NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|530384404|ref|XP_005249635|]
View 

Protein Classification

PKD domain-containing protein (domain architecture ID 10065681)

PKD domain-containing protein similar to melanocyte protein PMEL and transmembrane glycoprotein NMB

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
PKD cd00146
polycystic kidney disease I (PKD) domain; similar to other cell-surface modules, with an ...
256-319 4.44e-09

polycystic kidney disease I (PKD) domain; similar to other cell-surface modules, with an IG-like fold; domain probably functions as a ligand binding site in protein-protein or protein-carbohydrate interactions; a single instance of the repeat is presented here. The domain is also found in microbial collagenases and chitinases.


:

Pssm-ID: 238084 [Multi-domain]  Cd Length: 81  Bit Score: 53.27  E-value: 4.44e-09
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 530384404 256 LKDLPIMFDVLIHDPSHflnYSTINYKWSFGDNTGlFVSTNHTVNHTYVLNGTFSLNLTVKAAA 319
Cdd:cd00146   10 VAELGASVTFSASDSSG---GSIVSYKWDFGDGEV-SSSGEPTVTHTYTKPGTYTVTLTVTNAV 69
 
Name Accession Description Interval E-value
PKD cd00146
polycystic kidney disease I (PKD) domain; similar to other cell-surface modules, with an ...
256-319 4.44e-09

polycystic kidney disease I (PKD) domain; similar to other cell-surface modules, with an IG-like fold; domain probably functions as a ligand binding site in protein-protein or protein-carbohydrate interactions; a single instance of the repeat is presented here. The domain is also found in microbial collagenases and chitinases.


Pssm-ID: 238084 [Multi-domain]  Cd Length: 81  Bit Score: 53.27  E-value: 4.44e-09
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 530384404 256 LKDLPIMFDVLIHDPSHflnYSTINYKWSFGDNTGlFVSTNHTVNHTYVLNGTFSLNLTVKAAA 319
Cdd:cd00146   10 VAELGASVTFSASDSSG---GSIVSYKWDFGDGEV-SSSGEPTVTHTYTKPGTYTVTLTVTNAV 69
PKD smart00089
Repeats in polycystic kidney disease 1 (PKD1) and other proteins; Polycystic kidney disease 1 ...
262-319 6.16e-08

Repeats in polycystic kidney disease 1 (PKD1) and other proteins; Polycystic kidney disease 1 protein contains 14 repeats, present elsewhere such as in microbial collagenases.


Pssm-ID: 214510 [Multi-domain]  Cd Length: 79  Bit Score: 49.76  E-value: 6.16e-08
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|....*...
gi 530384404   262 MFDVLIHDPSHfLNYSTINYKWSFGDNTglfVSTNHTVNHTYVLNGTFSLNLTVKAAA 319
Cdd:smart00089  14 GESVTFTATSS-DDGSIVSYTWDFGDGT---SSTGPTVTHTYTKPGTYTVTLTVTNAV 67
PKD pfam00801
PKD domain; This domain was first identified in the Polycystic kidney disease protein PKD1. ...
279-319 4.47e-05

PKD domain; This domain was first identified in the Polycystic kidney disease protein PKD1. This domain has been predicted to contain an Ig-like fold.


Pssm-ID: 395646 [Multi-domain]  Cd Length: 70  Bit Score: 41.60  E-value: 4.47e-05
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|.
gi 530384404  279 INYKWSFGDNTGLfVSTNHTVNHTYVLNGTFSLNLTVKAAA 319
Cdd:pfam00801  26 VTYTWDFGDSPGT-SGSGPTVTHTYLSPGTYTVTLTASNAV 65
PCC TIGR00864
polycystin cation channel protein; The Polycystin Cation Channel (PCC) Family (TC 1.A.5) ...
204-317 1.59e-03

polycystin cation channel protein; The Polycystin Cation Channel (PCC) Family (TC 1.A.5) Polycystin is a huge protein of 4303aas. Its repeated leucine-rich (LRR) segment is found in many proteins. It contains 16 polycystic kidney disease (PKD) domains, one LDL-receptor class A domain, one C-type lectin family domain, and 16-18 putative TMSs in positions between residues 2200 and 4100. Polycystin-L has been shown to be a cation (Na+, K+ and Ca2+) channel that is activated by Ca2+. Two members of the PCC family (polycystin 1 and 2) are mutated in autosomal dominant polycystic kidney disease, and polycystin-L is deleted in mice with renal and retinal defects. Note: this model is restricted to the amino half.


Pssm-ID: 188093 [Multi-domain]  Cd Length: 2740  Bit Score: 41.61  E-value: 1.59e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 530384404   204 GPQLMEVTVYRRHGRAYVPIAQVKDVYVVTDQIPVFVTMFQKNDRNSSDETFLKDLPIMFDVLIHDPSHFLnystinYKW 283
Cdd:TIGR00864 1216 GPEATVEHKYAKAGNCTVNIGAANAAGHGARIIHVEVFVFEVAGIEPAACIGEHADANFRARVSGNAAHYL------FDW 1289
                           90       100       110
                   ....*....|....*....|....*....|....*
gi 530384404   284 SFGD-NTGLFVSTNHTVNHTYVLNGTFSLNLTVKA 317
Cdd:TIGR00864 1290 SFGDgSPNETHHGCPGISHNFRGNGTFPLALTISS 1324
 
Name Accession Description Interval E-value
PKD cd00146
polycystic kidney disease I (PKD) domain; similar to other cell-surface modules, with an ...
256-319 4.44e-09

polycystic kidney disease I (PKD) domain; similar to other cell-surface modules, with an IG-like fold; domain probably functions as a ligand binding site in protein-protein or protein-carbohydrate interactions; a single instance of the repeat is presented here. The domain is also found in microbial collagenases and chitinases.


Pssm-ID: 238084 [Multi-domain]  Cd Length: 81  Bit Score: 53.27  E-value: 4.44e-09
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 530384404 256 LKDLPIMFDVLIHDPSHflnYSTINYKWSFGDNTGlFVSTNHTVNHTYVLNGTFSLNLTVKAAA 319
Cdd:cd00146   10 VAELGASVTFSASDSSG---GSIVSYKWDFGDGEV-SSSGEPTVTHTYTKPGTYTVTLTVTNAV 69
PKD smart00089
Repeats in polycystic kidney disease 1 (PKD1) and other proteins; Polycystic kidney disease 1 ...
262-319 6.16e-08

Repeats in polycystic kidney disease 1 (PKD1) and other proteins; Polycystic kidney disease 1 protein contains 14 repeats, present elsewhere such as in microbial collagenases.


Pssm-ID: 214510 [Multi-domain]  Cd Length: 79  Bit Score: 49.76  E-value: 6.16e-08
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|....*...
gi 530384404   262 MFDVLIHDPSHfLNYSTINYKWSFGDNTglfVSTNHTVNHTYVLNGTFSLNLTVKAAA 319
Cdd:smart00089  14 GESVTFTATSS-DDGSIVSYTWDFGDGT---SSTGPTVTHTYTKPGTYTVTLTVTNAV 67
PKD pfam00801
PKD domain; This domain was first identified in the Polycystic kidney disease protein PKD1. ...
279-319 4.47e-05

PKD domain; This domain was first identified in the Polycystic kidney disease protein PKD1. This domain has been predicted to contain an Ig-like fold.


Pssm-ID: 395646 [Multi-domain]  Cd Length: 70  Bit Score: 41.60  E-value: 4.47e-05
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|.
gi 530384404  279 INYKWSFGDNTGLfVSTNHTVNHTYVLNGTFSLNLTVKAAA 319
Cdd:pfam00801  26 VTYTWDFGDSPGT-SGSGPTVTHTYLSPGTYTVTLTASNAV 65
PKD_4 pfam18911
PKD domain; This entry is composed of PKD domains found in bacterial surface proteins.
277-315 9.02e-05

PKD domain; This entry is composed of PKD domains found in bacterial surface proteins.


Pssm-ID: 408681 [Multi-domain]  Cd Length: 81  Bit Score: 41.10  E-value: 9.02e-05
                          10        20        30
                  ....*....|....*....|....*....|....*....
gi 530384404  277 STINYKWSFGDNTGlfvSTNHTVNHTYVLNGTFSLNLTV 315
Cdd:pfam18911  42 DILTYTWDFGDGTT---ATGANVSHTYAAPGTYTVTLTV 77
PCC TIGR00864
polycystin cation channel protein; The Polycystin Cation Channel (PCC) Family (TC 1.A.5) ...
204-317 1.59e-03

polycystin cation channel protein; The Polycystin Cation Channel (PCC) Family (TC 1.A.5) Polycystin is a huge protein of 4303aas. Its repeated leucine-rich (LRR) segment is found in many proteins. It contains 16 polycystic kidney disease (PKD) domains, one LDL-receptor class A domain, one C-type lectin family domain, and 16-18 putative TMSs in positions between residues 2200 and 4100. Polycystin-L has been shown to be a cation (Na+, K+ and Ca2+) channel that is activated by Ca2+. Two members of the PCC family (polycystin 1 and 2) are mutated in autosomal dominant polycystic kidney disease, and polycystin-L is deleted in mice with renal and retinal defects. Note: this model is restricted to the amino half.


Pssm-ID: 188093 [Multi-domain]  Cd Length: 2740  Bit Score: 41.61  E-value: 1.59e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 530384404   204 GPQLMEVTVYRRHGRAYVPIAQVKDVYVVTDQIPVFVTMFQKNDRNSSDETFLKDLPIMFDVLIHDPSHFLnystinYKW 283
Cdd:TIGR00864 1216 GPEATVEHKYAKAGNCTVNIGAANAAGHGARIIHVEVFVFEVAGIEPAACIGEHADANFRARVSGNAAHYL------FDW 1289
                           90       100       110
                   ....*....|....*....|....*....|....*
gi 530384404   284 SFGD-NTGLFVSTNHTVNHTYVLNGTFSLNLTVKA 317
Cdd:TIGR00864 1290 SFGDgSPNETHHGCPGISHNFRGNGTFPLALTISS 1324
PCC TIGR00864
polycystin cation channel protein; The Polycystin Cation Channel (PCC) Family (TC 1.A.5) ...
232-319 1.91e-03

polycystin cation channel protein; The Polycystin Cation Channel (PCC) Family (TC 1.A.5) Polycystin is a huge protein of 4303aas. Its repeated leucine-rich (LRR) segment is found in many proteins. It contains 16 polycystic kidney disease (PKD) domains, one LDL-receptor class A domain, one C-type lectin family domain, and 16-18 putative TMSs in positions between residues 2200 and 4100. Polycystin-L has been shown to be a cation (Na+, K+ and Ca2+) channel that is activated by Ca2+. Two members of the PCC family (polycystin 1 and 2) are mutated in autosomal dominant polycystic kidney disease, and polycystin-L is deleted in mice with renal and retinal defects. Note: this model is restricted to the amino half.


Pssm-ID: 188093 [Multi-domain]  Cd Length: 2740  Bit Score: 41.22  E-value: 1.91e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 530384404   232 VTDQIPVFV-TMFQKNDRNSSDETFLKDLPIMFDvlihdPSHFLNYSTINYKWSFGDNTGLFVSTNHTVNHTYVLNGTF- 309
Cdd:TIGR00864 1075 ISQQINMSVrAILPRVAIGTEDGLLLAGKPADFE-----AHPLPSPGGIHYEWDFGDGSALLQGRQPAAAHTFAKRGPFh 1149
                           90
                   ....*....|...
gi 530384404   310 ---SLNLTVKAAA 319
Cdd:TIGR00864 1150 vclEVNNTISGAA 1162
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH