NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|545542760|ref|XP_005635867|]
View 

Protein Classification

G-protein coupled receptor (domain architecture ID 11535993)

G-protein coupled receptor transmits physiological signals from the outside of the cell to the inside via G proteins by binding to an extracellular agonist, which induces conformational changes that lead to the activation of heterotrimeric G proteins, which then bind to and activate numerous downstream effector proteins

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
7tm_classA_rhodopsin-like cd00637
rhodopsin receptor-like class A family of the seven-transmembrane G protein-coupled receptor ...
21-277 6.66e-04

rhodopsin receptor-like class A family of the seven-transmembrane G protein-coupled receptor superfamily; Class A rhodopsin-like receptors constitute about 90% of all GPCRs. The class A GPCRs include the light-sensitive rhodopsin as well as receptors for biogenic amines, lipids, nucleotides, odorants, peptide hormones, and a variety of other ligands. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes. Based on sequence similarity, GPCRs can be divided into six major classes: class A (rhodopsin-like family), class B (Methuselah-like, adhesion and secretin-like receptor family), class C (metabotropic glutamate receptor family), class D (fungal mating pheromone receptors), class E (cAMP receptor family), and class F (frizzled/smoothened receptor family). Nearly 800 human GPCR genes have been identified and are involved essentially in all major physiological processes. Approximately 40% of clinically marketed drugs mediate their effects through modulation of GPCR function for the treatment of a variety of human diseases including bacterial infections.


:

Pssm-ID: 410626 [Multi-domain]  Cd Length: 275  Bit Score: 40.35  E-value: 6.66e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 545542760  21 KASVYMVAFFFTTFVTVIIITIVSQNSKLKKeVRYVLLCH----HLLCISSYCGLGVVFQGMRALLANSpvLMCWVVFGV 96
Cdd:cd00637    1 LAVLYILIFVVGLVGNLLVILVILRNRRLRT-VTNYFILNlavaDLLVGLLVIPFSLVSLLLGRWWFGD--ALCKLLGFL 77
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 545542760  97 QLSVGEGILFTLALMAVNTYLAICWPLKSLSFVDSVKYRIL-AGSWIIIIFKNVCLFLIEGTTSTQVAVLKSEPLCPVIL 175
Cdd:cd00637   78 QSVSLLASILTLTAISVDRYLAIVHPLRYRRRFTRRRAKLLiALIWLLSLLLALPPLLGWGVYDYGGYCCCCLCWPDLTL 157
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 545542760 176 NGSAARAIGMVFLFFLLFIILISYSLIY-------------QEGKRAGHFNRSNIKARKTVLIHLVQMGLHVIPTLVFIG 242
Cdd:cd00637  158 SKAYTIFLFVLLFLLPLLVIIVCYVRIFrklrrhrrrirssSSNSSRRRRRRRERKVTKTLLIVVVVFLLCWLPYFILLL 237
                        250       260       270
                 ....*....|....*....|....*....|....*...
gi 545542760 243 LGKMCGVFFFALNMVLFGVFAFAQ---CLNPLIYGLWN 277
Cdd:cd00637  238 LDVFGPDPSPLPRILYFLALLLAYlnsAINPIIYAFFN 275
 
Name Accession Description Interval E-value
7tm_classA_rhodopsin-like cd00637
rhodopsin receptor-like class A family of the seven-transmembrane G protein-coupled receptor ...
21-277 6.66e-04

rhodopsin receptor-like class A family of the seven-transmembrane G protein-coupled receptor superfamily; Class A rhodopsin-like receptors constitute about 90% of all GPCRs. The class A GPCRs include the light-sensitive rhodopsin as well as receptors for biogenic amines, lipids, nucleotides, odorants, peptide hormones, and a variety of other ligands. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes. Based on sequence similarity, GPCRs can be divided into six major classes: class A (rhodopsin-like family), class B (Methuselah-like, adhesion and secretin-like receptor family), class C (metabotropic glutamate receptor family), class D (fungal mating pheromone receptors), class E (cAMP receptor family), and class F (frizzled/smoothened receptor family). Nearly 800 human GPCR genes have been identified and are involved essentially in all major physiological processes. Approximately 40% of clinically marketed drugs mediate their effects through modulation of GPCR function for the treatment of a variety of human diseases including bacterial infections.


Pssm-ID: 410626 [Multi-domain]  Cd Length: 275  Bit Score: 40.35  E-value: 6.66e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 545542760  21 KASVYMVAFFFTTFVTVIIITIVSQNSKLKKeVRYVLLCH----HLLCISSYCGLGVVFQGMRALLANSpvLMCWVVFGV 96
Cdd:cd00637    1 LAVLYILIFVVGLVGNLLVILVILRNRRLRT-VTNYFILNlavaDLLVGLLVIPFSLVSLLLGRWWFGD--ALCKLLGFL 77
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 545542760  97 QLSVGEGILFTLALMAVNTYLAICWPLKSLSFVDSVKYRIL-AGSWIIIIFKNVCLFLIEGTTSTQVAVLKSEPLCPVIL 175
Cdd:cd00637   78 QSVSLLASILTLTAISVDRYLAIVHPLRYRRRFTRRRAKLLiALIWLLSLLLALPPLLGWGVYDYGGYCCCCLCWPDLTL 157
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 545542760 176 NGSAARAIGMVFLFFLLFIILISYSLIY-------------QEGKRAGHFNRSNIKARKTVLIHLVQMGLHVIPTLVFIG 242
Cdd:cd00637  158 SKAYTIFLFVLLFLLPLLVIIVCYVRIFrklrrhrrrirssSSNSSRRRRRRRERKVTKTLLIVVVVFLLCWLPYFILLL 237
                        250       260       270
                 ....*....|....*....|....*....|....*...
gi 545542760 243 LGKMCGVFFFALNMVLFGVFAFAQ---CLNPLIYGLWN 277
Cdd:cd00637  238 LDVFGPDPSPLPRILYFLALLLAYlnsAINPIIYAFFN 275
 
Name Accession Description Interval E-value
7tm_classA_rhodopsin-like cd00637
rhodopsin receptor-like class A family of the seven-transmembrane G protein-coupled receptor ...
21-277 6.66e-04

rhodopsin receptor-like class A family of the seven-transmembrane G protein-coupled receptor superfamily; Class A rhodopsin-like receptors constitute about 90% of all GPCRs. The class A GPCRs include the light-sensitive rhodopsin as well as receptors for biogenic amines, lipids, nucleotides, odorants, peptide hormones, and a variety of other ligands. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes. Based on sequence similarity, GPCRs can be divided into six major classes: class A (rhodopsin-like family), class B (Methuselah-like, adhesion and secretin-like receptor family), class C (metabotropic glutamate receptor family), class D (fungal mating pheromone receptors), class E (cAMP receptor family), and class F (frizzled/smoothened receptor family). Nearly 800 human GPCR genes have been identified and are involved essentially in all major physiological processes. Approximately 40% of clinically marketed drugs mediate their effects through modulation of GPCR function for the treatment of a variety of human diseases including bacterial infections.


Pssm-ID: 410626 [Multi-domain]  Cd Length: 275  Bit Score: 40.35  E-value: 6.66e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 545542760  21 KASVYMVAFFFTTFVTVIIITIVSQNSKLKKeVRYVLLCH----HLLCISSYCGLGVVFQGMRALLANSpvLMCWVVFGV 96
Cdd:cd00637    1 LAVLYILIFVVGLVGNLLVILVILRNRRLRT-VTNYFILNlavaDLLVGLLVIPFSLVSLLLGRWWFGD--ALCKLLGFL 77
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 545542760  97 QLSVGEGILFTLALMAVNTYLAICWPLKSLSFVDSVKYRIL-AGSWIIIIFKNVCLFLIEGTTSTQVAVLKSEPLCPVIL 175
Cdd:cd00637   78 QSVSLLASILTLTAISVDRYLAIVHPLRYRRRFTRRRAKLLiALIWLLSLLLALPPLLGWGVYDYGGYCCCCLCWPDLTL 157
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 545542760 176 NGSAARAIGMVFLFFLLFIILISYSLIY-------------QEGKRAGHFNRSNIKARKTVLIHLVQMGLHVIPTLVFIG 242
Cdd:cd00637  158 SKAYTIFLFVLLFLLPLLVIIVCYVRIFrklrrhrrrirssSSNSSRRRRRRRERKVTKTLLIVVVVFLLCWLPYFILLL 237
                        250       260       270
                 ....*....|....*....|....*....|....*...
gi 545542760 243 LGKMCGVFFFALNMVLFGVFAFAQ---CLNPLIYGLWN 277
Cdd:cd00637  238 LDVFGPDPSPLPRILYFLALLLAYlnsAINPIIYAFFN 275
7tmA_Delta_opioid_R cd15089
opioid receptor subtype delta, member of the class A family of seven-transmembrane G ...
75-165 4.80e-03

opioid receptor subtype delta, member of the class A family of seven-transmembrane G protein-coupled receptors; The delta-opioid receptor binds the endogenous pentapeptide ligands such as enkephalins and produces antidepressant-like effects. The opioid receptor family is composed of four major subtypes: mu (MOP), delta (DOP), kappa (KOP) opioid receptors, and the nociceptin/orphanin FQ peptide receptor (NOP). They are distributed widely in the central nervous system and respond to classic alkaloid opiates, such as morphine and heroin, as well as to endogenous peptide ligands, which include dynorphins, enkephalins, endorphins, endomorphins, and nociceptin. Opioid receptors are coupled to inhibitory G proteins of the G(i/o) family and involved in regulating a variety of physiological functions such as pain, addiction, mood, stress, epileptic seizure, and obesity, among many others.


Pssm-ID: 320217 [Multi-domain]  Cd Length: 281  Bit Score: 38.01  E-value: 4.80e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 545542760  75 FQGMRALLANSPV--LMCWVVFGVQLSVGEGILFTLALMAVNTYLAICWPLKSLSFVDSVKYRILagswiiiifkNVCLF 152
Cdd:cd15089   55 FQSAKYLMETWPFgeLLCKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLI----------NICIW 124
                         90
                 ....*....|...
gi 545542760 153 LIEGTTSTQVAVL 165
Cdd:cd15089  125 VLSSGVGVPIMVM 137
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH