GPCRs consists of Methuselah (Mth) and its closely related proteins found in bilateria. Mth was originally identified in Drosophila as a GPCR affecting stress resistance and aging. In addition to the seven transmembrane helices, Mth contains an N-terminal extracellular domain involved in ligand binding, and a third intracellular loop (IC3) required for the specificity of G-protein coupling. Drosophila Mth mutants showed an increase in average lifespan by 35% and greater resistance to a variety of stress factors, including starvation, high temperature, and paraquat-induced oxidative toxicity. Moreover, mutations in two endogenous peptide ligands of Methuselah, Stunted A and B, showed an increased in lifespan and resistance to oxidative stress induced by dietary paraquat. These results strongly suggest that the Stunted-Methuselah system plays important roles in stress response and aging.


Pssm-ID: 320167  Cd Length: 270  Bit Score: 45.68  E-value: 2.44e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334 227 TSNETLSCVIIFVIVYYALMAGVVWFVVLTY-AWHT-SFKALGTTYQPLSGKTSYFHLLTWSLPFVLTVAILAVAQVDGD 304
Cdd:cd15039   61 SLGDSTLCVALGILLHFFFLAAFFWLNVMSFdIWRTfRSKRSSSSRSKERKRFLRYSLYAWGVPLLLVAVTIIVDFSPPT 140
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 482677334 305 SV------SGICFVGYKNYRYRagFVLAPIGLVLIVGGYFLIRGVMTLFSIKSNhpgllSEKAASKINETMLRLGIFGFL 378
Cdd:cd15039  141 DSlrpgygEGSCWISNPWALLL--YFYGPVALLLLFNIILFILTAIRIRKVKKE-----TAKVQSRLRSDKQRFRLYLKL 213

                 ..
gi 482677334 379 AF 380
Cdd:cd15039  214 FV 215
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH