NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|49258417]
View 

Protein Classification

serine/threonine dehydratase family protein (domain architecture ID 10157824)

serine/threonine dehydratase family protein such as L-serine dehydratase/L-threonine deaminase, a pyridoxal-5'-phosphate (PLP)-dependent enzyme that catalyzes dehydration of L-Ser/Thr to yield pyruvate/ketobutyrate and ammonia

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
L-Ser-dehyd cd06448
Serine dehydratase is a pyridoxal phosphate (PLP)-dependent enzyme which catalyzes the ...
46-356 3.04e-154

Serine dehydratase is a pyridoxal phosphate (PLP)-dependent enzyme which catalyzes the conversion of L- , D-serine, or L-threonine to pyruvate/ketobutyrate and ammonia.


:

Pssm-ID: 107209  Cd Length: 316  Bit Score: 436.35  E-value: 3.04e-154
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417  46 KTPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRGIGHFCKRWAKQG---CAHFVCSSAGNAGMAAAYAARQLGVPATIV 122
Cdd:cd06448   1 KTPLIESTALSKTAGCNVFLKLENLQPSGSFKIRGIGHLCQKSAKQGlneCVHVVCSSGGNAGLAAAYAARKLGVPCTIV 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417 123 VPGTTPALTIERLKNEGATCKVVGELL-DEAFELAKALAKNNPGWVYIPPFDDPLIWEGHASIVKELKETLWE--KPGAI 199
Cdd:cd06448  81 VPESTKPRVVEKLRDEGATVVVHGKVWwEADNYLREELAENDPGPVYVHPFDDPLIWEGHSSMVDEIAQQLQSqeKVDAI 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417 200 ALSVGGGGLLCGVVQGLQECGWGDVPVIAMETFGAHSFHAATTAGKLVSLPKITSVAKALGVKTVGSQALKLFQEHPIFS 279
Cdd:cd06448 161 VCSVGGGGLLNGIVQGLERNGWGDIPVVAVETEGAHSLNASLKAGKLVTLPKITSVATSLGAKTVSSQALEYAQEHNIKS 240
                       250       260       270       280       290       300       310
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 49258417 280 EVISDQEAVAAIEKFVDDEKILVEPACGAALAAVYSHVIQKLQLEgNLRTPLPSLVVIVCGGSNISLAQLRALKEQL 356
Cdd:cd06448 241 EVVSDRDAVQACLRFADDERILVEPACGAALAVVYSGKILDLQLE-VLLTPLDNVVVVVCGGSNITLEQLKEYKKQL 316
 
Name Accession Description Interval E-value
L-Ser-dehyd cd06448
Serine dehydratase is a pyridoxal phosphate (PLP)-dependent enzyme which catalyzes the ...
46-356 3.04e-154

Serine dehydratase is a pyridoxal phosphate (PLP)-dependent enzyme which catalyzes the conversion of L- , D-serine, or L-threonine to pyruvate/ketobutyrate and ammonia.


Pssm-ID: 107209  Cd Length: 316  Bit Score: 436.35  E-value: 3.04e-154
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417  46 KTPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRGIGHFCKRWAKQG---CAHFVCSSAGNAGMAAAYAARQLGVPATIV 122
Cdd:cd06448   1 KTPLIESTALSKTAGCNVFLKLENLQPSGSFKIRGIGHLCQKSAKQGlneCVHVVCSSGGNAGLAAAYAARKLGVPCTIV 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417 123 VPGTTPALTIERLKNEGATCKVVGELL-DEAFELAKALAKNNPGWVYIPPFDDPLIWEGHASIVKELKETLWE--KPGAI 199
Cdd:cd06448  81 VPESTKPRVVEKLRDEGATVVVHGKVWwEADNYLREELAENDPGPVYVHPFDDPLIWEGHSSMVDEIAQQLQSqeKVDAI 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417 200 ALSVGGGGLLCGVVQGLQECGWGDVPVIAMETFGAHSFHAATTAGKLVSLPKITSVAKALGVKTVGSQALKLFQEHPIFS 279
Cdd:cd06448 161 VCSVGGGGLLNGIVQGLERNGWGDIPVVAVETEGAHSLNASLKAGKLVTLPKITSVATSLGAKTVSSQALEYAQEHNIKS 240
                       250       260       270       280       290       300       310
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 49258417 280 EVISDQEAVAAIEKFVDDEKILVEPACGAALAAVYSHVIQKLQLEgNLRTPLPSLVVIVCGGSNISLAQLRALKEQL 356
Cdd:cd06448 241 EVVSDRDAVQACLRFADDERILVEPACGAALAVVYSGKILDLQLE-VLLTPLDNVVVVVCGGSNITLEQLKEYKKQL 316
IlvA COG1171
Threonine dehydratase [Amino acid transport and metabolism];
45-354 1.50e-52

Threonine dehydratase [Amino acid transport and metabolism];


Pssm-ID: 224092  Cd Length: 347  Bit Score: 177.79  E-value: 1.50e-52
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417  45 VKTPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRGIGHFCKRWAKQGC--AHFVCSSAGNAGMAAAYAARQLGVPATIV 122
Cdd:COG1171  24 NPTPLQRSPSLSERLGAEIYLKRENLQPVGSFKIRGAYNKLSSLSEEEEraAGVIAASAGNHAQGVAYAAKRLGIKATIV 103
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417 123 VPGTTPALTIERLKNEGATCKVVGELLDEAFELAKALAKNNpGWVYIPPFDDPLIWEGHASIVKELKETLWEKPGAIals 202
Cdd:COG1171 104 MPETTPKIKVDATRGYGAEVILHGDNFDDAYAAAEELAEEE-GLTFVPPFDDPDVIAGQGTIALEILEQLPDLPDAV--- 179
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417 203 vggggllcgvvqgLQECGWG---------------DVPVIAMETFGAHSFHAATTAGKLVS-LPKITSVAKALGVKTVGS 266
Cdd:COG1171 180 -------------FVPVGGGglisgiatalkalspEIKVIGVEPEGAPSMYASLKAGKIVVvLPDVGTIADGLAVKRPGD 246
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417 267 QALKLFQEHPifSEVI--SDQEAVAAIEKFVDDEKILVEPACGAALAAVYSHVIQklQLEGnlrtplPSLVVIVCGGsNI 344
Cdd:COG1171 247 LTFEILRELV--DDIVlvDEDEICAAMRDLFERTKIIAEPAGALALAALLAGKIE--PLQG------KTVVVILSGG-NI 315
                       330
                ....*....|
gi 49258417 345 SLAQLRALKE 354
Cdd:COG1171 316 DFERLAEVLE 325
PALP pfam00291
Pyridoxal-phosphate dependent enzyme. Members of this family are all pyridoxal-phosphate ...
41-340 7.45e-52

Pyridoxal-phosphate dependent enzyme. Members of this family are all pyridoxal-phosphate dependent enzymes. This family includes: serine dehydratase EC:4.2.1.13 P20132, threonine dehydratase EC:4.2.1.16, tryptophan synthase beta chain EC:4.2.1.20, threonine synthase EC:4.2.99.2, cysteine synthase EC:4.2.99.8 P11096, cystathionine beta-synthase EC:4.2.1.22, 1-aminocyclopropane-1-carboxylate deaminase EC:4.1.99.4.


Pssm-ID: 366004  Cd Length: 294  Bit Score: 174.41  E-value: 7.45e-52
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417    41 EPLHVKTPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRGIGHFCKRwAKQGC--AHFVCSSAGNAGMAAAYAARQLGVP 118
Cdd:pfam00291   2 SLGIGPTPLVRLPRLSKELGVDVYLKLEDLNPTGSFKDRGALNLLLR-LKEGEggKTVVEASSGNHGRALAAAAARLGLK 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417   119 ATIVVPGTTPALTIERLKNEGATCKVVGELLDEAFELAKALAKNNPGWVYIPPFDDPLIWEGHASIVKELKETLWEKPGA 198
Cdd:pfam00291  81 CTIVVPEGAPPGKLLLMRALGAEVVLVGGDYDEAVAAARELAAEGPGAYYINQYDNPLNIEGYGTIGLEILEQLGGKPDA 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417   199 IALSVGGGGLLCGVVQGLQEcGWGDVPVIAMETFGAHSFHAAtTAGKLVSLPKITSVAKALGVKTV-GSQALKLFQEHPI 277
Cdd:pfam00291 161 VVVPVGGGGLIAGIARGLKE-LGPDVRIIGVEPEGAPALARS-LEARPVTLPVSDTIADGLGVGDVpGRLALDLLDEYVG 238
                         250       260       270       280       290       300
                  ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 49258417   278 FSEVISDQEAVAAIEKFVDDEKILVEPACGAALAAVysHVIQKLQLEGNLRTplpslVVIVCG 340
Cdd:pfam00291 239 EVVTVSDEEALEAMRLLARREGIVVEPSSAAALAAL--KLALAGELKGGDRV-----VVVLTG 294
PRK08198 PRK08198
threonine dehydratase; Provisional
46-344 2.61e-33

threonine dehydratase; Provisional


Pssm-ID: 236182 [Multi-domain]  Cd Length: 404  Bit Score: 127.95  E-value: 2.61e-33
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417   46 KTPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRG----IGhfcKRWAKQGCAHFVCSSAGNAGMAAAYAARQLGVPATI 121
Cdd:PRK08198  22 RTPLEYSRTLSELTGAEVYLKCENLQRTGSFKIRGaynkIA---SLSEEERARGVVAASAGNHAQGVAYAASLLGIKATI 98
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417  122 VVPGTTPALTIERLKNEGATCKVVGELLDEAFELAKALAKNNpGWVYIPPFDDPLIWEGHASIVKELKEtlwEKP----- 196
Cdd:PRK08198  99 VMPETAPLSKVKATRSYGAEVVLHGDVYDEALAKAQELAEET-GATFVHPFDDPDVIAGQGTIGLEILE---DLPdvdtv 174
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417  197 -------GAIAlsvggggllcgvvqglqecgwG----------DVPVIAMETFGAHSFHAATTAGKLVSLPKITSVAKAL 259
Cdd:PRK08198 175 vvpigggGLIS---------------------GvatavkalrpEVRVIGVQAEGAPAMPESLAAGRPVELESVDTIADGI 233
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417  260 GVKTVGSQALKLFQEHpiFSEVI--SDQEAVAAI----EKfvddEKILVEPACGAALAAVyshviqklqLEGNLRTPLPS 333
Cdd:PRK08198 234 AVKRPGDLTFEIIREL--VDDVVtvSDEEIARAIllllER----AKLVVEGAGAVSVAAL---------LSGKLDVKGKK 298
                        330
                 ....*....|.
gi 49258417  334 LVVIVCGGsNI 344
Cdd:PRK08198 299 VVAVLSGG-NI 308
ilvA_2Cterm TIGR01124
threonine ammonia-lyase, biosynthetic, long form; This model describes a form of threonine ...
45-355 6.76e-29

threonine ammonia-lyase, biosynthetic, long form; This model describes a form of threonine ammonia-lyase, a pyridoxal-phosphate dependent enzyme, with two copies of the threonine dehydratase C-terminal domain (pfam00585). Members with known function participate in isoleucine biosynthesis and are inhibited by isoleucine. Alternate name: threonine deaminase, threonine dehydratase. Forms scoring between the trusted and noise cutoff tend to branch with this subgroup of threonine ammonia-lyase phylogenetically but have only a single copy of the C-terminal domain. [Amino acid biosynthesis, Pyruvate family]


Pssm-ID: 130194 [Multi-domain]  Cd Length: 499  Bit Score: 116.76  E-value: 6.76e-29
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417    45 VKTPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRGIGHFCKRWAKQGCAHFV-CSSAGNAGMAAAYAARQLGVPATIVV 123
Cdd:TIGR01124  16 QETPLQKAAKLSERLGNRILIKREDLQPVFSFKLRGAYNKMAQLSPEQKARGViAASAGNHAQGVAFSAARLGLKALIVM 95
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417   124 PGTTPALTIERLKNEGATCKVVGELLDEAFELAKALAKNNpGWVYIPPFDDPLIWEGHASIVKELKETLWEKPGAIALSV 203
Cdd:TIGR01124  96 PETTPDIKVDAVRGFGGEVVLHGANFDDAKAKAIELSQEK-GLTFIHPFDDPLVIAGQGTLALEILRQVANPLDAVFVPV 174
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417   204 GGGGLLCGVVQGLQECgWGDVPVIAMETFGAHSFHAATTAGKLVSLPKITSVAKALGVKTVGSQALKLFQEHpIFSEVIS 283
Cdd:TIGR01124 175 GGGGLAAGVAALIKQL-MPEIKVIGVEPTDSDCMKQALDAGEPVDLDQVGLFADGVAVKRVGDETFRLCQQY-LDDIVTV 252
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 49258417   284 DQEAV-AAIEKFVDDEKILVEPACGAALAAVYSHVIQKlQLEGNlrtplpSLVVIVCgGSNISLAQLRALKEQ 355
Cdd:TIGR01124 253 DTDEVcAAIKDLFEDTRAVAEPAGALALAGLKKYVALH-GIRGQ------TLVAILS-GANMNFHRLRYVSER 317
 
Name Accession Description Interval E-value
L-Ser-dehyd cd06448
Serine dehydratase is a pyridoxal phosphate (PLP)-dependent enzyme which catalyzes the ...
46-356 3.04e-154

Serine dehydratase is a pyridoxal phosphate (PLP)-dependent enzyme which catalyzes the conversion of L- , D-serine, or L-threonine to pyruvate/ketobutyrate and ammonia.


Pssm-ID: 107209  Cd Length: 316  Bit Score: 436.35  E-value: 3.04e-154
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417  46 KTPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRGIGHFCKRWAKQG---CAHFVCSSAGNAGMAAAYAARQLGVPATIV 122
Cdd:cd06448   1 KTPLIESTALSKTAGCNVFLKLENLQPSGSFKIRGIGHLCQKSAKQGlneCVHVVCSSGGNAGLAAAYAARKLGVPCTIV 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417 123 VPGTTPALTIERLKNEGATCKVVGELL-DEAFELAKALAKNNPGWVYIPPFDDPLIWEGHASIVKELKETLWE--KPGAI 199
Cdd:cd06448  81 VPESTKPRVVEKLRDEGATVVVHGKVWwEADNYLREELAENDPGPVYVHPFDDPLIWEGHSSMVDEIAQQLQSqeKVDAI 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417 200 ALSVGGGGLLCGVVQGLQECGWGDVPVIAMETFGAHSFHAATTAGKLVSLPKITSVAKALGVKTVGSQALKLFQEHPIFS 279
Cdd:cd06448 161 VCSVGGGGLLNGIVQGLERNGWGDIPVVAVETEGAHSLNASLKAGKLVTLPKITSVATSLGAKTVSSQALEYAQEHNIKS 240
                       250       260       270       280       290       300       310
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 49258417 280 EVISDQEAVAAIEKFVDDEKILVEPACGAALAAVYSHVIQKLQLEgNLRTPLPSLVVIVCGGSNISLAQLRALKEQL 356
Cdd:cd06448 241 EVVSDRDAVQACLRFADDERILVEPACGAALAVVYSGKILDLQLE-VLLTPLDNVVVVVCGGSNITLEQLKEYKKQL 316
IlvA COG1171
Threonine dehydratase [Amino acid transport and metabolism];
45-354 1.50e-52

Threonine dehydratase [Amino acid transport and metabolism];


Pssm-ID: 224092  Cd Length: 347  Bit Score: 177.79  E-value: 1.50e-52
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417  45 VKTPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRGIGHFCKRWAKQGC--AHFVCSSAGNAGMAAAYAARQLGVPATIV 122
Cdd:COG1171  24 NPTPLQRSPSLSERLGAEIYLKRENLQPVGSFKIRGAYNKLSSLSEEEEraAGVIAASAGNHAQGVAYAAKRLGIKATIV 103
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417 123 VPGTTPALTIERLKNEGATCKVVGELLDEAFELAKALAKNNpGWVYIPPFDDPLIWEGHASIVKELKETLWEKPGAIals 202
Cdd:COG1171 104 MPETTPKIKVDATRGYGAEVILHGDNFDDAYAAAEELAEEE-GLTFVPPFDDPDVIAGQGTIALEILEQLPDLPDAV--- 179
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417 203 vggggllcgvvqgLQECGWG---------------DVPVIAMETFGAHSFHAATTAGKLVS-LPKITSVAKALGVKTVGS 266
Cdd:COG1171 180 -------------FVPVGGGglisgiatalkalspEIKVIGVEPEGAPSMYASLKAGKIVVvLPDVGTIADGLAVKRPGD 246
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417 267 QALKLFQEHPifSEVI--SDQEAVAAIEKFVDDEKILVEPACGAALAAVYSHVIQklQLEGnlrtplPSLVVIVCGGsNI 344
Cdd:COG1171 247 LTFEILRELV--DDIVlvDEDEICAAMRDLFERTKIIAEPAGALALAALLAGKIE--PLQG------KTVVVILSGG-NI 315
                       330
                ....*....|
gi 49258417 345 SLAQLRALKE 354
Cdd:COG1171 316 DFERLAEVLE 325
PALP pfam00291
Pyridoxal-phosphate dependent enzyme. Members of this family are all pyridoxal-phosphate ...
41-340 7.45e-52

Pyridoxal-phosphate dependent enzyme. Members of this family are all pyridoxal-phosphate dependent enzymes. This family includes: serine dehydratase EC:4.2.1.13 P20132, threonine dehydratase EC:4.2.1.16, tryptophan synthase beta chain EC:4.2.1.20, threonine synthase EC:4.2.99.2, cysteine synthase EC:4.2.99.8 P11096, cystathionine beta-synthase EC:4.2.1.22, 1-aminocyclopropane-1-carboxylate deaminase EC:4.1.99.4.


Pssm-ID: 366004  Cd Length: 294  Bit Score: 174.41  E-value: 7.45e-52
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417    41 EPLHVKTPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRGIGHFCKRwAKQGC--AHFVCSSAGNAGMAAAYAARQLGVP 118
Cdd:pfam00291   2 SLGIGPTPLVRLPRLSKELGVDVYLKLEDLNPTGSFKDRGALNLLLR-LKEGEggKTVVEASSGNHGRALAAAAARLGLK 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417   119 ATIVVPGTTPALTIERLKNEGATCKVVGELLDEAFELAKALAKNNPGWVYIPPFDDPLIWEGHASIVKELKETLWEKPGA 198
Cdd:pfam00291  81 CTIVVPEGAPPGKLLLMRALGAEVVLVGGDYDEAVAAARELAAEGPGAYYINQYDNPLNIEGYGTIGLEILEQLGGKPDA 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417   199 IALSVGGGGLLCGVVQGLQEcGWGDVPVIAMETFGAHSFHAAtTAGKLVSLPKITSVAKALGVKTV-GSQALKLFQEHPI 277
Cdd:pfam00291 161 VVVPVGGGGLIAGIARGLKE-LGPDVRIIGVEPEGAPALARS-LEARPVTLPVSDTIADGLGVGDVpGRLALDLLDEYVG 238
                         250       260       270       280       290       300
                  ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 49258417   278 FSEVISDQEAVAAIEKFVDDEKILVEPACGAALAAVysHVIQKLQLEGNLRTplpslVVIVCG 340
Cdd:pfam00291 239 EVVTVSDEEALEAMRLLARREGIVVEPSSAAALAAL--KLALAGELKGGDRV-----VVVLTG 294
Thr-dehyd cd01562
Threonine dehydratase: The first step in amino acid degradation is the removal of nitrogen. ...
45-344 3.39e-45

Threonine dehydratase: The first step in amino acid degradation is the removal of nitrogen. Although the nitrogen atoms of most amino acids are transferred to alpha-ketoglutarate before removal, the alpha-amino group of threonine can be directly converted into NH4+. The direct deamination is catalyzed by threonine dehydratase, in which pyridoxal phosphate (PLP) is the prosthetic group. Threonine dehydratase is widely distributed in all three major phylogenetic divisions.


Pssm-ID: 107205  Cd Length: 304  Bit Score: 157.26  E-value: 3.39e-45
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417  45 VKTPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRG----IGHFCKRWAKQGcahFVCSSAGNAGMAAAYAARQLGVPAT 120
Cdd:cd01562  16 RRTPLLTSPTLSELLGAEVYLKCENLQKTGSFKIRGaynkLLSLSEEERAKG---VVAASAGNHAQGVAYAAKLLGIPAT 92
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417 121 IVVPGTTPALTIERLKNEGATCKVVGELLDEAFELAKALAKNNpGWVYIPPFDDPLIWEGHASIVKELKETLWEkPGAIa 200
Cdd:cd01562  93 IVMPETAPAAKVDATRAYGAEVVLYGEDFDEAEAKARELAEEE-GLTFIHPFDDPDVIAGQGTIGLEILEQVPD-LDAV- 169
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417 201 lsvggggllcgvvqgLQECGWG---------------DVPVIAMETFGAHSFHAATTAGKLVSLPKITSVAKALGVKTVG 265
Cdd:cd01562 170 ---------------FVPVGGGgliagiatavkalspNTKVIGVEPEGAPAMAQSLAAGKPVTLPEVDTIADGLAVKRPG 234
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417 266 SQALKLFQEHPifSEVI--SDQEAVAAIEKFVDDEKILVEPACGAALAAVYSHviqKLQLEGNlrtplpSLVVIVCGGsN 343
Cdd:cd01562 235 ELTFEIIRKLV--DDVVtvSEDEIAAAMLLLFEREKLVAEPAGALALAALLSG---KLDLKGK------KVVVVLSGG-N 302

                .
gi 49258417 344 I 344
Cdd:cd01562 303 I 303
Trp-synth-beta_II cd00640
Tryptophan synthase beta superfamily (fold type II); this family of pyridoxal phosphate (PLP) ...
47-341 1.56e-44

Tryptophan synthase beta superfamily (fold type II); this family of pyridoxal phosphate (PLP)-dependent enzymes catalyzes beta-replacement and beta-elimination reactions. This CD corresponds to aminocyclopropane-1-carboxylate deaminase (ACCD), tryptophan synthase beta chain (Trp-synth_B), cystathionine beta-synthase (CBS), O-acetylserine sulfhydrylase (CS), serine dehydratase (Ser-dehyd), threonine dehydratase (Thr-dehyd), diaminopropionate ammonia lyase (DAL), and threonine synthase (Thr-synth). ACCD catalyzes the conversion of 1-aminocyclopropane-1-carboxylate to alpha-ketobutyrate and ammonia. Tryptophan synthase folds into a tetramer, where the beta chain is the catalytic PLP-binding subunit and catalyzes the formation of L-tryptophan from indole and L-serine. CBS is a tetrameric hemeprotein that catalyzes condensation of serine and homocysteine to cystathionine. CS is a homodimer that catalyzes the formation of L-cysteine from O-acetyl-L-serine. Ser-dehyd catalyzes the conversion of L- or D-serine to pyruvate and ammonia. Thr-dehyd is active as a homodimer and catalyzes the conversion of L-threonine to 2-oxobutanoate and ammonia. DAL is also a homodimer and catalyzes the alpha, beta-elimination reaction of both L- and D-alpha, beta-diaminopropionate to form pyruvate and ammonia. Thr-synth catalyzes the formation of threonine and inorganic phosphate from O-phosphohomoserine.


Pssm-ID: 107202 [Multi-domain]  Cd Length: 244  Bit Score: 153.44  E-value: 1.56e-44
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417  47 TPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRGIGHFCKRWAKQG---CAHFVCSSAGNAGMAAAYAARQLGVPATIVV 123
Cdd:cd00640   1 TPLVRLKRLSKLGGANIYLKLEFLNPTGSFKDRGALNLILLAEEEGklpKGVIIESTGGNTGIALAAAAARLGLKCTIVM 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417 124 PGTTPALTIERLKNEGATCKVVGELLDEAFELAKALAKNNPGWVYIPPFDDPLIWEGHASIVKELKETL-WEKPGAIals 202
Cdd:cd00640  81 PEGASPEKVAQMRALGAEVVLVPGDFDDAIALAKELAEEDPGAYYVNQFDNPANIAGQGTIGLEILEQLgGQKPDAV--- 157
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417 203 vggggllcgvvqglqecgwgdvpVIAMETFGAhsfhaattagklvslpkITSVAKAL-----GVKTVGSQAlklfqehpi 277
Cdd:cd00640 158 -----------------------VVPVGGGGN-----------------IAGIARALkellpNVKVIGVEP--------- 188
                       250       260       270       280       290       300
                ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 49258417 278 FSEVISDQEAVAAIEKFVDDEKILVEPACGAALAAVYSHVIQKLQLEgnlrtplpSLVVIVCGG 341
Cdd:cd00640 189 EVVTVSDEEALEAIRLLAREEGILVEPSSAAALAAALKLAKKLGKGK--------TVVVILTGG 244
PRK08198 PRK08198
threonine dehydratase; Provisional
46-344 2.61e-33

threonine dehydratase; Provisional


Pssm-ID: 236182 [Multi-domain]  Cd Length: 404  Bit Score: 127.95  E-value: 2.61e-33
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417   46 KTPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRG----IGhfcKRWAKQGCAHFVCSSAGNAGMAAAYAARQLGVPATI 121
Cdd:PRK08198  22 RTPLEYSRTLSELTGAEVYLKCENLQRTGSFKIRGaynkIA---SLSEEERARGVVAASAGNHAQGVAYAASLLGIKATI 98
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417  122 VVPGTTPALTIERLKNEGATCKVVGELLDEAFELAKALAKNNpGWVYIPPFDDPLIWEGHASIVKELKEtlwEKP----- 196
Cdd:PRK08198  99 VMPETAPLSKVKATRSYGAEVVLHGDVYDEALAKAQELAEET-GATFVHPFDDPDVIAGQGTIGLEILE---DLPdvdtv 174
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417  197 -------GAIAlsvggggllcgvvqglqecgwG----------DVPVIAMETFGAHSFHAATTAGKLVSLPKITSVAKAL 259
Cdd:PRK08198 175 vvpigggGLIS---------------------GvatavkalrpEVRVIGVQAEGAPAMPESLAAGRPVELESVDTIADGI 233
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417  260 GVKTVGSQALKLFQEHpiFSEVI--SDQEAVAAI----EKfvddEKILVEPACGAALAAVyshviqklqLEGNLRTPLPS 333
Cdd:PRK08198 234 AVKRPGDLTFEIIREL--VDDVVtvSDEEIARAIllllER----AKLVVEGAGAVSVAAL---------LSGKLDVKGKK 298
                        330
                 ....*....|.
gi 49258417  334 LVVIVCGGsNI 344
Cdd:PRK08198 299 VVAVLSGG-NI 308
ilvA_2Cterm TIGR01124
threonine ammonia-lyase, biosynthetic, long form; This model describes a form of threonine ...
45-355 6.76e-29

threonine ammonia-lyase, biosynthetic, long form; This model describes a form of threonine ammonia-lyase, a pyridoxal-phosphate dependent enzyme, with two copies of the threonine dehydratase C-terminal domain (pfam00585). Members with known function participate in isoleucine biosynthesis and are inhibited by isoleucine. Alternate name: threonine deaminase, threonine dehydratase. Forms scoring between the trusted and noise cutoff tend to branch with this subgroup of threonine ammonia-lyase phylogenetically but have only a single copy of the C-terminal domain. [Amino acid biosynthesis, Pyruvate family]


Pssm-ID: 130194 [Multi-domain]  Cd Length: 499  Bit Score: 116.76  E-value: 6.76e-29
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417    45 VKTPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRGIGHFCKRWAKQGCAHFV-CSSAGNAGMAAAYAARQLGVPATIVV 123
Cdd:TIGR01124  16 QETPLQKAAKLSERLGNRILIKREDLQPVFSFKLRGAYNKMAQLSPEQKARGViAASAGNHAQGVAFSAARLGLKALIVM 95
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417   124 PGTTPALTIERLKNEGATCKVVGELLDEAFELAKALAKNNpGWVYIPPFDDPLIWEGHASIVKELKETLWEKPGAIALSV 203
Cdd:TIGR01124  96 PETTPDIKVDAVRGFGGEVVLHGANFDDAKAKAIELSQEK-GLTFIHPFDDPLVIAGQGTLALEILRQVANPLDAVFVPV 174
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417   204 GGGGLLCGVVQGLQECgWGDVPVIAMETFGAHSFHAATTAGKLVSLPKITSVAKALGVKTVGSQALKLFQEHpIFSEVIS 283
Cdd:TIGR01124 175 GGGGLAAGVAALIKQL-MPEIKVIGVEPTDSDCMKQALDAGEPVDLDQVGLFADGVAVKRVGDETFRLCQQY-LDDIVTV 252
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 49258417   284 DQEAV-AAIEKFVDDEKILVEPACGAALAAVYSHVIQKlQLEGNlrtplpSLVVIVCgGSNISLAQLRALKEQ 355
Cdd:TIGR01124 253 DTDEVcAAIKDLFEDTRAVAEPAGALALAGLKKYVALH-GIRGQ------TLVAILS-GANMNFHRLRYVSER 317
ilvA_1Cterm TIGR01127
threonine ammonia-lyase, medium form; A form of threonine dehydratase with two copies of the ...
47-346 7.29e-29

threonine ammonia-lyase, medium form; A form of threonine dehydratase with two copies of the C-terminal domain pfam00585 is described by TIGR01124. This model describes a phylogenetically distinct form with a single copy of pfam00585. This form branches with the catabolic threonine dehydratase of E. coli; many members are designated as catabolic for this reason. However, the catabolic form lacks any pfam00585 domain. Many members of this model are found in species with other Ile biosynthetic enzymes. [Amino acid biosynthesis, Pyruvate family]


Pssm-ID: 130197 [Multi-domain]  Cd Length: 380  Bit Score: 115.23  E-value: 7.29e-29
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417    47 TPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRG----IGHFCKRWAKQGCahfVCSSAGNAGMAAAYAARQLGVPATIV 122
Cdd:TIGR01127   1 TPLIYSTTLSDITGSEVYLKLENLQKTGSFKIRGalnkIANLSEDQRQRGV---VAASAGNHAQGVAYAAKKFGIKAVIV 77
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417   123 VPGTTPALTIERLKNEGATCKVVGELLDEAFELAKALAKNNpGWVYIPPFDDPLIWEGHASIVKELKETLWEKPGAIALS 202
Cdd:TIGR01127  78 MPESAPPSKVKATKSYGAEVILHGDDYDEAYAFATSLAEEE-GRVFVHPFDDEFVMAGQGTIGLEIMEDIPDVDTVIVPV 156
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417   203 VGGGGLLCGVVQGLQECgwGDVPVIAMETFGAHSFHAATTAGKLVSLPKITSVAKALGVKTVGSQALKLFQEHpiFSEVI 282
Cdd:TIGR01127 157 GGGGLISGVASAAKQIN--PNVKVIGVEAEGAPSMYESLREGKIKAVESVRTIADGIAVKKPGDLTFNIIKEY--VDDVV 232
                         250       260       270       280       290       300
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 49258417   283 --SDQEAVAAIEKFVDDEKILVEPACGAALAAVyshviqklqLEGNLRTPLPSLVVIVCGGsNISL 346
Cdd:TIGR01127 233 tvDEEEIANAIYLLLERHKILAEGAGAAGVAAL---------LEQKVDVKGKKIAVVLSGG-NIDL 288
THD1 TIGR02079
threonine dehydratase; This model represents threonine dehydratase, the first step in the ...
47-355 1.48e-28

threonine dehydratase; This model represents threonine dehydratase, the first step in the pathway converting threonine into isoleucine. At least two other clades of biosynthetic threonine dehydratases have been characterized by models (TIGR01124 and TIGR01127). Those sequences described by this model are exclusively found in species containg the rest of the isoleucine pathway and which are generally lacking in members of the those other two clades of threonine dehydratases. Members of this clade are also often gene clustered with other elements of the isoleucine pathway. [Amino acid biosynthesis, Pyruvate family]


Pssm-ID: 273957 [Multi-domain]  Cd Length: 409  Bit Score: 114.85  E-value: 1.48e-28
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417    47 TPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRGIGHFCKRWAKQGCAH-FVCSSAGNAGMAAAYAARQLGVPATIVVPG 125
Cdd:TIGR02079  17 TPLQLNERLSEKYGANIYLKREDLQPVRSYKIRGAYNFLKQLSDAQLAKgVVCASAGNHAQGFAYACRHLGVHGTVFMPA 96
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417   126 TTPALTIERLK---NEGATCKVVGELLDEAFELAKALAKNNpGWVYIPPFDDPLIWEGHASIVKELKETLWEKP------ 196
Cdd:TIGR02079  97 TTPKQKIDRVKifgGEFIEIILVGDTFDQCAAAAREHVEDH-GGTFIPPFDDPRIIEGQGTVAAEILDQLPEKPdyvvvp 175
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417   197 ----GAIAlsvggggllcgvvqGLQECGWGDVP---VIAMETFGAHSFHAATTAGKLVSLPKITSVAKALGVKTVGSQAL 269
Cdd:TIGR02079 176 vgggGLIS--------------GLTTYLAGTSPktkIIGVEPEGAPSMKASLEAGEVVTLDKIDNFVDGAAVKRVGDLNF 241
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417   270 KLFQEHPIFSEVISDQEAVAAIEKFVDDEKILVEPACGAALAAVyshVIQKLQLEGnlrtplpSLVVIVCGGSNISLAQL 349
Cdd:TIGR02079 242 KALKDVPDEVTLVPEGAVCTTILDLYNLEGIVAEPAGALSIAAL---ERLGEEIKG-------KTVVCVVSGGNNDIERT 311

                  ....*.
gi 49258417   350 RALKEQ 355
Cdd:TIGR02079 312 EEIRER 317
PRK12483 PRK12483
threonine dehydratase; Reviewed
45-355 1.00e-25

threonine dehydratase; Reviewed


Pssm-ID: 237111 [Multi-domain]  Cd Length: 521  Bit Score: 107.96  E-value: 1.00e-25
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417   45 VKTPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRGIGHFCKRWAKQGCAHFV-CSSAGNAGMAAAYAARQLGVPATIVV 123
Cdd:PRK12483  36 RETPLQRAPNLSARLGNQVLLKREDLQPVFSFKIRGAYNKMARLPAEQLARGViTASAGNHAQGVALAAARLGVKAVIVM 115
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417  124 PGTTPALTIERLKNEGATCKVVGELLDEAFELAKALAKNNpGWVYIPPFDDPLIWEGHASIVKELketLWEKPGAIALS- 202
Cdd:PRK12483 116 PRTTPQLKVDGVRAHGGEVVLHGESFPDALAHALKLAEEE-GLTFVPPFDDPDVIAGQGTVAMEI---LRQHPGPLDAIf 191
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417  203 -----VGGGGLLCGVVQGLQEcgwgDVPVIAMETFGAHSFHAATTAGKLVSLPKITSVAKALGVKTVGSQALKLFQEHpi 277
Cdd:PRK12483 192 vpvggGGLIAGIAAYVKYVRP----EIKVIGVEPDDSNCLQAALAAGERVVLGQVGLFADGVAVAQIGEHTFELCRHY-- 265
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417  278 FSEVI--SDQEAVAAIEKFVDDEKILVEPACGAALAAVYSHVIQKlQLEGnlRTplpslVVIVCGGSNISLAQLRALKEQ 355
Cdd:PRK12483 266 VDEVVtvSTDELCAAIKDIYDDTRSITEPAGALAVAGIKKYAERE-GIEG--QT-----LVAIDSGANVNFDRLRHVAER 337
PRK08639 PRK08639
threonine dehydratase; Validated
45-343 8.97e-24

threonine dehydratase; Validated


Pssm-ID: 236318 [Multi-domain]  Cd Length: 420  Bit Score: 101.42  E-value: 8.97e-24
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417   45 VKTPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRGIGHF-CKRWAKQGCAHFVCSSAGNAGMAAAYAARQLGVPATIVV 123
Cdd:PRK08639  24 PETPLQRNDYLSEKYGANVYLKREDLQPVRSYKLRGAYNAiSQLSDEELAAGVVCASAGNHAQGVAYACRHLGIPGVIFM 103
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417  124 PGTTPALTIERLK---NEGATCKVVGELLDEAFELAKALAKNNpGWVYIPPFDDPLIWEGHASIVKELKETLwEKP---- 196
Cdd:PRK08639 104 PVTTPQQKIDQVRffgGEFVEIVLVGDTFDDSAAAAQEYAEET-GATFIPPFDDPDVIAGQGTVAVEILEQL-EKEgspd 181
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417  197 ---------GAIALSVGGggllcgvvqgLQECGWgDVPVIAMETFGAHSFHAATTAGKLVSLPKITSVAKALGVKTVGSQ 267
Cdd:PRK08639 182 yvfvpvgggGLISGVTTY----------LKERSP-KTKIIGVEPAGAASMKAALEAGKPVTLEKIDKFVDGAAVARVGDL 250
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 49258417  268 ALKLFQEHPifSEVIS-DQEAV-AAIEKFVDDEKILVEPACGAALAAVYSHviqKLQLEGnlrtplpSLVVIVCGGSN 343
Cdd:PRK08639 251 TFEILKDVV--DDVVLvPEGAVcTTILELYNKEGIVAEPAGALSIAALELY---KDEIKG-------KTVVCVISGGN 316
PRK08246 PRK08246
serine/threonine dehydratase;
63-341 4.28e-23

serine/threonine dehydratase;


Pssm-ID: 181319  Cd Length: 310  Bit Score: 97.72  E-value: 4.28e-23
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417   63 VYLKMDSAQPSGSFKIRGIGHFCkRWAKQGCAHFVCSSAGNAGMAAAYAARQLGVPATIVVPGTTPALTIERLKNEGATC 142
Cdd:PRK08246  39 VWLKLEHLQHTGSFKARGAFNRL-LAAPVPAAGVVAASGGNAGLAVAYAAAALGVPATVFVPETAPPAKVARLRALGAEV 117
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417  143 KVVGELLDEAFELAKALAKNNpGWVYIPPFDDPLIWEGHASIVKELKETLWEKP------------GAIAlsvggggllc 210
Cdd:PRK08246 118 VVVGAEYADALEAAQAFAAET-GALLCHAYDQPEVLAGAGTLGLEIEEQAPGVDtvlvavggggliAGIA---------- 186
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417  211 gvvqglqecGW--GDVPVIAMETFGAHSFHAATTAGKLVSLPKITSVAKALGVKTVGSQALKLFQEHPIFSEVISDQEAV 288
Cdd:PRK08246 187 ---------AWfeGRARVVAVEPEGAPTLHAALAAGEPVDVPVSGIAADSLGARRVGEIAFALARAHVVTSVLVSDEAII 257
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|....*
gi 49258417  289 AAIEKFVDDEKILVEPACGAALAAVYShviqklqleGNLRtPLPS--LVVIVCGG 341
Cdd:PRK08246 258 AARRALWEELRLAVEPGAATALAALLS---------GAYV-PAPGerVAVVLCGA 302
PRK09224 PRK09224
threonine ammonia-lyase IlvA;
45-350 1.08e-22

threonine ammonia-lyase IlvA;


Pssm-ID: 236417 [Multi-domain]  Cd Length: 504  Bit Score: 99.06  E-value: 1.08e-22
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417   45 VKTPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRG----IGHFCKRWAKQGCahfVCSSAGNAGMAAAYAARQLGVPAT 120
Cdd:PRK09224  19 QETPLEKAPKLSARLGNQVLLKREDLQPVFSFKLRGaynkMAQLTEEQLARGV---ITASAGNHAQGVALSAARLGIKAV 95
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417  121 IVVPGTTPALTIERLKNEGAtcKVV--GELLDEAFELAKALAKNNpGWVYIPPFDDPLIWEGHASIVKELKETLWEKP-- 196
Cdd:PRK09224  96 IVMPVTTPDIKVDAVRAFGG--EVVlhGDSFDEAYAHAIELAEEE-GLTFIHPFDDPDVIAGQGTIAMEILQQHPHPLda 172
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417  197 --------GAIAlsvggggllcgvvqglqecG--------WGDVPVIAMETFGAHSFHAATTAGKLVSLPKITSVAKALG 260
Cdd:PRK09224 173 vfvpvgggGLIA-------------------GvaayikqlRPEIKVIGVEPEDSACLKAALEAGERVDLPQVGLFADGVA 233
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417  261 VKTVGSQALKLFQEHpiFSEVI---SDqEAVAAIEKFVDDEKILVEPAcGA-ALAAVYSHViQKLQLEGNlrtplpSLVV 336
Cdd:PRK09224 234 VKRIGEETFRLCQEY--VDDVItvdTD-EICAAIKDVFEDTRSIAEPA-GAlALAGLKKYV-AQHGIEGE------TLVA 302
                        330
                 ....*....|....
gi 49258417  337 IVCgGSNISLAQLR 350
Cdd:PRK09224 303 ILS-GANMNFDRLR 315
PLN02550 PLN02550
threonine dehydratase
45-354 1.21e-21

threonine dehydratase


Pssm-ID: 178165 [Multi-domain]  Cd Length: 591  Bit Score: 96.14  E-value: 1.21e-21
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417   45 VKTPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRGIGHFCKRWAKQGCAHFV-CSSAGNAGMAAAYAARQLGVPATIVV 123
Cdd:PLN02550 108 IESPLQLAKKLSERLGVKVLLKREDLQPVFSFKLRGAYNMMAKLPKEQLDKGViCSSAGNHAQGVALSAQRLGCDAVIAM 187
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417  124 PGTTPALTIERLKNEGATCKVVGELLDEAFELAKALAKNNpGWVYIPPFDDPLIWEGHASIVKELKETLWEKPGAIALSV 203
Cdd:PLN02550 188 PVTTPEIKWQSVERLGATVVLVGDSYDEAQAYAKQRALEE-GRTFIPPFDHPDVIAGQGTVGMEIVRQHQGPLHAIFVPV 266
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417  204 GGGGLLCGVVQGLQECGwGDVPVIAMETFGAHSFHAATTAGKLVSLPKITSVAKALGVKTVGSQALKLFQEHPIFSEVIS 283
Cdd:PLN02550 267 GGGGLIAGIAAYVKRVR-PEVKIIGVEPSDANAMALSLHHGERVMLDQVGGFADGVAVKEVGEETFRLCRELVDGVVLVS 345
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 49258417  284 DQEAVAAIEKFVDDEKILVEPACGAALAAVYSHViQKLQLEGnlrtplpSLVVIVCGGSNISLAQLRALKE 354
Cdd:PLN02550 346 RDAICASIKDMFEEKRSILEPAGALALAGAEAYC-KYYGLKD-------ENVVAITSGANMNFDRLRIVTE 408
eutB PRK07476
threonine dehydratase; Provisional
45-352 7.85e-21

threonine dehydratase; Provisional


Pssm-ID: 236025  Cd Length: 322  Bit Score: 91.57  E-value: 7.85e-21
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417   45 VKTPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRGIGHFCKRWAKQGCAH-FVCSSAGNAGMAAAYAARQLGVPATIVV 123
Cdd:PRK07476  18 RRTPLVASASLSARAGVPVWLKLETLQPTGSFKLRGATNALLSLSAQERARgVVTASTGNHGRALAYAARALGIRATICM 97
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417  124 PGTTPALTIERLKNEGATCKVVGELLDEAFELAKALAKNNpGWVYIPPFDDPLIWEGHASIVKELKETLWEKP------- 196
Cdd:PRK07476  98 SRLVPANKVDAIRALGAEVRIVGRSQDDAQAEVERLVREE-GLTMVPPFDDPRIIAGQGTIGLEILEALPDVAtvlvpls 176
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417  197 --GAIALSVGGGGLLCGVVQglqecgwgdVPVIAMETfGAhSFHAATTAGKLVSLPKITSVAKALGvktvGSQAL----- 269
Cdd:PRK07476 177 ggGLASGVAAAVKAIRPAIR---------VIGVSMER-GA-AMHASLAAGRPVQVEEVPTLADSLG----GGIGLdnryt 241
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417  270 -KLFQEhpIFSEVI--SDQEAVAAIEKFVDDEKILVEPACGAALAAVyshviqklqLEGNLRTPLPSLVVIVCGGsNISL 346
Cdd:PRK07476 242 fAMCRA--LLDDVVllDEAEIAAGIRHAYREERLVVEGAGAVGIAAL---------LAGKIAARDGPIVVVVSGA-NIDM 309

                 ....*.
gi 49258417  347 AQLRAL 352
Cdd:PRK07476 310 ELHRRI 315
PRK08526 PRK08526
threonine dehydratase; Provisional
45-355 2.08e-20

threonine dehydratase; Provisional


Pssm-ID: 181457 [Multi-domain]  Cd Length: 403  Bit Score: 91.70  E-value: 2.08e-20
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417   45 VKTPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRG----IGHFCKRWAKQGCahfVCSSAGNAGMAAAYAARQLGVPAT 120
Cdd:PRK08526  19 NKTPFAYAPFLSKISGAEVYLKKENLQITGAYKIRGaynkIANLSEEQKQHGV---IAASAGNHAQGVAISAKKFGIKAV 95
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417  121 IVVPGTTPALTIERLKNEGATCKVVGELLDEAFELAKALAKNNpGWVYIPPFDDPLIWEGHASIVKELketlwekpgaia 200
Cdd:PRK08526  96 IVMPEATPLLKVSGTKALGAEVILKGDNYDEAYAFALEYAKEN-NLTFIHPFEDEEVMAGQGTIALEM------------ 162
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417  201 lsvggggllcgvvqgLQEC----------GWG---------------DVPVIAMETFGAHSFHAATTAGKLVSLPKITSV 255
Cdd:PRK08526 163 ---------------LDEIsdldmvvvpvGGGglisgiasaakqinpNIKIIGVGAKGAPAMYESFHAKKIINSKSVRTI 227
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417  256 AKALGVKTVGSQALKLFQEhpIFSEVIS--DQEAVAAIEKFVDDEKILVEPACGAALAAVyshviqklqLEGNLRTPLPS 333
Cdd:PRK08526 228 ADGIAVRDASPINLAIILE--CVDDFVQvdDEEIANAILFLLEKQKIVVEGAGAASVAAL---------LHQKIDLKKGK 296
                        330       340
                 ....*....|....*....|..
gi 49258417  334 LVVIVCGGSNISLAQLRALKEQ 355
Cdd:PRK08526 297 KIGVVLSGGNIDVQMLNIIIEK 318
PRK06815 PRK06815
threonine/serine dehydratase;
47-351 6.69e-19

threonine/serine dehydratase;


Pssm-ID: 180709  Cd Length: 317  Bit Score: 86.29  E-value: 6.69e-19
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417   47 TPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRG----IGHFCKRWAKQGcahFVCSSAGNAGMAAAYAARQLGVPATIV 122
Cdd:PRK06815  21 TPLEHSPLLSQHTGCEVYLKCEHLQHTGSFKFRGasnkLRLLNEAQRQQG---VITASSGNHGQGVALAAKLAGIPVTVY 97
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417  123 VPGTTPALTIERLKNEGATCKVVGELLDEAfELAKALAKNNPGWVYIPPFDDPLIWEGHASIVKELKETLwEKPGAIALS 202
Cdd:PRK06815  98 APEQASAIKLDAIRALGAEVRLYGGDALNA-ELAARRAAEQQGKVYISPYNDPQVIAGQGTIGMELVEQQ-PDLDAVFVA 175
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417  203 VGGGGLLCGVVQGLQECGwGDVPVIAMETFGAHSFHAATTAGKLVSLPKITSVAK--ALGVKTvGSQALKLFQEHPIFSE 280
Cdd:PRK06815 176 VGGGGLISGIATYLKTLS-PKTEIIGCWPANSPSLYTSLEAGEIVEVAEQPTLSDgtAGGVEP-GAITFPLCQQLIDQKV 253
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 49258417  281 VISDQEAVAAIEKFVDDEKILVEPACGAALAAVyshviqkLQLEGNLRTplPSLVVIVCgGSNISLAQLRA 351
Cdd:PRK06815 254 LVSEEEIKEAMRLIAETDRWLIEGAAGVALAAA-------LKLAPRYQG--KKVAVVLC-GKNIVLEKYLE 314
PLN02970 PLN02970
serine racemase
46-349 6.74e-19

serine racemase


Pssm-ID: 215524  Cd Length: 328  Bit Score: 86.27  E-value: 6.74e-19
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417   46 KTPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRG----IGHFCKRWAKQGCahfVCSSAGNAGMAAAYAARQLGVPATI 121
Cdd:PLN02970  27 RTPVLTSSSLDALAGRSLFFKCECFQKGGAFKFRGacnaIFSLSDDQAEKGV---VTHSSGNHAAALALAAKLRGIPAYI 103
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417  122 VVPGTTPALTIERLKNEGATCkVVGELLDEAFELAKALAKNNPGWVYIPPFDDPLIWEGHASIVKELKETL--------- 192
Cdd:PLN02970 104 VVPKNAPACKVDAVIRYGGII-TWCEPTVESREAVAARVQQETGAVLIHPYNDGRVISGQGTIALEFLEQVpeldviivp 182
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417  193 WEKPGAIAlsvggggLLCGVVQGLQEcgwgDVPVIAMETFGAHSFHAATTAGKLVSLPKITSVAKALGVKtVGSQALKLF 272
Cdd:PLN02970 183 ISGGGLIS-------GIALAAKAIKP----SIKIIAAEPKGADDAAQSKAAGEIITLPVTNTIADGLRAS-LGDLTWPVV 250
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417  273 QEhpIFSEVI--SDQEAVAAIEKFVDDEKILVEPACGAALAAVYSHVIQ-KLQLEGNLRtplpsLVVIVCGGsNISLAQL 349
Cdd:PLN02970 251 RD--LVDDVItvDDKEIIEAMKLCYERLKVVVEPSGAIGLAAALSDSFRsNPAWKGCKN-----VGIVLSGG-NVDLGVL 322
PRK07334 PRK07334
threonine dehydratase; Provisional
45-316 1.45e-17

threonine dehydratase; Provisional


Pssm-ID: 235994 [Multi-domain]  Cd Length: 403  Bit Score: 83.02  E-value: 1.45e-17
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417   45 VKTPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRGIghfCKRWAK-------------------QGCAHfvcssagnag 105
Cdd:PRK07334  22 LRTPCVHSRTLSQITGAEVWLKFENLQFTASFKERGA---LNKLLLlteeerargviamsagnhaQGVAY---------- 88
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417  106 maaayAARQLGVPATIVVPGTTPALTIERLKNEGATCKVVGELLDEAFELAKALAKNNpGWVYIPPFDDPLIWEGHASIV 185
Cdd:PRK07334  89 -----HAQRLGIPATIVMPRFTPTVKVERTRGFGAEVVLHGETLDEARAHARELAEEE-GLTFVHPYDDPAVIAGQGTVA 162
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417  186 KELKE------TLWEKPG--------AIALSVGGGgllcgvvqglqecgwgDVPVIAMETfgaHSFHAATTAGKLVSLPK 251
Cdd:PRK07334 163 LEMLEdapdldTLVVPIGggglisgmATAAKALKP----------------DIEIIGVQT---ELYPSMYAAIKGVALPC 223
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 49258417  252 ITS-VAKALGVKTVGSQALKLFQEHPIFSEVISDQEAVAAIEKFVDDEKILVEPACGAALAAVYSH 316
Cdd:PRK07334 224 GGStIAEGIAVKQPGQLTLEIVRRLVDDILLVSEADIEQAVSLLLEIEKTVVEGAGAAGLAALLAY 289
PRK08638 PRK08638
bifunctional threonine ammonia-lyase/L-serine ammonia-lyase TdcB;
46-356 9.03e-17

bifunctional threonine ammonia-lyase/L-serine ammonia-lyase TdcB;


Pssm-ID: 236317  Cd Length: 333  Bit Score: 80.16  E-value: 9.03e-17
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417   46 KTPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRG----IGHFCKRWAKQGcahFVCSSAGNAGMAAAYAARQLGVPATI 121
Cdd:PRK08638  27 KTPLPRSNYLSERCKGEIFLKLENMQRTGSFKIRGafnkLSSLTDAEKRKG---VVACSAGNHAQGVALSCALLGIDGKV 103
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417  122 VVPGTTPALTIERLKNEGATCKVVGELLDEAFELAKALAKNNpGWVYIPPFDDPLIWEGHASIVKELKETLWEKPGAIal 201
Cdd:PRK08638 104 VMPKGAPKSKVAATCGYGAEVVLHGDNFNDTIAKVEEIVEEE-GRTFIPPYDDPKVIAGQGTIGLEILEDLWDVDTVI-- 180
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417  202 svggggllcgvvqglqecgwgdVPV----------IAMETF------------GAHSFHAATTAGKLVSLPKITSVAKAL 259
Cdd:PRK08638 181 ----------------------VPIggggliagiaVALKSInptihiigvqseNVHGMAASFYAGEITTHRTTGTLADGC 238
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417  260 GVKTVGSQALKLFQEhpIFSEVI--SDQEAVAAIEKFVDDEKILVEPACGAALAAVYSHVIQKLqLEGNlrtplpSLVVI 337
Cdd:PRK08638 239 DVSRPGNLTYEIVRE--LVDDIVlvSEDEIRNAMKDLIQRNKVVTEGAGALATAALLSGKLDQY-IQNK------KVVAI 309
                        330
                 ....*....|....*....
gi 49258417  338 VCGGsNISLAQLRALKEQL 356
Cdd:PRK08638 310 ISGG-NVDLSRVSQITGHV 327
Thr-synth_1 cd01563
Threonine synthase is a pyridoxal phosphate (PLP) dependent enzyme that catalyses the last ...
47-340 4.65e-16

Threonine synthase is a pyridoxal phosphate (PLP) dependent enzyme that catalyses the last reaction in the synthesis of threonine from aspartate. It proceeds by converting O-phospho-L-homoserine (OPH) into threonine and inorganic phosphate. In plants, OPH is an intermediate between the methionine and threonine/isoleucine pathways. Thus threonine synthase competes for OPH with cystathionine-gamma-synthase, the first enzyme in the methionine pathway. These enzymes are in general dimers. Members of this CD, Thr-synth_1, are widely distributed in bacteria, archaea and higher plants.


Pssm-ID: 107206  Cd Length: 324  Bit Score: 78.02  E-value: 4.65e-16
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417  47 TPIRDSMALSKMAGT-SVYLKMDSAQPSGSFKIRG----IGHfckrwAKQ-GCAHFVCSSAGNAGMAAAYAARQLGVPAT 120
Cdd:cd01563  23 TPLVRAPRLGERLGGkNLYVKDEGLNPTGSFKDRGmtvaVSK-----AKElGVKAVACASTGNTSASLAAYAARAGIKCV 97
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417 121 IVVPGTTPALTIERLKNEGATCKVVGELLDEAFELAKALAKNNpgWVYIPPFDDPLIWEGHASIVKELKETL-WEKPGAI 199
Cdd:cd01563  98 VFLPAGKALGKLAQALAYGATVLAVEGNFDDALRLVRELAEEN--WIYLSNSLNPYRLEGQKTIAFEIAEQLgWEVPDYV 175
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417 200 ALSVGGGGLLCGVVQGLQEC---GWGD-VP-VIAMETFGAHSFHAATTAGK--LVSLPKITSVAKALGVKTVGS--QALK 270
Cdd:cd01563 176 VVPVGNGGNITAIWKGFKELkelGLIDrLPrMVGVQAEGAAPIVRAFKEGKddIEPVENPETIATAIRIGNPASgpKALR 255
                       250       260       270       280       290       300       310
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417 271 LFQEHPIFSEVISDQEAVAAIEKFVDDEKILVEPACGAALAAVyshviQKLQLEGNLRTPlPSLVVIVCG 340
Cdd:cd01563 256 AVRESGGTAVAVSDEEILEAQKLLARTEGIFVEPASAASLAGL-----KKLREEGIIDKG-ERVVVVLTG 319
PRK06352 PRK06352
threonine synthase; Validated
47-317 2.17e-15

threonine synthase; Validated


Pssm-ID: 180539  Cd Length: 351  Bit Score: 76.25  E-value: 2.17e-15
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417   47 TPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRGIGHFCKRWAKQGCAHFVCSSAGNAGMAAAYAARQLGVPATIVVPGT 126
Cdd:PRK06352  29 TPLIPLPNLSKELGVTLYGKYEGLNPTGSFKDRGMVMAVAKAKEEGAEAVICASTGNTSAAAAAYATRAGLKAYIVIPEG 108
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417  127 TPAL-TIERLKNEGATCKVVGELLDEAFELAKALAKNNPgwVYIPPFDDPLIWEGHASIVKELKETLWEKPGAIALSVGG 205
Cdd:PRK06352 109 KVALgKLAQAVMYGADIISIQGNFDEALKSVRELAETEA--VTLVNSVNPYRLEGQKTAAFEICEQLGSAPDVLAIPVGN 186
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417  206 GGLLCGVVQGLQEcgWGDVPVIAMETFgaHSFH----AATTAGKLVSLPKITSVAKALGVKTVGSQALKLFQEHPIFSEV 281
Cdd:PRK06352 187 AGNISAYWKGFKE--WNEAKASGLPRM--HGFEaegaAAIVQGKPIDNPETIATAIRIGNPASWGLAEAARDESGGYIHS 262
                        250       260       270
                 ....*....|....*....|....*....|....*.
gi 49258417  282 ISDQEAVAAIEKFVDDEKILVEPACGAALAAVYSHV 317
Cdd:PRK06352 263 VTDDEIVNAYKKIAAQDGVFIEPGSAASLAGVIQHV 298
PRK06608 PRK06608
serine/threonine dehydratase;
46-366 1.43e-14

serine/threonine dehydratase;


Pssm-ID: 235842  Cd Length: 338  Bit Score: 73.65  E-value: 1.43e-14
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417   46 KTPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRGIGHFCKRWAKQGC--AHFVCSSAGNAGMAAAYAARQLGVPATIVV 123
Cdd:PRK06608  23 LTPIVHSESLNEMLGHEIFFKVESLQKTGAFKVRGVLNHLLELKEQGKlpDKIVAYSTGNHGQAVAYASKLFGIKTRIYL 102
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417  124 PgttpaLTIERLKNEgATCKVVGELL-----DEAFElaKALAKNNPGWVYIPPFDDPLIWEGHASIVKELKETLWEKPGA 198
Cdd:PRK06608 103 P-----LNTSKVKQQ-AALYYGGEVIltntrQEAEE--KAKEDEEQGFYYIHPSDSDSTIAGAGTLCYEALQQLGFSPDA 174
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417  199 IalsvggggllcgvvqgLQECGWG---------------DVPVIAMETFGAHSFHAATTAGKLVSLPKI-TSVAKALGVK 262
Cdd:PRK06608 175 I----------------FASCGGGglisgtylakelispTSLLIGSEPLNANDAYLSLKNNKIYRLNYSpNTIADGLKTL 238
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417  263 TVGSQALKLFQEHPIFSEViSDQEAVAAIEKFVDDEKILVEPACGAALAAVYSHVIQklqlegnlRTPLPSLVVIVCGGs 342
Cdd:PRK06608 239 SVSARTFEYLKKLDDFYLV-EEYEIYYWTAWLTHLLKVICEPSSAINMVAVVNWLKT--------QSKPQKLLVILSGG- 308
                        330       340
                 ....*....|....*....|....
gi 49258417  343 NISLAQLRALKEQLGMTNrLPKLE 366
Cdd:PRK06608 309 NIDPILYNELWKEDYLTI-PPKIL 331
PRK06382 PRK06382
threonine dehydratase; Provisional
46-366 1.46e-14

threonine dehydratase; Provisional


Pssm-ID: 180550 [Multi-domain]  Cd Length: 406  Bit Score: 74.15  E-value: 1.46e-14
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417   46 KTPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRG-IGHFCKRWAKQGCAHFVCSSAGNAGMAAAYAARQLGVPATIVVP 124
Cdd:PRK06382  25 RTPLIHSTTFGDEYGGDIYFKLENFQKTGSFKSRGaVFKFSKLSEDELRNGVITASAGNHAQGVAYAASINGIDAKIVMP 104
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417  125 GTTPALTIERLKNEGATCKVVGELLDEAFELAKALAKNNpGWVYIPPFDDPLIWEGHASIVKELKETLWEKPGAIALSVG 204
Cdd:PRK06382 105 EYTIPQKVNAVEAYGAHVILTGRDYDEAHRYADKIAMDE-NRTFIEAFNDRWVISGQGTIGLEIMEDLPDLDQIIVPVGG 183
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417  205 GGGLLCGVVQGLQECgwGDVPVIAMETFGAHSFHAATTAGKLVSLPKITSVAKALGVKTVGSQALKLFQEHPIFSEVISD 284
Cdd:PRK06382 184 GGLISGIALAAKHIN--PNVKIIGIESELSDSMKASLREGKIVAHTSGVSICDGISVKYPGDLTFDIAKNYVDDIVTVTE 261
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417  285 QEAVAAIEKFVDDEKILVEPACGAALAAVYshviqklqlEGNLRTPLPSLVVIVCGGSNISLAQLRALKEQLGMTNRLPK 364
Cdd:PRK06382 262 ESVSKAIYKLFEREKIVAEPSGAVGLAAIM---------EGKVDVKGKKVAIVVSGGNINPLLMSKIIYKELENLGQLVR 332

                 ..
gi 49258417  365 LE 366
Cdd:PRK06382 333 IE 334
ectoine_eutB TIGR02991
ectoine utilization protein EutB; Members of this protein family are EutB, a predicted ...
46-347 1.02e-12

ectoine utilization protein EutB; Members of this protein family are EutB, a predicted arylmalonate decarboxylase found in a conserved ectoine utilization operon of species that include Sinorhizobium meliloti 1021 (where it is known to be induced by ectoine), Mesorhizobium loti, Silicibacter pomeroyi, Agrobacterium tumefaciens, and Pseudomonas putida. Members of this family resemble threonine dehydratases.


Pssm-ID: 132036  Cd Length: 317  Bit Score: 67.96  E-value: 1.02e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417    46 KTPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRG-IGHFCKRWAKQGCAHFVCSSAGNAGMAAAYAARQLGVPATIVVP 124
Cdd:TIGR02991  19 ETPLVESPSLSELCGVPVHLKLEHRQTTGSFKLRGaTNAVLSLSDTQRAAGVVAASTGNHGRALAYAAAEEGVRATICMS 98
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417   125 GTTPALTIERLKNEGATCKVVGELLDEAFELAKALAKNNpGWVYIPPFDDPLIWEGHASIVKELKETLWEKPGAIALSV- 203
Cdd:TIGR02991  99 ELVPQNKVDEIRRLGAEVRIVGRSQDDAQEEVERLVADR-GLTMLPPFDHPDIVAGQGTLGLEVVEQMPDLATVLVPLSg 177
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417   204 -GGGGLLCGVVQGLQEcgwgDVPVIAMETFGAHSFHAATTAGKLVSLPKITSVAKALGVKTVGSQALKLFQEHPIFSEVI 282
Cdd:TIGR02991 178 gGLASGVAMAVKAARP----DTRVIGVSMERGAAMKASLQAGRPVLVAELPTLADSLGGGIGLDNRVTFAMCKALLDEIV 253
                         250       260       270       280       290       300
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 49258417   283 --SDQEAVAAIEKFVDDEKILVEPACGAALAAVyshviqklqLEGNLRTPLPslVVIVCGGSNISLA 347
Cdd:TIGR02991 254 lvSEAEIAAGIRHAYAEEREIVEGAGAVGIAAL---------LAGKIKNPGP--CAVIVSGRNIDMD 309
PRK08813 PRK08813
threonine dehydratase; Provisional
63-312 2.95e-11

threonine dehydratase; Provisional


Pssm-ID: 236339  Cd Length: 349  Bit Score: 63.88  E-value: 2.95e-11
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417   63 VYLKMDSAQPSGSFKIRGIGHFCKRWAKQGCAH-FVCSSAGNAGMAAAYAARQLGVPATIVVPGTTPALTIERLKNEGAT 141
Cdd:PRK08813  50 VWLKLENLQRTGSYKVRGALNALLAGLERGDERpVICASAGNHAQGVAWSAYRLGVQAITVMPHGAPQTKIAGVAHWGAT 129
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417  142 CKVVGELLDEAFELAKALAKNNpGWVYIPPFDDPLIWEGHASIVKELKEtlwEKPGAIALSVGGGGLLCGVVQGLQECGw 221
Cdd:PRK08813 130 VRQHGNSYDEAYAFARELADQN-GYRFLSAFDDPDVIAGQGTVGIELAA---HAPDVVIVPIGGGGLASGVALALKSQG- 204
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417  222 gdVPVIAMETFGAHSFhAATTAGKLVSLPKITSVAKALGVKTVGSQALKLFQEHPIFSEVISDQEAVAAIEKFVDDEKIL 301
Cdd:PRK08813 205 --VRVVGAQVEGVDSM-ARAIRGDLREIAPVATLADGVKVKIPGFLTRRLCSSLLDDVVIVREAELRETLVRLALEEHVI 281
                        250
                 ....*....|.
gi 49258417  302 VEPACGAALAA 312
Cdd:PRK08813 282 AEGAGALALAA 292
PRK07048 PRK07048
threo-3-hydroxy-L-aspartate ammonia-lyase;
46-352 3.98e-11

threo-3-hydroxy-L-aspartate ammonia-lyase;


Pssm-ID: 235918  Cd Length: 321  Bit Score: 63.11  E-value: 3.98e-11
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417   46 KTPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRG----IGHFCKRWAKQGCAHFvcsSAGNAGMAAAYAARQLGVPATI 121
Cdd:PRK07048  24 RTPVLTSRTADARTGAQVFFKCENFQRMGAFKFRGaynaLSQFSPEQRRAGVVTF---SSGNHAQAIALSARLLGIPATI 100
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417  122 VVPGTTPALTIERLKNEGATCKVVGELLDEAFELAKALAKNNpGWVYIPPFDDPLIWEGHASIVKElketLWEKPGAIAL 201
Cdd:PRK07048 101 VMPQDAPAAKVAATRGYGGEVVTYDRYTEDREEIGRRLAEER-GLTLIPPYDHPHVIAGQGTAAKE----LFEEVGPLDA 175
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417  202 SvggggllcgvvqgLQECGWG---------------DVPVIAMETF----GAHSFHaattAGKLVSLPKITSVAKALGVK 262
Cdd:PRK07048 176 L-------------FVCLGGGgllsgcalaaralspGCKVYGVEPEagndGQQSFR----SGEIVHIDTPRTIADGAQTQ 238
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417  263 TVGSQALKLFQEHPIFSEVISDQEAVAAIEKFVDDEKILVEPACGAALAAVYShviQKLQLEGNlrtplpSLVVIVCGGs 342
Cdd:PRK07048 239 HLGNYTFPIIRRLVDDIVTVSDAELVDAMRFFAERMKIVVEPTGCLGAAAALR---GKVPLKGK------RVGVIISGG- 308
                        330
                 ....*....|
gi 49258417  343 NISLAQLRAL 352
Cdd:PRK07048 309 NVDLARFAAL 318
PRK06721 PRK06721
threonine synthase; Reviewed
47-317 4.25e-11

threonine synthase; Reviewed


Pssm-ID: 136018  Cd Length: 352  Bit Score: 63.55  E-value: 4.25e-11
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417   47 TPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRGIGHFCKRWAKQGCAHFVCSSAGNAGMAAAYAARQLGVPATIVVP-G 125
Cdd:PRK06721  29 TPLIPLLNISKQLGIQLYGKYEGANPTGSFKDRGMVMAVAKAKEEGSEAIICASTGNTSASAAAYAARLGMKCIIVIPeG 108
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417  126 TTPALTIERLKNEGATCKVVGELLDEAFELAKALAKNNPgwVYIPPFDDPLIWEGHASIVKELKETLWEKPGAIALSVGG 205
Cdd:PRK06721 109 KIAHGKLAQAVAYGAEIISIEGNFDDALKAVRNIAAEEP--ITLVNSVNPYRIEGQKTAAFEICDQLQRAPDVLAIPVGN 186
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417  206 GGLLCGVVQGL----QECGWGDVPVIAMETFGAhsfhAATTAGKLVSLPKITSVAKALGVKTVGSQALKLFQEHPIFSEV 281
Cdd:PRK06721 187 AGNITAYWKGFceyeKEKGYKKPRIHGFEAEGA----AAIVKGHVIDEPETIATAIRIGNPASWSYAVEAAEQSHGEIDM 262
                        250       260       270
                 ....*....|....*....|....*....|....*.
gi 49258417  282 ISDQEAVAAIEKFVDDEKILVEPACGAALAAVYSHV 317
Cdd:PRK06721 263 VSDEEILHAYRLLAKSEGVFAEPGSNASLAGVMKHV 298
PRK05638 PRK05638
threonine synthase; Validated
47-342 4.92e-08

threonine synthase; Validated


Pssm-ID: 235539 [Multi-domain]  Cd Length: 442  Bit Score: 54.43  E-value: 4.92e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417   47 TPIRDSMALSKMaGTSVYLKMDSAQPSGSFKIRGIGHFCKRWAKQGCAHFVCSSAGNAGMAAAYAARQLGVPATIVVPGT 126
Cdd:PRK05638  67 TPLIRARISEKL-GENVYIKDETRNPTGSFRDRLATVAVSYGLPYAANGFIVASDGNAAASVAAYSARAGKEAFVVVPRK 145
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417  127 TPALTIERLKNEGATCKVVGELLDEAFELAKALAKNNpGWVYIPPFDDPLIWEGHASIVKELKETLweKPGAIALSVGGG 206
Cdd:PRK05638 146 VDKGKLIQMIAFGAKIIRYGESVDEAIEYAEELARLN-GLYNVTPEYNIIGLEGQKTIAFELWEEI--NPTHVIVPTGSG 222
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417  207 GLLCGVVQGLQEC----GWGDVP-VIAMETfgahsFHAATTAGKLVSLPKITSVAKALGV----KTVGSQALKLFQEHPI 277
Cdd:PRK05638 223 SYLYSIYKGFKELleigVIEEIPkLIAVQT-----ERCNPIASEILGNKTKCNETKALGLyvknPVMKEYVSEAIKESGG 297
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 49258417  278 FSEVISDQEAVAAiEKFVDDEKILVEPACGAALAAVyshviqkLQLEGNLRTPLPSLVVIVCGGS 342
Cdd:PRK05638 298 TAVVVNEEEIMAG-EKLLAKEGIFAELSSAVVMPAL-------LKLGEEGYIEKGDKVVLVVTGS 354
PRK08197 PRK08197
threonine synthase; Validated
30-313 2.69e-07

threonine synthase; Validated


Pssm-ID: 181283 [Multi-domain]  Cd Length: 394  Bit Score: 51.93  E-value: 2.69e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417   30 MGRGSEFMMSGEPLHV------KTPIRDSMALSKMAG-TSVYLKMDSAQPSGSFKIRGIGHFCKRWAKQGCAHFVCSSAG 102
Cdd:PRK08197  57 LWRYHELLPVRDPEHIvslgegMTPLLPLPRLGKALGiGRLWVKDEGLNPTGSFKARGLAVGVSRAKELGVKHLAMPTNG 136
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417  103 NAGMAAAYAARQLGVPATIVVPGTTPALTIERLKNEGATCKVVGELLDEAFELAKAlAKNNPGWVYIPPFDDPLIWEGHA 182
Cdd:PRK08197 137 NAGAAWAAYAARAGIRATIFMPADAPEITRLECALAGAELYLVDGLISDAGKIVAE-AVAEYGWFDVSTLKEPYRIEGKK 215
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417  183 SIVKELKETL-WEKPGAI---ALSVGGGGLLCGVVQGLQECGW--GDVP-VIAMETFGAHSFHAATTAGKLVSLPKITSV 255
Cdd:PRK08197 216 TMGLELAEQLgWRLPDVIlypTGGGVGLIGIWKAFDELEALGWigGKRPrLVAVQAEGCAPIVKAWEEGKEESEFWEDAH 295
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 49258417  256 AKALGV---KTVGSQ-ALKLFQEHPIFSEVISDQEAVAAIEKFVDDEKILVEPACGAALAAV 313
Cdd:PRK08197 296 TVAFGIrvpKALGDFlVLDAVRETGGCAIAVSDDAILAAQRELAREEGLFACPEGAATFAAA 357
ThrC COG0498
Threonine synthase [Amino acid transport and metabolism];
47-312 9.32e-07

Threonine synthase [Amino acid transport and metabolism];


Pssm-ID: 223572 [Multi-domain]  Cd Length: 411  Bit Score: 50.40  E-value: 9.32e-07
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417  47 TPIRDSMALSKMAGTS---VYLKMDSAQPSGSFKIRGiGHFCKRWAKQ-GCAHFVCSSAGNAGMAAAYAARQLGVPATIV 122
Cdd:COG0498  77 TPLYKAPALAAPLGVLndnLYVKELGHNPTGSFKDRG-MTVLVSLAKElGAKTILCASSGNTGASAAAYAARAGLKVFVL 155
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417 123 VP-GTTPALTIERLKNEGATCKVVGELLDEAFELAKALAKNNpGWVYIPPFDDPLIWEGHASIVKELKETL-WEKPGAIA 200
Cdd:COG0498 156 YPkGKVSPGKLAQMLTLGAHVIAVDGNFDDAQELVKEAANRE-GLLSAVNSINPYRLEGQKTYAFEIAEQLgWKAPDHVV 234
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417 201 lsvggggllcgvvqglqecgwgdVPVIAmetFGA-----HSFHAATTAGKLVSLPKITSVaKALGVKTV----------- 264
Cdd:COG0498 235 -----------------------VPVGN---GGNllaiyKGFKEGLPIGKIDKAPNMNGV-QAEGFSPGvyawkegretp 287
                       250       260       270       280       290       300
                ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 49258417 265 --------------GSQALKLFQEHPIFSEVISDQEAVAAIEKFVDDEKILVEPACGAALAA 312
Cdd:COG0498 288 etiapamdignpsnWERALFALRESGGLAVAVSDEEILEAIKLLAEREGILIEPHSAVAVAA 349
thrC TIGR00260
threonine synthase; Involved in threonine biosynthesis it catalyses the reaction ...
47-313 1.00e-06

threonine synthase; Involved in threonine biosynthesis it catalyses the reaction O-PHOSPHO-L-HOMOSERINE + H(2)O = L-THREONINE + ORTHOPHOSPHATE using pyridoxal phosphate as a cofactor. the enzyme is distantly related to the serine/threonine dehydratases which are also pyridoxal-phosphate dependent enzymes. the pyridoxal-phosphate binding site is a Lys (K) residues present at residue 70 of the model. [Amino acid biosynthesis, Aspartate family]


Pssm-ID: 272986  Cd Length: 327  Bit Score: 49.69  E-value: 1.00e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417    47 TPIRDSMALSKMAG-TSVYLKMDSAQPSGSFKIRGIGHFCKRWAKQGCAHFVCSSAGNAGMAAAYAARQLGVPATIVVP- 124
Cdd:TIGR00260  23 TPLFRAPALAANVGiKNLYVKELGHNPTLSFKDRGMAVALTKALELGNDTVLCASTGNTGAAAAAYAGKAGLKVVVLYPa 102
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417   125 GTTPALTIERLKNEGATCKVVGELLDEAFELAKALAKNNPGWVYIPPFDDPLIWEGHASIVKELKETL-WEKPGAIALSV 203
Cdd:TIGR00260 103 GKISLGKLAQALGYNAEVVAIDGNFDDAQRLVKQLFEDKPALGLNSANSIPYRLEGQKTYAFEAVEQLgWEAPDKVVVPV 182
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417   204 GGGGLLCGVVQGLQE---CGWGDVPV-IAMETFGAHSFHAATTAGKLV---SLPKITSVAKALGVKTVGSQALKLFQEHP 276
Cdd:TIGR00260 183 PNSGNFGAIWKGFKEkkmLGLDSLPVkRGIQAEGAADIVRAFLEGGQWepiETPETLSTAMDIGNPANWPRALEAFRRSN 262
                         250       260       270
                  ....*....|....*....|....*....|....*..
gi 49258417   277 IFSEVISDQEAVAAIEKFVDDEKILVEPACGAALAAV 313
Cdd:TIGR00260 263 GYAEDLSDEEILEAIKLLAREEGYFVEPHSAVAVAAL 299
PRK06110 PRK06110
threonine dehydratase;
55-350 1.69e-06

threonine dehydratase;


Pssm-ID: 235699  Cd Length: 322  Bit Score: 49.22  E-value: 1.69e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417   55 LSKMAGTSVYLKMDSAQPSGSFKIRGIGHFCKRWAKQG--CAHFVCSSAGNAGMAAAYAARQLGVPATIVVP-GTTPAlt 131
Cdd:PRK06110  30 LAERLGCEVWVKHENHTPTGAFKVRGGLVYFDRLARRGprVRGVISATRGNHGQSVAFAARRHGLAATIVVPhGNSVE-- 107
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417  132 ierlKNE-----GATCKVVGELLDEAFELAKALAKNNpGWVYIPPFDDPLIwEGHASIVKELKETLwekpgaialsvggg 206
Cdd:PRK06110 108 ----KNAamralGAELIEHGEDFQAAREEAARLAAER-GLHMVPSFHPDLV-RGVATYALELFRAV-------------- 167
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417  207 gllcgvvQGLQE------CGWGDVPVIA--------METFGAHSFHAAT-----TAGKLVSLPKITSVAKALGVKTVGSQ 267
Cdd:PRK06110 168 -------PDLDVvyvpigMGSGICGAIAardalglkTRIVGVVSAHAPAyalsfEAGRVVTTPVATTLADGMACRTPDPE 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417  268 ALKLFQEHpiFSEVI--SDQEAVAAIEKFVDDEKILVEPACGAALAAVYShviQKLQLEGnLRtplpslVVIVCGGSNIS 345
Cdd:PRK06110 241 ALEVIRAG--ADRIVrvTDDEVAAAMRAYFTDTHNVAEGAGAAALAAALQ---ERERLAG-KR------VGLVLSGGNID 308

                 ....*
gi 49258417  346 LAQLR 350
Cdd:PRK06110 309 RAVFA 313
CBS_like cd01561
CBS_like: This subgroup includes Cystathionine beta-synthase (CBS) and Cysteine synthase. CBS ...
46-313 7.51e-05

CBS_like: This subgroup includes Cystathionine beta-synthase (CBS) and Cysteine synthase. CBS is a unique heme-containing enzyme that catalyzes a pyridoxal 5'-phosphate (PLP)-dependent condensation of serine and homocysteine to give cystathionine. Deficiency of CBS leads to homocystinuria, an inherited disease of sulfur metabolism characterized by increased levels of the toxic metabolite homocysteine. Cysteine synthase on the other hand catalyzes the last step of cysteine biosynthesis. This subgroup also includes an O-Phosphoserine sulfhydrylase found in hyperthermophilic archaea which produces L-cysteine from sulfide and the more thermostable O-phospho-L-serine.


Pssm-ID: 107204  Cd Length: 291  Bit Score: 44.04  E-value: 7.51e-05
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417  46 KTPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRGIGHFCKRWAKQGCAH------------------FVCssagnagma 107
Cdd:cd01561   2 NTPLVRLNRLSPGTGAEIYAKLEFFNPGGSVKDRIALYMIEDAEKRGLLKpgttiieptsgntgiglaMVA--------- 72
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417 108 aayaaRQLGVPATIVVPGTTPALTIERLKNEGATCKVVGELLDE----AFELAKALAKNNPGWVYIPPFDDPLIWEGH-- 181
Cdd:cd01561  73 -----AAKGYRFIIVMPETMSEEKRKLLRALGAEVILTPEAEADgmkgAIAKARELAAETPNAFWLNQFENPANPEAHye 147
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417 182 ---ASIVKELKETLwekpgaialsvggggllcgvvqglqecgwgDVPVIAMETFGahsfhaaTTAGklVS------LPKI 252
Cdd:cd01561 148 ttaPEIWEQLDGKV------------------------------DAFVAGVGTGG-------TITG--VArylkekNPNV 188
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417 253 TSVakalGVKTVGSQALKLFQEHP------------------IFSEV--ISDQEAVAAIEKFVDDEKILVEPACGAALAA 312
Cdd:cd01561 189 RIV----GVDPVGSVLFSGGPPGPhkiegigagfipenldrsLIDEVvrVSDEEAFAMARRLAREEGLLVGGSSGAAVAA 264

                .
gi 49258417 313 V 313
Cdd:cd01561 265 A 265
CysK COG0031
Cysteine synthase [Amino acid transport and metabolism];
60-339 2.14e-04

Cysteine synthase [Amino acid transport and metabolism];


Pssm-ID: 223110  Cd Length: 300  Bit Score: 42.52  E-value: 2.14e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417  60 GTSVYLKMDSAQPSGSFKIRgIGHF------CKRWAKQGcAHFVCSSAGNAGMAAAYAARQLGVPATIVVPGTTPALTIE 133
Cdd:COG0031  25 GVEIYAKLESFNPGGSVKDR-IALYmiedaeKRGLLKPG-GTIVEATSGNTGIALAMVAAAKGYRLIIVMPETMSQERRK 102
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417 134 RLKNEGATCKVV---GELLDEAFELAKALAKNNPGWVYIPP-FDDPLIWEGH-ASIVKELKETLWEKPGAIAlsvggggl 208
Cdd:COG0031 103 LLRALGAEVILTpgaPGNMKGAIERAKELAAEIPGYAVWLNqFENPANPEAHyETTGPEIWQQTDGKVDAFV-------- 174
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49258417 209 lcgvvqglqeCGWGdvpviameTFGahsfHAATTAGKLVS-LPKITSVakalGVKTVGSQAL------------------ 269
Cdd:COG0031 175 ----------AGVG--------TGG----TITGVARYLKErNPNVRIV----AVDPEGSVLLsggegphkiegigagfvp 228
                       250       260       270       280       290       300       310
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 49258417 270 -KLFQEHPIFSEVISDQEAVAAIEKFVDDEKILVEPACGAALAAvYSHVIQKLQLEGNlrtplpsLVVIVC 339
Cdd:COG0031 229 eNLDLDLIDEVIRVSDEEAIATARRLAREEGLLVGISSGAALAA-ALKLAKELPAGKT-------IVTILP 291
PRK07409 PRK07409
threonine synthase; Validated
47-80 1.51e-03

threonine synthase; Validated


Pssm-ID: 236013  Cd Length: 353  Bit Score: 40.18  E-value: 1.51e-03
                         10        20        30
                 ....*....|....*....|....*....|....
gi 49258417   47 TPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRG 80
Cdd:PRK07409  32 TPLIPAPNLSELLGVEVYVKYEGLNPTGSFKDRG 65
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH