NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|56378009|dbj|BAD74187|]
View 

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Patched super family cl25655
Patched family; The transmembrane protein Patched is a receptor for the morphogene Sonic ...
1-174 1.87e-112

Patched family; The transmembrane protein Patched is a receptor for the morphogene Sonic Hedgehog. This protein associates with the smoothened protein to transduce hedgehog signals.


The actual alignment was detected with superfamily member TIGR00918:

Pssm-ID: 355433  Cd Length: 1145  Bit Score: 344.56  E-value: 1.87e-112
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56378009      1 MFNPQLMIQTPKEEGANVLTTEALLQHLDSALQASRVHVYMYNRQWKLEHLCYKSGELITETGYMDQIIEYLYPCLIITP 80
Cdd:TIGR00918  112 MFTPQLLIQTPHQEGANVLTPEALLQHLDSALKASRVHVYLYNRQWGLEHLCYKSGEPSTEGGYIEQILEKLIPCLIITP 191
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56378009     81 LDCFWEGAKLQSGTAYLLGKPPLRWTNFDPLEFLEELKKINYQVDSWEEMLNKAEVGHGYMDRPCLNPADPDCPATAPNK 160
Cdd:TIGR00918  192 LDCFWEGAKLQGGTAYLPGKPPLQWTNLDPASFLEELKQKMSQVESWEEMLKKAAVGQGYMERPCLNPADPDCPDTAPNK 271
                          170
                   ....*....|....
gi 56378009    161 NSTKPLDMALVLNG 174
Cdd:TIGR00918  272 NSTQPPDVAAVLSG 285
 
Name Accession Description Interval E-value
2A060602 TIGR00918
The Eukaryotic (Putative) Sterol Transporter (EST) Family;
1-174 1.87e-112

The Eukaryotic (Putative) Sterol Transporter (EST) Family;


Pssm-ID: 273338  Cd Length: 1145  Bit Score: 344.56  E-value: 1.87e-112
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56378009      1 MFNPQLMIQTPKEEGANVLTTEALLQHLDSALQASRVHVYMYNRQWKLEHLCYKSGELITETGYMDQIIEYLYPCLIITP 80
Cdd:TIGR00918  112 MFTPQLLIQTPHQEGANVLTPEALLQHLDSALKASRVHVYLYNRQWGLEHLCYKSGEPSTEGGYIEQILEKLIPCLIITP 191
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56378009     81 LDCFWEGAKLQSGTAYLLGKPPLRWTNFDPLEFLEELKKINYQVDSWEEMLNKAEVGHGYMDRPCLNPADPDCPATAPNK 160
Cdd:TIGR00918  192 LDCFWEGAKLQGGTAYLPGKPPLQWTNLDPASFLEELKQKMSQVESWEEMLKKAAVGQGYMERPCLNPADPDCPDTAPNK 271
                          170
                   ....*....|....
gi 56378009    161 NSTKPLDMALVLNG 174
Cdd:TIGR00918  272 NSTQPPDVAAVLSG 285
 
Name Accession Description Interval E-value
2A060602 TIGR00918
The Eukaryotic (Putative) Sterol Transporter (EST) Family;
1-174 1.87e-112

The Eukaryotic (Putative) Sterol Transporter (EST) Family;


Pssm-ID: 273338  Cd Length: 1145  Bit Score: 344.56  E-value: 1.87e-112
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56378009      1 MFNPQLMIQTPKEEGANVLTTEALLQHLDSALQASRVHVYMYNRQWKLEHLCYKSGELITETGYMDQIIEYLYPCLIITP 80
Cdd:TIGR00918  112 MFTPQLLIQTPHQEGANVLTPEALLQHLDSALKASRVHVYLYNRQWGLEHLCYKSGEPSTEGGYIEQILEKLIPCLIITP 191
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56378009     81 LDCFWEGAKLQSGTAYLLGKPPLRWTNFDPLEFLEELKKINYQVDSWEEMLNKAEVGHGYMDRPCLNPADPDCPATAPNK 160
Cdd:TIGR00918  192 LDCFWEGAKLQGGTAYLPGKPPLQWTNLDPASFLEELKQKMSQVESWEEMLKKAAVGQGYMERPCLNPADPDCPDTAPNK 271
                          170
                   ....*....|....
gi 56378009    161 NSTKPLDMALVLNG 174
Cdd:TIGR00918  272 NSTQPPDVAAVLSG 285
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH