NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|56694759|ref|YP_164479|]
View 

large tegument protein [Cercopithecine alphaherpesvirus 2]

Protein Classification

PHA03247 family protein (domain architecture ID 11476190)

PHA03247 family protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
PHA03247 PHA03247
large tegument protein UL36; Provisional
1-3070 0e+00

large tegument protein UL36; Provisional


:

Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 4167.34  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759     1 MAPRGDRGIVVTGARNQFAPDLEPGGAVSCMRSSLSFLSLVFDAGLRDALSAEAVDGCLVEGGAWTRASAGGAPPRMCSV 80
Cdd:PHA03247    1 MARRGDRGIVVTGARNQFAPDLEPGGAVSCMRSSLSFLSLVFDAGLRDALSAEAVDGCLVEGGAWTRASAGSGPPRMCSI 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759    81 VELPTFLEYPSGRGLRCVFSRVYGEVAFFGQPSPGLLETQCPAHDFFAGPWARRPLSYTLVTIGALGMGLYRDGDDAYLF 160
Cdd:PHA03247   81 VELPTFLEYPSGRGLRCVFSRVYGEVAFFGEPAPGLLETQCPAHDFFAGPWARRPLSYTLVTIGALGMGLYRDGDTAYLF 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759   161 DPHGLREGSPAFVAKVRAGEVYTYLTYYTQEHPEARWAGAMVFFVPWGPEPATPAGLAAAALRLYGASETYLQDEPFVER 240
Cdd:PHA03247  161 DPHGLREGSPAFVAKVRAGEVYTYLTYYTQDHPEARWAGAMVFFVPSGPGPAAPADLTAAALHLYGASETYLQDEPFVER 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759   241 RAVASHPLRGDDVPGTPPVGEGGGG--TPGTARGATSRPPPPEPSAPADPGPAAppSGVWGAALAGAPLALPAPPPSSDS 318
Cdd:PHA03247  241 RVVISHPLRGDIAAPAPPPVVGEGAdrAPETARGATGPPPPPEAAAPNGAAAPP--DGVWGAALAGAPLALPAPPDPPPP 318
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759   319 APATDVDDTDGEDGAMEVVSPLPHPKQHYPLGFPKRRRPTWTPPSSLEDLSAGRHHPKRASLPTRTRRAARHAASPFARG 398
Cdd:PHA03247  319 APAGDAEEEDDEDGAMEVVSPLPRPRQHYPLGFPKRRRPTWTPPSSLEDLSAGRHHPKRASLPTRKRRSARHAATPFARG 398
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759   399 PGGGDQPRPSTPTPAPAPVPVPATTPAPAPAPLPtaDPLPAADPASSESPAPPPERQPAADATepvpdDATEPAPDDATR 478
Cdd:PHA03247  399 PGGDDQTRPAAPVPASVPTPAPTPVPASAPPPPA--TPLPSAEPGSDDGPAPPPERQPPAPAT-----EPAPDDPDDATR 471
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759   479 KALDALRERRPPEPPACDPAELLGRYPDTGGVVSRLAEREVTIAREVAECSRLTVNALRSPFPDAPGLLQHCIILLFERV 558
Cdd:PHA03247  472 KALDALRERRPPEPPGADLAELLGRHPDTAGTVVRLAAREAAIAREVAECSRLTINALRSPFPASPGLLQHCVIFLFERV 551
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759   559 LAFLIENGARTHAGAGAEGPASALLDLTLGLLPNRTAVGDFLASTRMTLADVAAHVPLIQPVIEEGSGVGRLALAKLVLV 638
Cdd:PHA03247  552 LAFLIENGARTHAGAGAEGPAAALLDLTLSLLPRRTAVGDFLASTRMTLADVAAHLPLIQPVLDEGSGVGRLALAKLVLV 631
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759   639 ARDVIRATDELHGELAELERQLRATPPTEVYARLSEWLLERSRAGPDTLFAPATPTHPEPLLQRVQALAGFARGEEARAA 718
Cdd:PHA03247  632 ARDVIRETDAFHGELAELERQLRATPPAEVYARLSEWLLERSRAGPDTLFAPATPTHPEPLLQRVQALAGFARGEEIRAA 711
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759   719 AEDREVRGALDALARSVDAVARRGGPLAVA-APEAPGGTEDPPPHPLSPQAVRSRLDRVRAEGQKAVEGAVKEYFLRGAV 797
Cdd:PHA03247  712 AEDREVRGALDALARGVDAVARRAGPLTVApAPAAPGGQGAPRPPPLSPEAIRVRLEQVRAQGQRAIEGAVKEYFHRGAV 791
                         810       820       830       840       850       860       870       880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759   798 YSAKALLAGDARDRRYHVASAPVVPVAQLLESLPAFDARVREVAARARVPAPPPLATSPAADLLRELLQRGCDLEAPADL 877
Cdd:PHA03247  792 YSAKALLAGDARDRRFHVASAPVVPVVQLLESLPAFDAHVREVAQRARVPAPPPLATSPQAILLRELLQRGQDLEAPADL 871
                         890       900       910       920       930       940       950       960
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759   878 AAWLASLGDAAGQGLVARKELDELAQAIHKINERVVRRSSGLAELERFEALDAALRRELESEAAFEPAADHAAGGDDAAA 957
Cdd:PHA03247  872 AAWLASLGDAAGQGLVERKELDELARAIHKINERQVRRSSGLAELERFEALDAALRQELESEAAFVPAPGAAPYADAGGL 951
                         970       980       990      1000      1010      1020      1030      1040
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759   958 GglaPETRRLAEDALRQAKAMAAAKLTDELSPEARDRLGARARAIEDLLAEARARAEAARAARTRFFQRLQGVLRPLPDF 1037
Cdd:PHA03247  952 S---PETRRLAEDALRQAKAMAAAKLTDELSPEARERLRARARAIEAMLEEARERAEAARAARERFFQKLQGVLRPLPDF 1028
                        1050      1060      1070      1080      1090      1100      1110      1120
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  1038 GGLRTAPAVLATLRADLPGGWTCLPDAAQAAPPEVRAALRADLWGLLGQYRAALEHPTPDTAAALSGLHPNFVEALRDLF 1117
Cdd:PHA03247 1029 GGLRAAPAVLATLRADLPGGWTDLPDAAQAAPPEVRAALRADLWGLLGQYREALEHPTPDTATALSGLHPNFVEVLRDLF 1108
                        1130      1140      1150      1160      1170      1180      1190      1200
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  1118 PAAPETPLLVSFFSDHAPRVARAVSEAINAGGAAVATASPESTVEAAARARDVLAAAVAALSPAVLDPACPLAFLVALAD 1197
Cdd:PHA03247 1109 PAAPETPLLVQFFSDHAPRIARAVSEAINAGSAAVATASPESTVDAAVRAHGVLADAVAALSPAVRDPACPLAFLVALAD 1188
                        1210      1220      1230      1240      1250      1260      1270      1280
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  1198 SAAGYERATRLALDARRAIARLGALGAAAADLAAAVRRENPEAEGDRAALLEAAARAVAEARAGLAACEGEFGGLLHAEG 1277
Cdd:PHA03247 1189 SAAGYVKATRLALDARRAIARLGALGAAAADLAVAVRRENPQAEGDRAALLEAAARAVTAAREGLAACEGEFGGLLHAEG 1268
                        1290      1300      1310      1320      1330      1340      1350      1360
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  1278 STGDPSPSGRALQELGKVVGATRRRADELEAAAADLAEKLAARRARDSRERWVADVDAALDRVENRAEFDAVELRRLQAL 1357
Cdd:PHA03247 1269 SAGDPSPSGRALQELGKVVGATRRRADELEAAAADLAEKMAARRARASRERWAADVEAALDRVENRAEFDAVELRRLQAL 1348
                        1370      1380      1390      1400      1410      1420      1430      1440
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  1358 AAQSNYNPRDFRKRAERALAANAETATLALEAAFAFNPYTPENQRHPALPPLAAVHRLDWGPAFGAAAETYAEMFRVDTE 1437
Cdd:PHA03247 1349 AATHGYNPRDFRKRAEQALAANAKTATLALEAAFAFNPYTPENQRHPMLPPLAAIHRIDWGPAFGAAAETYAEMFRVDTE 1428
                        1450      1460      1470      1480      1490      1500      1510      1520
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  1438 PLARLLRLAEGLLALSQAGGGFIDYHEAVSRLAEDLNGVPSLRRYVAFFRRGHAEYLGLCDRLAALRADVHRALGGVPLD 1517
Cdd:PHA03247 1429 PLARLLRLAGGLLELAQAGGGFIDYHEAVSRLAEDLNGVPSLRRYVPFFRRGHAEYLELCDRLDALRADVHRALGGVPLD 1508
                        1530      1540      1550      1560      1570      1580      1590      1600
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  1518 LAAAAERTTRLRADPAAAAELVRTGVALACPSEDALAACVGALERVDQTPVKDTAYAEYIAYAARRDLGEAKDALVRAKQ 1597
Cdd:PHA03247 1509 LAAAAEQTSRLRNDPAAAAELVRTGVTLACPSEDALAACVGALERVDQSPVKDTAYAEYVAFVARRDLAEAKDALVRAKQ 1588
                        1610      1620      1630      1640      1650      1660      1670      1680
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  1598 QRAEATDRVTAALREALAAHERRAQSEAESLANLKTLLRVAAIPATAAKTLDQARSVPEIVDQIELLLEQTEKAAELDPG 1677
Cdd:PHA03247 1589 QRAEATDRVTAALREALAAHERRAQSEAESLANLKTLLRVAAIPATAAKTLDQARSVAEIVDQIELLLEQTEKAAELDVA 1668
                        1690      1700      1710      1720      1730      1740      1750      1760
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  1678 AVDWLEHARRVFGAHPLTAARDGAPDPLARLHGRLDALGEACRRTTALRRSLEAAAAEWDEVWVRFGRVRGGAWKSPAAL 1757
Cdd:PHA03247 1669 AVDWLEHARRVFEAHPLTAARGGGPDPLARLHARLDALGETRRRTEALRRSLEAAEAEWDEVWGRFGRVRGGAWKSPEAL 1748
                        1770      1780      1790      1800      1810      1820      1830      1840
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  1758 EAAREQLCALRTATNTVLGLMADAHYPRLPAKDRGALGAKSAERAGAVEEMGVAVARHDGLLARLREEVVARVPWEMNAD 1837
Cdd:PHA03247 1749 RAAREQLRALQTATNTVLGLRADAHYERLPAKYQGALGAKSAERAGAVEELGAAVARHDGLLARLREEVVARVPWEMNAD 1828
                        1850      1860      1870      1880      1890      1900      1910      1920
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  1838 ALGRLLVEFDALAGDLPPWAVDEFRGARALVQHRLGLYSAYAAARAHRGAGGPPPPAPLLADIRALEARAQSPDERRAPD 1917
Cdd:PHA03247 1829 ALGRLLAEFDALAGDLAPWAVDEFRGARALVQHRLGLYSAYAKARAQTGAGGAAPPAPLLVDLRALEARARSPPERHEPD 1908
                        1930      1940      1950      1960      1970      1980      1990      2000
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  1918 LRMVRCRGEAYLRASGDPGPLELREATSELDLPFAISYLAPDGTPLQYALCFPAVTDKLGALLMRPEAARARPALPSEGL 1997
Cdd:PHA03247 1909 PRMVRRRGEAYLRASGDPGPLELREATSELDLPFATSYLAPDGTPLQYALCFPAVTDKLGALLMRPEAARARPPLPTEGL 1988
                        2010      2020      2030      2040      2050      2060      2070      2080
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  1998 EATQTLAAMCTVPLITHLQLALSDAQGDGFRLFGRFVRHRQPAWRDSVAAAAELYAALVATTLTREFGCRWDELGWARGE 2077
Cdd:PHA03247 1989 ESTQTLAAMCTVPLITRLQLALSDAQGAGFRLFGRFVRHRQPAWRDSMAAAAELYAALVATTLTREFGCRWDELGWARGA 2068
                        2090      2100      2110      2120      2130      2140      2150      2160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  2078 GALAPLAEPAGARRPRVTFSINDLMVALVAGTPEHIYNFWRLDLVLQHEYMHLTLPAAWETGAGAILFVQRLTPHARPEV 2157
Cdd:PHA03247 2069 AAPAPLAEPAGSRRPRVTFNENDVMVALVAGTPEHIYNFWRLDLVLQHEYMHLTLPAAWETGAGSILFVQRLTPHPDPEV 2148
                        2170      2180      2190      2200      2210      2220      2230      2240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  2158 RVLPAVPAGPPPATGLLFGTRLADWRHGKLSPSDPLAPWRAAPELAAGGAAAALGGLDGPRALVAVSVLGRMCLPSAALA 2237
Cdd:PHA03247 2149 RVLPAVPAGPPPATGLLFGTRLADWRHGKLSESDPLAPWRAAPELAAGGAAAALGGLSGPRALVAVSVLGRMCLPSAALA 2228
                        2250      2260      2270      2280      2290      2300      2310      2320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  2238 ALWSCMFPDGYSEYDSLDALLEARLGSGRAPDPQGGREDAPAPPAHALYRPSGQRVLVRGGPPDPAARVTVMDLVLAATL 2317
Cdd:PHA03247 2229 ALWSCMFPDGYSEYDSLDALLAARLGSGRTPDPQGGREDSPAPPAHALYRPSGQRVLVRGGAPDPAARVTVMDLVLAATL 2308
                        2330      2340      2350      2360      2370      2380      2390      2400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  2318 LGAPVVVALRSDPAFSEGSELELCVTLFDSRAGAADAALREVVSSDVETWAADLMHADPNVIENACLAAQLPALSALVAA 2397
Cdd:PHA03247 2309 LGAPVVVALRSDPAFSRGSELELCVTLFDSRARGADAALREVVSSDVETWAVDLLHADLNPIENACLAAQLPALSALIAA 2388
                        2410      2420      2430      2440      2450      2460      2470      2480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  2398 RPLAGSPPCLVIVDISMAPLFVLWERPDPPGPPDVRFVGGEEIEELPFVSPGVEVLAGLAAKDDPFFARTILGAPFSLSH 2477
Cdd:PHA03247 2389 RPLARSPPCLVLVDISMAPLFVLWEQPDPPGPPDVRFVGSEEIEELPFVSPGGDVLAGLAADGDPFFARTILGAPFSLSL 2468
                        2490      2500      2510      2520      2530      2540      2550      2560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  2478 LLREAFPGAPAYRRPAEARFPFAARGAP--DPGPDPDPDAPPTPSRPAPAILPDEPVGEAVHPRMLTWIRGLEELASDDA 2555
Cdd:PHA03247 2469 LLGELFPGAPVYRRPAEARFPFAAGAAPdpGGGGPPDPDAPPAPSRLAPAILPDEPVGEPVHPRMLTWIRGLEELASDDA 2548
                        2570      2580      2590      2600      2610      2620      2630      2640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  2556 GDPPPPLPPAAPPAAPDRSVPPPRPAPRPSEPAVRSRARRPDAPPQPASPRTPGDDSGSPPGPAAPNALPPDTHPPDPPP 2635
Cdd:PHA03247 2549 GDPPPPLPPAAPPAAPDRSVPPPRPAPRPSEPAVTSRARRPDAPPQSARPRAPVDDRGDPRGPAPPSPLPPDTHAPDPPP 2628
                        2650      2660      2670      2680      2690      2700      2710      2720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  2636 PAPRPHGNEAPEpHPLPTAPPPEQPRDDPAPRRVSPRRRVSPPRRPRRR----------AARPTVGSLASLAD------- 2698
Cdd:PHA03247 2629 PSPSPAANEPDP-HPPPTVPPPERPRDDPAPGRVSRPRRARRLGRAAQAssppqrprrrAARPTVGSLTSLADppppppt 2707
                        2730      2740      2750      2760      2770      2780      2790      2800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  2699 --------------------PPPPEREPEPRPAPRASPNAPATDVSVTPVPSPPATSGAPRSAPPAAPPTTPPPAAPVQA 2758
Cdd:PHA03247 2708 pepaphalvsatplppgpaaARQASPALPAAPAPPAVPAGPATPGGPARPARPPTTAGPPAPAPPAAPAAGPPRRLTRPA 2787
                        2810      2820      2830      2840      2850      2860      2870      2880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  2759 PAATLPPPTTPTPAAPPKPP--------------------------------------LESTLSMGGAVAPGGDFRRRGP 2800
Cdd:PHA03247 2788 VASLSESRESLPSPWDPADPpaavlapaaalppaaspagplppptsaqptapppppgpPPPSLPLGGSVAPGGDVRRRPP 2867
                        2890      2900      2910      2920      2930      2940      2950      2960
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  2801 SRAAPA-PATPRHPPVRRLARPAVSRSTESFALPPDSPERPPPPDSPERPRTPATEEAPASETPAPRTPGRSDAPLAPTT 2879
Cdd:PHA03247 2868 SRSPAAkPAAPARPPVRRLARPAVSRSTESFALPPDQPERPPQPQAPPPPQPQPQPPPPPQPQPPPPPPPRPQPPLAPTT 2947
                        2970      2980      2990      3000      3010      3020      3030      3040
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  2880 DTAGAGEPTGAAPNPWLGALVPGRVEVPR-RVSSPAPSREAPAPSTSSLHDH-DPRLSSWASSLALDEETDPRPVSLKQT 2957
Cdd:PHA03247 2948 DPAGAGEPSGAVPQPWLGALVPGRVAVPRfRVPQPAPSREAPASSTPPLTGHsLSRVSSWASSLALHEETDPPPVSLKQT 3027
                        3050      3060      3070      3080      3090      3100      3110      3120
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  2958 LWPPDDTEGSD-------DTEDSDESSV----DANPNDPNDPNDPPTPEAGAREDPGSHFGPPPLSANAALSRRYVRSTG 3026
Cdd:PHA03247 3028 LWPPDDTEDSDadslfdsDSERSDLEALdplpPEPHDPFAHEPDPATPEAGARESPSSQFGPPPLSANAALSRRYVRSTG 3107
                        3130      3140      3150      3160
                  ....*....|....*....|....*....|....*....|....
gi 56694759  3027 RSALAVLIEACRRLRRQLRRTRHALIDRSEAVLTGLYHVRMLLG 3070
Cdd:PHA03247 3108 RSALAVLIEACRRIRRQLRRTRHALLDRSGAVLTGLYHVRMLLG 3151
 
Name Accession Description Interval E-value
PHA03247 PHA03247
large tegument protein UL36; Provisional
1-3070 0e+00

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 4167.34  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759     1 MAPRGDRGIVVTGARNQFAPDLEPGGAVSCMRSSLSFLSLVFDAGLRDALSAEAVDGCLVEGGAWTRASAGGAPPRMCSV 80
Cdd:PHA03247    1 MARRGDRGIVVTGARNQFAPDLEPGGAVSCMRSSLSFLSLVFDAGLRDALSAEAVDGCLVEGGAWTRASAGSGPPRMCSI 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759    81 VELPTFLEYPSGRGLRCVFSRVYGEVAFFGQPSPGLLETQCPAHDFFAGPWARRPLSYTLVTIGALGMGLYRDGDDAYLF 160
Cdd:PHA03247   81 VELPTFLEYPSGRGLRCVFSRVYGEVAFFGEPAPGLLETQCPAHDFFAGPWARRPLSYTLVTIGALGMGLYRDGDTAYLF 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759   161 DPHGLREGSPAFVAKVRAGEVYTYLTYYTQEHPEARWAGAMVFFVPWGPEPATPAGLAAAALRLYGASETYLQDEPFVER 240
Cdd:PHA03247  161 DPHGLREGSPAFVAKVRAGEVYTYLTYYTQDHPEARWAGAMVFFVPSGPGPAAPADLTAAALHLYGASETYLQDEPFVER 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759   241 RAVASHPLRGDDVPGTPPVGEGGGG--TPGTARGATSRPPPPEPSAPADPGPAAppSGVWGAALAGAPLALPAPPPSSDS 318
Cdd:PHA03247  241 RVVISHPLRGDIAAPAPPPVVGEGAdrAPETARGATGPPPPPEAAAPNGAAAPP--DGVWGAALAGAPLALPAPPDPPPP 318
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759   319 APATDVDDTDGEDGAMEVVSPLPHPKQHYPLGFPKRRRPTWTPPSSLEDLSAGRHHPKRASLPTRTRRAARHAASPFARG 398
Cdd:PHA03247  319 APAGDAEEEDDEDGAMEVVSPLPRPRQHYPLGFPKRRRPTWTPPSSLEDLSAGRHHPKRASLPTRKRRSARHAATPFARG 398
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759   399 PGGGDQPRPSTPTPAPAPVPVPATTPAPAPAPLPtaDPLPAADPASSESPAPPPERQPAADATepvpdDATEPAPDDATR 478
Cdd:PHA03247  399 PGGDDQTRPAAPVPASVPTPAPTPVPASAPPPPA--TPLPSAEPGSDDGPAPPPERQPPAPAT-----EPAPDDPDDATR 471
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759   479 KALDALRERRPPEPPACDPAELLGRYPDTGGVVSRLAEREVTIAREVAECSRLTVNALRSPFPDAPGLLQHCIILLFERV 558
Cdd:PHA03247  472 KALDALRERRPPEPPGADLAELLGRHPDTAGTVVRLAAREAAIAREVAECSRLTINALRSPFPASPGLLQHCVIFLFERV 551
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759   559 LAFLIENGARTHAGAGAEGPASALLDLTLGLLPNRTAVGDFLASTRMTLADVAAHVPLIQPVIEEGSGVGRLALAKLVLV 638
Cdd:PHA03247  552 LAFLIENGARTHAGAGAEGPAAALLDLTLSLLPRRTAVGDFLASTRMTLADVAAHLPLIQPVLDEGSGVGRLALAKLVLV 631
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759   639 ARDVIRATDELHGELAELERQLRATPPTEVYARLSEWLLERSRAGPDTLFAPATPTHPEPLLQRVQALAGFARGEEARAA 718
Cdd:PHA03247  632 ARDVIRETDAFHGELAELERQLRATPPAEVYARLSEWLLERSRAGPDTLFAPATPTHPEPLLQRVQALAGFARGEEIRAA 711
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759   719 AEDREVRGALDALARSVDAVARRGGPLAVA-APEAPGGTEDPPPHPLSPQAVRSRLDRVRAEGQKAVEGAVKEYFLRGAV 797
Cdd:PHA03247  712 AEDREVRGALDALARGVDAVARRAGPLTVApAPAAPGGQGAPRPPPLSPEAIRVRLEQVRAQGQRAIEGAVKEYFHRGAV 791
                         810       820       830       840       850       860       870       880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759   798 YSAKALLAGDARDRRYHVASAPVVPVAQLLESLPAFDARVREVAARARVPAPPPLATSPAADLLRELLQRGCDLEAPADL 877
Cdd:PHA03247  792 YSAKALLAGDARDRRFHVASAPVVPVVQLLESLPAFDAHVREVAQRARVPAPPPLATSPQAILLRELLQRGQDLEAPADL 871
                         890       900       910       920       930       940       950       960
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759   878 AAWLASLGDAAGQGLVARKELDELAQAIHKINERVVRRSSGLAELERFEALDAALRRELESEAAFEPAADHAAGGDDAAA 957
Cdd:PHA03247  872 AAWLASLGDAAGQGLVERKELDELARAIHKINERQVRRSSGLAELERFEALDAALRQELESEAAFVPAPGAAPYADAGGL 951
                         970       980       990      1000      1010      1020      1030      1040
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759   958 GglaPETRRLAEDALRQAKAMAAAKLTDELSPEARDRLGARARAIEDLLAEARARAEAARAARTRFFQRLQGVLRPLPDF 1037
Cdd:PHA03247  952 S---PETRRLAEDALRQAKAMAAAKLTDELSPEARERLRARARAIEAMLEEARERAEAARAARERFFQKLQGVLRPLPDF 1028
                        1050      1060      1070      1080      1090      1100      1110      1120
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  1038 GGLRTAPAVLATLRADLPGGWTCLPDAAQAAPPEVRAALRADLWGLLGQYRAALEHPTPDTAAALSGLHPNFVEALRDLF 1117
Cdd:PHA03247 1029 GGLRAAPAVLATLRADLPGGWTDLPDAAQAAPPEVRAALRADLWGLLGQYREALEHPTPDTATALSGLHPNFVEVLRDLF 1108
                        1130      1140      1150      1160      1170      1180      1190      1200
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  1118 PAAPETPLLVSFFSDHAPRVARAVSEAINAGGAAVATASPESTVEAAARARDVLAAAVAALSPAVLDPACPLAFLVALAD 1197
Cdd:PHA03247 1109 PAAPETPLLVQFFSDHAPRIARAVSEAINAGSAAVATASPESTVDAAVRAHGVLADAVAALSPAVRDPACPLAFLVALAD 1188
                        1210      1220      1230      1240      1250      1260      1270      1280
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  1198 SAAGYERATRLALDARRAIARLGALGAAAADLAAAVRRENPEAEGDRAALLEAAARAVAEARAGLAACEGEFGGLLHAEG 1277
Cdd:PHA03247 1189 SAAGYVKATRLALDARRAIARLGALGAAAADLAVAVRRENPQAEGDRAALLEAAARAVTAAREGLAACEGEFGGLLHAEG 1268
                        1290      1300      1310      1320      1330      1340      1350      1360
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  1278 STGDPSPSGRALQELGKVVGATRRRADELEAAAADLAEKLAARRARDSRERWVADVDAALDRVENRAEFDAVELRRLQAL 1357
Cdd:PHA03247 1269 SAGDPSPSGRALQELGKVVGATRRRADELEAAAADLAEKMAARRARASRERWAADVEAALDRVENRAEFDAVELRRLQAL 1348
                        1370      1380      1390      1400      1410      1420      1430      1440
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  1358 AAQSNYNPRDFRKRAERALAANAETATLALEAAFAFNPYTPENQRHPALPPLAAVHRLDWGPAFGAAAETYAEMFRVDTE 1437
Cdd:PHA03247 1349 AATHGYNPRDFRKRAEQALAANAKTATLALEAAFAFNPYTPENQRHPMLPPLAAIHRIDWGPAFGAAAETYAEMFRVDTE 1428
                        1450      1460      1470      1480      1490      1500      1510      1520
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  1438 PLARLLRLAEGLLALSQAGGGFIDYHEAVSRLAEDLNGVPSLRRYVAFFRRGHAEYLGLCDRLAALRADVHRALGGVPLD 1517
Cdd:PHA03247 1429 PLARLLRLAGGLLELAQAGGGFIDYHEAVSRLAEDLNGVPSLRRYVPFFRRGHAEYLELCDRLDALRADVHRALGGVPLD 1508
                        1530      1540      1550      1560      1570      1580      1590      1600
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  1518 LAAAAERTTRLRADPAAAAELVRTGVALACPSEDALAACVGALERVDQTPVKDTAYAEYIAYAARRDLGEAKDALVRAKQ 1597
Cdd:PHA03247 1509 LAAAAEQTSRLRNDPAAAAELVRTGVTLACPSEDALAACVGALERVDQSPVKDTAYAEYVAFVARRDLAEAKDALVRAKQ 1588
                        1610      1620      1630      1640      1650      1660      1670      1680
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  1598 QRAEATDRVTAALREALAAHERRAQSEAESLANLKTLLRVAAIPATAAKTLDQARSVPEIVDQIELLLEQTEKAAELDPG 1677
Cdd:PHA03247 1589 QRAEATDRVTAALREALAAHERRAQSEAESLANLKTLLRVAAIPATAAKTLDQARSVAEIVDQIELLLEQTEKAAELDVA 1668
                        1690      1700      1710      1720      1730      1740      1750      1760
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  1678 AVDWLEHARRVFGAHPLTAARDGAPDPLARLHGRLDALGEACRRTTALRRSLEAAAAEWDEVWVRFGRVRGGAWKSPAAL 1757
Cdd:PHA03247 1669 AVDWLEHARRVFEAHPLTAARGGGPDPLARLHARLDALGETRRRTEALRRSLEAAEAEWDEVWGRFGRVRGGAWKSPEAL 1748
                        1770      1780      1790      1800      1810      1820      1830      1840
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  1758 EAAREQLCALRTATNTVLGLMADAHYPRLPAKDRGALGAKSAERAGAVEEMGVAVARHDGLLARLREEVVARVPWEMNAD 1837
Cdd:PHA03247 1749 RAAREQLRALQTATNTVLGLRADAHYERLPAKYQGALGAKSAERAGAVEELGAAVARHDGLLARLREEVVARVPWEMNAD 1828
                        1850      1860      1870      1880      1890      1900      1910      1920
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  1838 ALGRLLVEFDALAGDLPPWAVDEFRGARALVQHRLGLYSAYAAARAHRGAGGPPPPAPLLADIRALEARAQSPDERRAPD 1917
Cdd:PHA03247 1829 ALGRLLAEFDALAGDLAPWAVDEFRGARALVQHRLGLYSAYAKARAQTGAGGAAPPAPLLVDLRALEARARSPPERHEPD 1908
                        1930      1940      1950      1960      1970      1980      1990      2000
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  1918 LRMVRCRGEAYLRASGDPGPLELREATSELDLPFAISYLAPDGTPLQYALCFPAVTDKLGALLMRPEAARARPALPSEGL 1997
Cdd:PHA03247 1909 PRMVRRRGEAYLRASGDPGPLELREATSELDLPFATSYLAPDGTPLQYALCFPAVTDKLGALLMRPEAARARPPLPTEGL 1988
                        2010      2020      2030      2040      2050      2060      2070      2080
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  1998 EATQTLAAMCTVPLITHLQLALSDAQGDGFRLFGRFVRHRQPAWRDSVAAAAELYAALVATTLTREFGCRWDELGWARGE 2077
Cdd:PHA03247 1989 ESTQTLAAMCTVPLITRLQLALSDAQGAGFRLFGRFVRHRQPAWRDSMAAAAELYAALVATTLTREFGCRWDELGWARGA 2068
                        2090      2100      2110      2120      2130      2140      2150      2160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  2078 GALAPLAEPAGARRPRVTFSINDLMVALVAGTPEHIYNFWRLDLVLQHEYMHLTLPAAWETGAGAILFVQRLTPHARPEV 2157
Cdd:PHA03247 2069 AAPAPLAEPAGSRRPRVTFNENDVMVALVAGTPEHIYNFWRLDLVLQHEYMHLTLPAAWETGAGSILFVQRLTPHPDPEV 2148
                        2170      2180      2190      2200      2210      2220      2230      2240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  2158 RVLPAVPAGPPPATGLLFGTRLADWRHGKLSPSDPLAPWRAAPELAAGGAAAALGGLDGPRALVAVSVLGRMCLPSAALA 2237
Cdd:PHA03247 2149 RVLPAVPAGPPPATGLLFGTRLADWRHGKLSESDPLAPWRAAPELAAGGAAAALGGLSGPRALVAVSVLGRMCLPSAALA 2228
                        2250      2260      2270      2280      2290      2300      2310      2320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  2238 ALWSCMFPDGYSEYDSLDALLEARLGSGRAPDPQGGREDAPAPPAHALYRPSGQRVLVRGGPPDPAARVTVMDLVLAATL 2317
Cdd:PHA03247 2229 ALWSCMFPDGYSEYDSLDALLAARLGSGRTPDPQGGREDSPAPPAHALYRPSGQRVLVRGGAPDPAARVTVMDLVLAATL 2308
                        2330      2340      2350      2360      2370      2380      2390      2400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  2318 LGAPVVVALRSDPAFSEGSELELCVTLFDSRAGAADAALREVVSSDVETWAADLMHADPNVIENACLAAQLPALSALVAA 2397
Cdd:PHA03247 2309 LGAPVVVALRSDPAFSRGSELELCVTLFDSRARGADAALREVVSSDVETWAVDLLHADLNPIENACLAAQLPALSALIAA 2388
                        2410      2420      2430      2440      2450      2460      2470      2480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  2398 RPLAGSPPCLVIVDISMAPLFVLWERPDPPGPPDVRFVGGEEIEELPFVSPGVEVLAGLAAKDDPFFARTILGAPFSLSH 2477
Cdd:PHA03247 2389 RPLARSPPCLVLVDISMAPLFVLWEQPDPPGPPDVRFVGSEEIEELPFVSPGGDVLAGLAADGDPFFARTILGAPFSLSL 2468
                        2490      2500      2510      2520      2530      2540      2550      2560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  2478 LLREAFPGAPAYRRPAEARFPFAARGAP--DPGPDPDPDAPPTPSRPAPAILPDEPVGEAVHPRMLTWIRGLEELASDDA 2555
Cdd:PHA03247 2469 LLGELFPGAPVYRRPAEARFPFAAGAAPdpGGGGPPDPDAPPAPSRLAPAILPDEPVGEPVHPRMLTWIRGLEELASDDA 2548
                        2570      2580      2590      2600      2610      2620      2630      2640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  2556 GDPPPPLPPAAPPAAPDRSVPPPRPAPRPSEPAVRSRARRPDAPPQPASPRTPGDDSGSPPGPAAPNALPPDTHPPDPPP 2635
Cdd:PHA03247 2549 GDPPPPLPPAAPPAAPDRSVPPPRPAPRPSEPAVTSRARRPDAPPQSARPRAPVDDRGDPRGPAPPSPLPPDTHAPDPPP 2628
                        2650      2660      2670      2680      2690      2700      2710      2720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  2636 PAPRPHGNEAPEpHPLPTAPPPEQPRDDPAPRRVSPRRRVSPPRRPRRR----------AARPTVGSLASLAD------- 2698
Cdd:PHA03247 2629 PSPSPAANEPDP-HPPPTVPPPERPRDDPAPGRVSRPRRARRLGRAAQAssppqrprrrAARPTVGSLTSLADppppppt 2707
                        2730      2740      2750      2760      2770      2780      2790      2800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  2699 --------------------PPPPEREPEPRPAPRASPNAPATDVSVTPVPSPPATSGAPRSAPPAAPPTTPPPAAPVQA 2758
Cdd:PHA03247 2708 pepaphalvsatplppgpaaARQASPALPAAPAPPAVPAGPATPGGPARPARPPTTAGPPAPAPPAAPAAGPPRRLTRPA 2787
                        2810      2820      2830      2840      2850      2860      2870      2880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  2759 PAATLPPPTTPTPAAPPKPP--------------------------------------LESTLSMGGAVAPGGDFRRRGP 2800
Cdd:PHA03247 2788 VASLSESRESLPSPWDPADPpaavlapaaalppaaspagplppptsaqptapppppgpPPPSLPLGGSVAPGGDVRRRPP 2867
                        2890      2900      2910      2920      2930      2940      2950      2960
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  2801 SRAAPA-PATPRHPPVRRLARPAVSRSTESFALPPDSPERPPPPDSPERPRTPATEEAPASETPAPRTPGRSDAPLAPTT 2879
Cdd:PHA03247 2868 SRSPAAkPAAPARPPVRRLARPAVSRSTESFALPPDQPERPPQPQAPPPPQPQPQPPPPPQPQPPPPPPPRPQPPLAPTT 2947
                        2970      2980      2990      3000      3010      3020      3030      3040
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  2880 DTAGAGEPTGAAPNPWLGALVPGRVEVPR-RVSSPAPSREAPAPSTSSLHDH-DPRLSSWASSLALDEETDPRPVSLKQT 2957
Cdd:PHA03247 2948 DPAGAGEPSGAVPQPWLGALVPGRVAVPRfRVPQPAPSREAPASSTPPLTGHsLSRVSSWASSLALHEETDPPPVSLKQT 3027
                        3050      3060      3070      3080      3090      3100      3110      3120
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  2958 LWPPDDTEGSD-------DTEDSDESSV----DANPNDPNDPNDPPTPEAGAREDPGSHFGPPPLSANAALSRRYVRSTG 3026
Cdd:PHA03247 3028 LWPPDDTEDSDadslfdsDSERSDLEALdplpPEPHDPFAHEPDPATPEAGARESPSSQFGPPPLSANAALSRRYVRSTG 3107
                        3130      3140      3150      3160
                  ....*....|....*....|....*....|....*....|....
gi 56694759  3027 RSALAVLIEACRRLRRQLRRTRHALIDRSEAVLTGLYHVRMLLG 3070
Cdd:PHA03247 3108 RSALAVLIEACRRIRRQLRRTRHALLDRSGAVLTGLYHVRMLLG 3151
Herpes_UL36 pfam03586
Herpesvirus UL36 tegument protein; The UL36 open reading frame (ORF) encodes the largest ...
1325-1571 1.93e-91

Herpesvirus UL36 tegument protein; The UL36 open reading frame (ORF) encodes the largest herpes simplex virus type 1 (HSV-1) protein, a 270-kDa polypeptide designated VP1/2, which is also a component of the virion tegument. A null mutation in the UL36 gene of herpes simplex virus type 1 results in accumulation of unenveloped DNA-filled capsids in the cytoplasm of infected cells. This family only covers a small central part of this large protein.


Pssm-ID: 397577 [Multi-domain]  Cd Length: 252  Bit Score: 297.93  E-value: 1.93e-91
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759   1325 SRERWVADVDAALDRVENRAEFDAVELRRLQALAAQSNYNPRDFRKRAERALAANAETATLALEAAFAFNPYTPENQRHP 1404
Cdd:pfam03586    1 SHERWASDIEALLERVESGAEFDVVELRRLRDLAGTGGYDPRDFRKRAEQVVGANAKAVTLALETVLAFNPYTPENQRHP 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759   1405 ALPPLAAVHRLDWGPAFGAAAETYAEMFRVDTEPLARLLRLAEGLLALSQAGGGFIDYHEAVSRLAEDLNGVPSLRRYVA 1484
Cdd:pfam03586   81 MLPPLAALHSITWSDAFGAAADTYTDMFGVSTEPLARLLRIAGGILERADANDGNIDYHEAVLHLSGDLGQVPALRQYVD 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759   1485 FFRRGHAEYLGLCDRLAALRADVHRALGGVPLDLAAAAERTTRLRADPAAAAELVRTGVALACPSEDALAACVGALERVD 1564
Cdd:pfam03586  161 FYQRGYAEFVDIRARLDELRADARRAIGRVALELAAALEEIAAVRNDPEAAKEALEAGVTIPCPSEDALVACVEALKRVD 240

                   ....*..
gi 56694759   1565 QTPVKDT 1571
Cdd:pfam03586  241 QKPFEGT 247
gliding_GltJ NF033761
adventurous gliding motility protein GltJ; Adventurous gliding motility protein GltJ, also ...
2782-2923 1.37e-03

adventurous gliding motility protein GltJ; Adventurous gliding motility protein GltJ, also known as AgmX, occurs in delta-proteobacteria such as Myxococcus xanthus.


Pssm-ID: 411345 [Multi-domain]  Cd Length: 671  Bit Score: 44.44  E-value: 1.37e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  2782 TLSMGGAVAPGGDFRRRGPSRAAPAPATPRHPPVRrlARPAVSRSTESFALPPDSPERPPPPDSPERPRTPATEEAPASE 2861
Cdd:NF033761  379 VLLLVGGAGAGFWAGGRSQPPPTPAPVVAPAPPPA--PAPPPPPPPAAAQPPPPPAATPPAAATAAATPAAPPAAAPAAA 456
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 56694759  2862 TP-APRTPGRSDAPLAPTTDTAGAGEPTGAAPNPWLGALVPGRVEVPRRVSSPAPSREAPAPS 2923
Cdd:NF033761  457 APaAAGTPPAAPAAAPTPPPAPKAAEPPAAAPAAPARVARPERRTTRRRTSSSRRVPAPTAPV 519
 
Name Accession Description Interval E-value
PHA03247 PHA03247
large tegument protein UL36; Provisional
1-3070 0e+00

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 4167.34  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759     1 MAPRGDRGIVVTGARNQFAPDLEPGGAVSCMRSSLSFLSLVFDAGLRDALSAEAVDGCLVEGGAWTRASAGGAPPRMCSV 80
Cdd:PHA03247    1 MARRGDRGIVVTGARNQFAPDLEPGGAVSCMRSSLSFLSLVFDAGLRDALSAEAVDGCLVEGGAWTRASAGSGPPRMCSI 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759    81 VELPTFLEYPSGRGLRCVFSRVYGEVAFFGQPSPGLLETQCPAHDFFAGPWARRPLSYTLVTIGALGMGLYRDGDDAYLF 160
Cdd:PHA03247   81 VELPTFLEYPSGRGLRCVFSRVYGEVAFFGEPAPGLLETQCPAHDFFAGPWARRPLSYTLVTIGALGMGLYRDGDTAYLF 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759   161 DPHGLREGSPAFVAKVRAGEVYTYLTYYTQEHPEARWAGAMVFFVPWGPEPATPAGLAAAALRLYGASETYLQDEPFVER 240
Cdd:PHA03247  161 DPHGLREGSPAFVAKVRAGEVYTYLTYYTQDHPEARWAGAMVFFVPSGPGPAAPADLTAAALHLYGASETYLQDEPFVER 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759   241 RAVASHPLRGDDVPGTPPVGEGGGG--TPGTARGATSRPPPPEPSAPADPGPAAppSGVWGAALAGAPLALPAPPPSSDS 318
Cdd:PHA03247  241 RVVISHPLRGDIAAPAPPPVVGEGAdrAPETARGATGPPPPPEAAAPNGAAAPP--DGVWGAALAGAPLALPAPPDPPPP 318
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759   319 APATDVDDTDGEDGAMEVVSPLPHPKQHYPLGFPKRRRPTWTPPSSLEDLSAGRHHPKRASLPTRTRRAARHAASPFARG 398
Cdd:PHA03247  319 APAGDAEEEDDEDGAMEVVSPLPRPRQHYPLGFPKRRRPTWTPPSSLEDLSAGRHHPKRASLPTRKRRSARHAATPFARG 398
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759   399 PGGGDQPRPSTPTPAPAPVPVPATTPAPAPAPLPtaDPLPAADPASSESPAPPPERQPAADATepvpdDATEPAPDDATR 478
Cdd:PHA03247  399 PGGDDQTRPAAPVPASVPTPAPTPVPASAPPPPA--TPLPSAEPGSDDGPAPPPERQPPAPAT-----EPAPDDPDDATR 471
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759   479 KALDALRERRPPEPPACDPAELLGRYPDTGGVVSRLAEREVTIAREVAECSRLTVNALRSPFPDAPGLLQHCIILLFERV 558
Cdd:PHA03247  472 KALDALRERRPPEPPGADLAELLGRHPDTAGTVVRLAAREAAIAREVAECSRLTINALRSPFPASPGLLQHCVIFLFERV 551
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759   559 LAFLIENGARTHAGAGAEGPASALLDLTLGLLPNRTAVGDFLASTRMTLADVAAHVPLIQPVIEEGSGVGRLALAKLVLV 638
Cdd:PHA03247  552 LAFLIENGARTHAGAGAEGPAAALLDLTLSLLPRRTAVGDFLASTRMTLADVAAHLPLIQPVLDEGSGVGRLALAKLVLV 631
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759   639 ARDVIRATDELHGELAELERQLRATPPTEVYARLSEWLLERSRAGPDTLFAPATPTHPEPLLQRVQALAGFARGEEARAA 718
Cdd:PHA03247  632 ARDVIRETDAFHGELAELERQLRATPPAEVYARLSEWLLERSRAGPDTLFAPATPTHPEPLLQRVQALAGFARGEEIRAA 711
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759   719 AEDREVRGALDALARSVDAVARRGGPLAVA-APEAPGGTEDPPPHPLSPQAVRSRLDRVRAEGQKAVEGAVKEYFLRGAV 797
Cdd:PHA03247  712 AEDREVRGALDALARGVDAVARRAGPLTVApAPAAPGGQGAPRPPPLSPEAIRVRLEQVRAQGQRAIEGAVKEYFHRGAV 791
                         810       820       830       840       850       860       870       880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759   798 YSAKALLAGDARDRRYHVASAPVVPVAQLLESLPAFDARVREVAARARVPAPPPLATSPAADLLRELLQRGCDLEAPADL 877
Cdd:PHA03247  792 YSAKALLAGDARDRRFHVASAPVVPVVQLLESLPAFDAHVREVAQRARVPAPPPLATSPQAILLRELLQRGQDLEAPADL 871
                         890       900       910       920       930       940       950       960
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759   878 AAWLASLGDAAGQGLVARKELDELAQAIHKINERVVRRSSGLAELERFEALDAALRRELESEAAFEPAADHAAGGDDAAA 957
Cdd:PHA03247  872 AAWLASLGDAAGQGLVERKELDELARAIHKINERQVRRSSGLAELERFEALDAALRQELESEAAFVPAPGAAPYADAGGL 951
                         970       980       990      1000      1010      1020      1030      1040
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759   958 GglaPETRRLAEDALRQAKAMAAAKLTDELSPEARDRLGARARAIEDLLAEARARAEAARAARTRFFQRLQGVLRPLPDF 1037
Cdd:PHA03247  952 S---PETRRLAEDALRQAKAMAAAKLTDELSPEARERLRARARAIEAMLEEARERAEAARAARERFFQKLQGVLRPLPDF 1028
                        1050      1060      1070      1080      1090      1100      1110      1120
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  1038 GGLRTAPAVLATLRADLPGGWTCLPDAAQAAPPEVRAALRADLWGLLGQYRAALEHPTPDTAAALSGLHPNFVEALRDLF 1117
Cdd:PHA03247 1029 GGLRAAPAVLATLRADLPGGWTDLPDAAQAAPPEVRAALRADLWGLLGQYREALEHPTPDTATALSGLHPNFVEVLRDLF 1108
                        1130      1140      1150      1160      1170      1180      1190      1200
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  1118 PAAPETPLLVSFFSDHAPRVARAVSEAINAGGAAVATASPESTVEAAARARDVLAAAVAALSPAVLDPACPLAFLVALAD 1197
Cdd:PHA03247 1109 PAAPETPLLVQFFSDHAPRIARAVSEAINAGSAAVATASPESTVDAAVRAHGVLADAVAALSPAVRDPACPLAFLVALAD 1188
                        1210      1220      1230      1240      1250      1260      1270      1280
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  1198 SAAGYERATRLALDARRAIARLGALGAAAADLAAAVRRENPEAEGDRAALLEAAARAVAEARAGLAACEGEFGGLLHAEG 1277
Cdd:PHA03247 1189 SAAGYVKATRLALDARRAIARLGALGAAAADLAVAVRRENPQAEGDRAALLEAAARAVTAAREGLAACEGEFGGLLHAEG 1268
                        1290      1300      1310      1320      1330      1340      1350      1360
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  1278 STGDPSPSGRALQELGKVVGATRRRADELEAAAADLAEKLAARRARDSRERWVADVDAALDRVENRAEFDAVELRRLQAL 1357
Cdd:PHA03247 1269 SAGDPSPSGRALQELGKVVGATRRRADELEAAAADLAEKMAARRARASRERWAADVEAALDRVENRAEFDAVELRRLQAL 1348
                        1370      1380      1390      1400      1410      1420      1430      1440
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  1358 AAQSNYNPRDFRKRAERALAANAETATLALEAAFAFNPYTPENQRHPALPPLAAVHRLDWGPAFGAAAETYAEMFRVDTE 1437
Cdd:PHA03247 1349 AATHGYNPRDFRKRAEQALAANAKTATLALEAAFAFNPYTPENQRHPMLPPLAAIHRIDWGPAFGAAAETYAEMFRVDTE 1428
                        1450      1460      1470      1480      1490      1500      1510      1520
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  1438 PLARLLRLAEGLLALSQAGGGFIDYHEAVSRLAEDLNGVPSLRRYVAFFRRGHAEYLGLCDRLAALRADVHRALGGVPLD 1517
Cdd:PHA03247 1429 PLARLLRLAGGLLELAQAGGGFIDYHEAVSRLAEDLNGVPSLRRYVPFFRRGHAEYLELCDRLDALRADVHRALGGVPLD 1508
                        1530      1540      1550      1560      1570      1580      1590      1600
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  1518 LAAAAERTTRLRADPAAAAELVRTGVALACPSEDALAACVGALERVDQTPVKDTAYAEYIAYAARRDLGEAKDALVRAKQ 1597
Cdd:PHA03247 1509 LAAAAEQTSRLRNDPAAAAELVRTGVTLACPSEDALAACVGALERVDQSPVKDTAYAEYVAFVARRDLAEAKDALVRAKQ 1588
                        1610      1620      1630      1640      1650      1660      1670      1680
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  1598 QRAEATDRVTAALREALAAHERRAQSEAESLANLKTLLRVAAIPATAAKTLDQARSVPEIVDQIELLLEQTEKAAELDPG 1677
Cdd:PHA03247 1589 QRAEATDRVTAALREALAAHERRAQSEAESLANLKTLLRVAAIPATAAKTLDQARSVAEIVDQIELLLEQTEKAAELDVA 1668
                        1690      1700      1710      1720      1730      1740      1750      1760
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  1678 AVDWLEHARRVFGAHPLTAARDGAPDPLARLHGRLDALGEACRRTTALRRSLEAAAAEWDEVWVRFGRVRGGAWKSPAAL 1757
Cdd:PHA03247 1669 AVDWLEHARRVFEAHPLTAARGGGPDPLARLHARLDALGETRRRTEALRRSLEAAEAEWDEVWGRFGRVRGGAWKSPEAL 1748
                        1770      1780      1790      1800      1810      1820      1830      1840
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  1758 EAAREQLCALRTATNTVLGLMADAHYPRLPAKDRGALGAKSAERAGAVEEMGVAVARHDGLLARLREEVVARVPWEMNAD 1837
Cdd:PHA03247 1749 RAAREQLRALQTATNTVLGLRADAHYERLPAKYQGALGAKSAERAGAVEELGAAVARHDGLLARLREEVVARVPWEMNAD 1828
                        1850      1860      1870      1880      1890      1900      1910      1920
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  1838 ALGRLLVEFDALAGDLPPWAVDEFRGARALVQHRLGLYSAYAAARAHRGAGGPPPPAPLLADIRALEARAQSPDERRAPD 1917
Cdd:PHA03247 1829 ALGRLLAEFDALAGDLAPWAVDEFRGARALVQHRLGLYSAYAKARAQTGAGGAAPPAPLLVDLRALEARARSPPERHEPD 1908
                        1930      1940      1950      1960      1970      1980      1990      2000
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  1918 LRMVRCRGEAYLRASGDPGPLELREATSELDLPFAISYLAPDGTPLQYALCFPAVTDKLGALLMRPEAARARPALPSEGL 1997
Cdd:PHA03247 1909 PRMVRRRGEAYLRASGDPGPLELREATSELDLPFATSYLAPDGTPLQYALCFPAVTDKLGALLMRPEAARARPPLPTEGL 1988
                        2010      2020      2030      2040      2050      2060      2070      2080
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  1998 EATQTLAAMCTVPLITHLQLALSDAQGDGFRLFGRFVRHRQPAWRDSVAAAAELYAALVATTLTREFGCRWDELGWARGE 2077
Cdd:PHA03247 1989 ESTQTLAAMCTVPLITRLQLALSDAQGAGFRLFGRFVRHRQPAWRDSMAAAAELYAALVATTLTREFGCRWDELGWARGA 2068
                        2090      2100      2110      2120      2130      2140      2150      2160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  2078 GALAPLAEPAGARRPRVTFSINDLMVALVAGTPEHIYNFWRLDLVLQHEYMHLTLPAAWETGAGAILFVQRLTPHARPEV 2157
Cdd:PHA03247 2069 AAPAPLAEPAGSRRPRVTFNENDVMVALVAGTPEHIYNFWRLDLVLQHEYMHLTLPAAWETGAGSILFVQRLTPHPDPEV 2148
                        2170      2180      2190      2200      2210      2220      2230      2240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  2158 RVLPAVPAGPPPATGLLFGTRLADWRHGKLSPSDPLAPWRAAPELAAGGAAAALGGLDGPRALVAVSVLGRMCLPSAALA 2237
Cdd:PHA03247 2149 RVLPAVPAGPPPATGLLFGTRLADWRHGKLSESDPLAPWRAAPELAAGGAAAALGGLSGPRALVAVSVLGRMCLPSAALA 2228
                        2250      2260      2270      2280      2290      2300      2310      2320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  2238 ALWSCMFPDGYSEYDSLDALLEARLGSGRAPDPQGGREDAPAPPAHALYRPSGQRVLVRGGPPDPAARVTVMDLVLAATL 2317
Cdd:PHA03247 2229 ALWSCMFPDGYSEYDSLDALLAARLGSGRTPDPQGGREDSPAPPAHALYRPSGQRVLVRGGAPDPAARVTVMDLVLAATL 2308
                        2330      2340      2350      2360      2370      2380      2390      2400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  2318 LGAPVVVALRSDPAFSEGSELELCVTLFDSRAGAADAALREVVSSDVETWAADLMHADPNVIENACLAAQLPALSALVAA 2397
Cdd:PHA03247 2309 LGAPVVVALRSDPAFSRGSELELCVTLFDSRARGADAALREVVSSDVETWAVDLLHADLNPIENACLAAQLPALSALIAA 2388
                        2410      2420      2430      2440      2450      2460      2470      2480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  2398 RPLAGSPPCLVIVDISMAPLFVLWERPDPPGPPDVRFVGGEEIEELPFVSPGVEVLAGLAAKDDPFFARTILGAPFSLSH 2477
Cdd:PHA03247 2389 RPLARSPPCLVLVDISMAPLFVLWEQPDPPGPPDVRFVGSEEIEELPFVSPGGDVLAGLAADGDPFFARTILGAPFSLSL 2468
                        2490      2500      2510      2520      2530      2540      2550      2560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  2478 LLREAFPGAPAYRRPAEARFPFAARGAP--DPGPDPDPDAPPTPSRPAPAILPDEPVGEAVHPRMLTWIRGLEELASDDA 2555
Cdd:PHA03247 2469 LLGELFPGAPVYRRPAEARFPFAAGAAPdpGGGGPPDPDAPPAPSRLAPAILPDEPVGEPVHPRMLTWIRGLEELASDDA 2548
                        2570      2580      2590      2600      2610      2620      2630      2640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  2556 GDPPPPLPPAAPPAAPDRSVPPPRPAPRPSEPAVRSRARRPDAPPQPASPRTPGDDSGSPPGPAAPNALPPDTHPPDPPP 2635
Cdd:PHA03247 2549 GDPPPPLPPAAPPAAPDRSVPPPRPAPRPSEPAVTSRARRPDAPPQSARPRAPVDDRGDPRGPAPPSPLPPDTHAPDPPP 2628
                        2650      2660      2670      2680      2690      2700      2710      2720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  2636 PAPRPHGNEAPEpHPLPTAPPPEQPRDDPAPRRVSPRRRVSPPRRPRRR----------AARPTVGSLASLAD------- 2698
Cdd:PHA03247 2629 PSPSPAANEPDP-HPPPTVPPPERPRDDPAPGRVSRPRRARRLGRAAQAssppqrprrrAARPTVGSLTSLADppppppt 2707
                        2730      2740      2750      2760      2770      2780      2790      2800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  2699 --------------------PPPPEREPEPRPAPRASPNAPATDVSVTPVPSPPATSGAPRSAPPAAPPTTPPPAAPVQA 2758
Cdd:PHA03247 2708 pepaphalvsatplppgpaaARQASPALPAAPAPPAVPAGPATPGGPARPARPPTTAGPPAPAPPAAPAAGPPRRLTRPA 2787
                        2810      2820      2830      2840      2850      2860      2870      2880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  2759 PAATLPPPTTPTPAAPPKPP--------------------------------------LESTLSMGGAVAPGGDFRRRGP 2800
Cdd:PHA03247 2788 VASLSESRESLPSPWDPADPpaavlapaaalppaaspagplppptsaqptapppppgpPPPSLPLGGSVAPGGDVRRRPP 2867
                        2890      2900      2910      2920      2930      2940      2950      2960
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  2801 SRAAPA-PATPRHPPVRRLARPAVSRSTESFALPPDSPERPPPPDSPERPRTPATEEAPASETPAPRTPGRSDAPLAPTT 2879
Cdd:PHA03247 2868 SRSPAAkPAAPARPPVRRLARPAVSRSTESFALPPDQPERPPQPQAPPPPQPQPQPPPPPQPQPPPPPPPRPQPPLAPTT 2947
                        2970      2980      2990      3000      3010      3020      3030      3040
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  2880 DTAGAGEPTGAAPNPWLGALVPGRVEVPR-RVSSPAPSREAPAPSTSSLHDH-DPRLSSWASSLALDEETDPRPVSLKQT 2957
Cdd:PHA03247 2948 DPAGAGEPSGAVPQPWLGALVPGRVAVPRfRVPQPAPSREAPASSTPPLTGHsLSRVSSWASSLALHEETDPPPVSLKQT 3027
                        3050      3060      3070      3080      3090      3100      3110      3120
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  2958 LWPPDDTEGSD-------DTEDSDESSV----DANPNDPNDPNDPPTPEAGAREDPGSHFGPPPLSANAALSRRYVRSTG 3026
Cdd:PHA03247 3028 LWPPDDTEDSDadslfdsDSERSDLEALdplpPEPHDPFAHEPDPATPEAGARESPSSQFGPPPLSANAALSRRYVRSTG 3107
                        3130      3140      3150      3160
                  ....*....|....*....|....*....|....*....|....
gi 56694759  3027 RSALAVLIEACRRLRRQLRRTRHALIDRSEAVLTGLYHVRMLLG 3070
Cdd:PHA03247 3108 RSALAVLIEACRRIRRQLRRTRHALLDRSGAVLTGLYHVRMLLG 3151
PHA03246 PHA03246
large tegument protein UL36; Provisional
6-2460 0e+00

large tegument protein UL36; Provisional


Pssm-ID: 223020  Cd Length: 3095  Bit Score: 926.30  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759     6 DRGIVVTGARNQFAPDLEPGGAVSCMRSSLSFLSLVFDAGLRDALSAEAVDGCLVEGGAWTRASAGGAPPRMCSVVELPT 85
Cdd:PHA03246   73 DFTIVAVGIRNQFAPDLSPGSSVSCLRSSLAFLRIVFAYGLDTVLSADAIDRLLLQGKDWTIHTSDDGVYTTCVPHDLPN 152
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759    86 FLEYPSGRGLRCV-FSRVYGEVAFF-GQPSPGLLETQCPAHDFFAGPWA-RRPLSYTLVTIGALGMGLYRDGDDAYLFDP 162
Cdd:PHA03246  153 RILSKDPGGNLCVaFSSSYGESEFYlDENTPTILDTQISARTFIERVWKqKRGDIYCLIVIGVLGIGVYRSEDGIYIFDP 232
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759   163 HGLREGSPAFVAKVRAGEVYTYLTYYTQEHPEARWAGAMVFFV------------------------------------- 205
Cdd:PHA03246  233 HGHGHIGQACIVRVSEGYFYQYLTSYADPSGMPDWSATFVYFVstassappkeeiisavsrlygtadivldlgradeedn 312
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759   206 ----------PWGPEPATPAGLAAAalrlygaSETYLQDEPFVERRAVASHPLRGDDVPGTPPVGEGGGGTPGTARGATS 275
Cdd:PHA03246  313 lkvvsadfdpPSRPQPWQTKIVIGT-------ADSYADSSPKLHSESTDLTPHEHGEYDPSTLVGGASTNINISDPPART 385
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759   276 RPPPPEPSAPADPGPAAPPSGVWGAALAGAPLALPAPPPSSDSAPATDVDDTdgedGAMEVVSPLPH-------PKQHYP 348
Cdd:PHA03246  386 DCRRYSEGSVIHESVDSHIEDVTEATSVVAAWSDAFSDISEDYSHLTRPDLP----ATAHDVSKNGHdtksdrrSRGSNS 461
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759   349 LgfPKRRRPTWTPPSSLEDLSA---GRHHPKRASLPTRTRRAARHAASPFARgpgggdqprpstptpapapvpvpattpa 425
Cdd:PHA03246  462 R--HKRRRPSWTPPSSSENVSSdgpTFSQSRKPSRKSKRALDLDYGHLSNEP---------------------------- 511
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759   426 papaplptadplPAADPASSESPAPpperqpaadATEPVPDDATEPAPDDATRKALDALRER----RPPEPPACDPAELL 501
Cdd:PHA03246  512 ------------SDVDGENSDSPAG---------AISNIPDNVSFNEFISSQARAEDSIEHLslrnRPVFNPHTVTGNLD 570
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759   502 GRYPDTGG--------VVSRLAEREVTIAREVAECSRLTVNALRSPFPDApGLLQHCIILLFERVLAFLIENGARTHAGA 573
Cdd:PHA03246  571 NTLRDSLWndeysgsyPLSDISDMIDDITESIADGMRLVVHTSHRGDYDG-GLLDVCIMDVFTRLFNYIIENGARTTTDR 649
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759   574 GAEGPASALLDLTLGLLPNRTAVgdFLASTRMTLADVAAHVPLIQPVIEEGSGVGRLALAKLVLVARDVIRATDELHGEL 653
Cdd:PHA03246  650 ASVVEPEMAALTKAFTTPSHFST--FISSTGMSLSEASESADLIESVLTENSKIGKLALSKLTLVALEVEEATDTLHKSL 727
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759   654 AELERQLRATPPTEVYARLSEWLLERSRAGPDTLFAPATPTHPE-PLLQRVQALAGFARGEEARAAAEDREVRGALDALA 732
Cdd:PHA03246  728 DAIEREASTADPDRIYERMATVLVDTFYRNSGKLYSETTSYNSDqTLTDRVVSLCEFIRDRENVATRKAELILAEIEALD 807
                         810       820       830       840       850       860       870       880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759   733 RSV-------DAVARRGGPlavaapEAPGGTEDPPPHPLSPQAVRSRLDRVRAEGQKAVEGAVKEYFLRGAVYSAKALLA 805
Cdd:PHA03246  808 AGVrwmntkfDAFIMGGSG------GMSPAKGLSAIAKTSTDVVTQRLESIGKAAIDIVGNALREYYLKCALYSAKALRA 881
                         890       900       910       920       930       940       950       960
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759   806 GDARDRRYH-VASAPVVPVAQLLESLPAFDARVREVAARARVPAPPPLATSPAADLLRELLQRGCDLEAPADLAAWLASL 884
Cdd:PHA03246  882 DMKETSRFKiVVTEQLEKMTRLLSSLSVIDDVILLIASRSDARVPVPVSKALESQLLGDLLEIGSHLDVPENLVTWKGLM 961
                         970       980       990      1000      1010      1020      1030      1040
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759   885 GDAAGQGLVARKELDELAQAIHKINERVVRRSSGLAELERFEALDAALRRELESEAAFEPAADHaaggddaaagglapET 964
Cdd:PHA03246  962 VSVQTGGWISRRELDLLLKEVDAVNDNAARRETALTELERLHELESRIASYTDLETTVDLQKLD--------------EA 1027
                        1050      1060      1070      1080      1090      1100      1110      1120
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759   965 RRLAEDALRQAKAMAAAKLTDELSPEARDRLGARARAIEDLLAEARARAEAARAARTRFFQRLQGVLRPLPDFGGLRTAP 1044
Cdd:PHA03246 1028 LKLANSIVKLTKGLDGAKLASSLSSDIREKIRQKRSETETLIARLSARYAEVKAAVDGLYSSIRKLLRPLQNFAGLRALD 1107
                        1130      1140      1150      1160      1170      1180      1190      1200
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  1045 AVLATLRADLPGGWTCLPDAAQAAPPEVRAALRADLWGLLGQYRAALEHPTPDTAAALSGLHPNFVEALRDLFPAAPETP 1124
Cdd:PHA03246 1108 STVKTITDSIPPGMGSFESFLASAPPDVIGALRSDLWVLFTQYKTILSRPSTGTAAELSGLGGPFALAIRVILGPEGEYP 1187
                        1210      1220      1230      1240      1250      1260      1270      1280
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  1125 LLVSFFSDHAPRVARAVSEAINAGGAAVATASPESTVEAAA----RA-RDVLAAAVAALSPAVLDPAcpLAFLVAL---A 1196
Cdd:PHA03246 1188 AASVFFGKHADVLSAALAAAASEPMSVEKTSAAVSVLKEAIsdinRAdATIPQQGIMADLSTERADA--FSFLHALlsdA 1265
                        1290      1300      1310      1320      1330      1340      1350      1360
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  1197 DSAAGYE----------RATRLALDArraiARLGALGAAAADLAAAVRRENPEAEGDRAALLEAAARAVAEARAGLAACE 1266
Cdd:PHA03246 1266 EGAADVAsrgaylstliRTVRDSLEA----VIDSITKIKSLDPKTYTYNTDASVIVSAKAEVSAATQQAGDCKDALTALE 1341
                        1370      1380      1390      1400      1410      1420      1430      1440
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  1267 GEfggllhaeGSTGDPSPSgRALQELGKVVGATRRRADELEAAAADLAEKLAARRARDSRERWVADVDAALDRVENRAEF 1346
Cdd:PHA03246 1342 NE--------PLTYNPHIQ-RKIAELNKLIESVNQRVGELDIALQTYERNRISAERSRSEDLWTSSITSLLVNAEIKSEF 1412
                        1450      1460      1470      1480      1490      1500      1510      1520
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  1347 DAVELRRLQALAAQSNYNPRDFRKRAERALAANAETATLALEAAFAFNPYTPENQRHPALPPLAAVHRLDWGPAFGAAAE 1426
Cdd:PHA03246 1413 DAMEINSLEETARNAGYDTIRFKSRAEKIVSAHARVVENAIETVLKFNPYSTTNIIHGLKPPIAALKNITWGDAFFAAAP 1492
                        1530      1540      1550      1560      1570      1580      1590      1600
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  1427 TYAEMFRVDTEPLARLLRLAEGLLALSQAGGGFIDYHEAVSRLAEDLNGVPSLRRYVAFFRRGHAEYLGLCDRLAALRAD 1506
Cdd:PHA03246 1493 YYTKLFGVNCDVLISLLKILFAILRHASAHPGNLDYYFLVGEIESDLRAIPSLAKYVDFYRRGHDSFEGFLARLEQMRVE 1572
                        1610      1620      1630      1640      1650      1660      1670      1680
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  1507 VHRALGGVPLDLAAAAERTTRLRAdPAAAAELVRTGVALACPSEDALAACVGALERVDQTPVKDTAYAEYIAYAARRDLG 1586
Cdd:PHA03246 1573 ALHASGRVSIEISDALETLARTHS-PEGARRALEYGVSIVIPSANTIMSIADALQKEKITELDGTAYAEYSAHILRRDND 1651
                        1690      1700      1710      1720      1730      1740      1750      1760
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  1587 EAKDALVRAKQQRAEATDRVTAALREaLAAHERRAQSE-AESLANLKTLLRVAAIPATAAKTLDQARSVPEIVDQIELLL 1665
Cdd:PHA03246 1652 AIKSITQRVTTAIEAAKSRGESILKD-LAEASYAADREtAEQLANLKNLLRLVAMPAHIAKAIDKAETANDIVTQAALLL 1730
                        1770      1780      1790      1800      1810      1820      1830      1840
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  1666 EQTEKAAELDPGAVDWLEHARRVFGAHPLTAARDGApDPLARLHGRLDALGEACRRTTALRRSLEAAAAEWDEVWVRFGR 1745
Cdd:PHA03246 1731 TKVEETKELDTQTVEWLKHAESVIDSHDLTVRIDES-GPMTIYAERIDALVRLENRLAELKSELALAEVAWDDTWSTFIH 1809
                        1850      1860      1870      1880      1890      1900      1910      1920
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  1746 VRGGAWKSPAALEAAREQLCALRTATNTVLGLMADAHYPRLPAKDRGALGAKSAERAGAVEEMGVAVARHDGLLARLrEE 1825
Cdd:PHA03246 1810 DKDRIDKSSEGFSAARESAARAKVSTNAINALRNNAEYNRLPAKIIGLIDSKYRDRTVVLDAFLDSMKEIEDTQKQM-EI 1888
                        1930      1940      1950      1960      1970      1980      1990      2000
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  1826 VVARVPWEMNADALGRLLVEFDALAGDLPPWAVDEFRGARALVQHRLGLYSayaaARAHRGAGGPPPPAPLLADIRALEA 1905
Cdd:PHA03246 1889 LCSKIPLTFSLNDLRAISSQFDDIAKRLPKWYVKQVGRYSRLIKLRLALYA----AYSNASTGPIGDPPLLPFDTGRANI 1964
                        2010      2020      2030      2040      2050      2060      2070      2080
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  1906 RAQSPDERRAPDlRMVRCRGEAYLRASgdpGPLELREATSELDLPFAISYLAPDGTPLQYALCFPAVTDKLGALLMRPEA 1985
Cdd:PHA03246 1965 AANMAPSVGLVD-RYLKHRVAAWIRPK---VVATLQEAFSEIDMPGLTTYLDSTDTPLRYSICYRTVGEKLAACLCEPSA 2040
                        2090      2100      2110      2120      2130      2140      2150      2160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  1986 ARARPALPSEGLEATQTLAAMCTVPLITHLQLALSDAQGDGFRLFGRFVRHRQPAW--RDSVAAAAELYAALVATTLTRE 2063
Cdd:PHA03246 2041 VNIKPRIPTNLISTVEMESAAGMLNDIMILRLGFVQACADRFQLFTKYVRTGIHDWspDYCIKAHGTIYCALIAITLTRK 2120
                        2170      2180      2190      2200      2210      2220      2230      2240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  2064 FGCRWDELGWARGEgaLAPLAEPA--------GARRPRVTFSINDLMVALVAGTPEHIYNFWRLDLVLQHEYMHLTLPAA 2135
Cdd:PHA03246 2121 TGSNLSDIYFIPGQ--YGPTIDKKelkkfaanGRRRQVVRLDPADVMVTIMACTPGHVLTFSKLDLINQYDFMDKTLYNV 2198
                        2250      2260      2270      2280      2290      2300      2310      2320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  2136 WETGAGAILFVQRLTPH------ARPEVRVLPAVPAGPPPATGLLFGTRLADWRHGKLSPSDPLAPWRAAPELAAGGAAA 2209
Cdd:PHA03246 2199 LTDSISTVAFVNCLSTQlskdgkVDPNCRPLSLTGGEWDPSGGSLFAIRYSDWKQGRLSDTDPLKPWEDISGDEGAGLAK 2278
                        2330      2340      2350      2360      2370      2380      2390      2400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  2210 ALGGLDGpRALVAVSVLGRMCLPSAALAALWSCMFPDGYSE----YD-----------SLDALLEARLGSGRAPDPQGgr 2274
Cdd:PHA03246 2279 IRAVVPS-SLLTTTTVLARMCIPPTALAVMWSSLLPDGIEQtcksYDdvvtargdgasTLDVTTSTIDHTGVKNIQTN-- 2355
                        2410      2420      2430      2440      2450      2460      2470      2480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  2275 EDAPappahALYRPSGQRV--LVRGGPPDPAARVTVMDLVLAATLLGAPVVVALRSDPAFSEGSELELCVTLFDSRAGAA 2352
Cdd:PHA03246 2356 LDCP-----NLYEYTGTATtfTVVSTPPSRVLKVNAMDIAACATLFGARIVIAAECPEAYSSDSGLSLCIRLFDSRSGSK 2430
                        2490      2500      2510      2520      2530      2540      2550      2560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  2353 DAALRE-VVSSDVETWAADLMHADPNVIENACLAAQLPALSALVAARPLAGSPPCLVIVDISMAPLFVLWERPDPPGPPD 2431
Cdd:PHA03246 2431 GCFLEPgAVSSDITSWGAKLLAADSNPIENACLGQQLEHLSHLIASKPLSSAPPCLVIVDAGMVPVKVLWAKEELDPIPI 2510
                        2570      2580      2590
                  ....*....|....*....|....*....|.
gi 56694759  2432 VRFVGGEE--IEELPFVSPGVEVLAGLAAKD 2460
Cdd:PHA03246 2511 IRLTSADDalISELPYIDAGIRGETGADFQH 2541
Herpes_UL36 pfam03586
Herpesvirus UL36 tegument protein; The UL36 open reading frame (ORF) encodes the largest ...
1325-1571 1.93e-91

Herpesvirus UL36 tegument protein; The UL36 open reading frame (ORF) encodes the largest herpes simplex virus type 1 (HSV-1) protein, a 270-kDa polypeptide designated VP1/2, which is also a component of the virion tegument. A null mutation in the UL36 gene of herpes simplex virus type 1 results in accumulation of unenveloped DNA-filled capsids in the cytoplasm of infected cells. This family only covers a small central part of this large protein.


Pssm-ID: 397577 [Multi-domain]  Cd Length: 252  Bit Score: 297.93  E-value: 1.93e-91
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759   1325 SRERWVADVDAALDRVENRAEFDAVELRRLQALAAQSNYNPRDFRKRAERALAANAETATLALEAAFAFNPYTPENQRHP 1404
Cdd:pfam03586    1 SHERWASDIEALLERVESGAEFDVVELRRLRDLAGTGGYDPRDFRKRAEQVVGANAKAVTLALETVLAFNPYTPENQRHP 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759   1405 ALPPLAAVHRLDWGPAFGAAAETYAEMFRVDTEPLARLLRLAEGLLALSQAGGGFIDYHEAVSRLAEDLNGVPSLRRYVA 1484
Cdd:pfam03586   81 MLPPLAALHSITWSDAFGAAADTYTDMFGVSTEPLARLLRIAGGILERADANDGNIDYHEAVLHLSGDLGQVPALRQYVD 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759   1485 FFRRGHAEYLGLCDRLAALRADVHRALGGVPLDLAAAAERTTRLRADPAAAAELVRTGVALACPSEDALAACVGALERVD 1564
Cdd:pfam03586  161 FYQRGYAEFVDIRARLDELRADARRAIGRVALELAAALEEIAAVRNDPEAAKEALEAGVTIPCPSEDALVACVEALKRVD 240

                   ....*..
gi 56694759   1565 QTPVKDT 1571
Cdd:pfam03586  241 QKPFEGT 247
Herpes_teg_N pfam04843
Herpesvirus tegument protein, N-terminal conserved region;
15-185 9.13e-42

Herpesvirus tegument protein, N-terminal conserved region;


Pssm-ID: 398488 [Multi-domain]  Cd Length: 158  Bit Score: 151.76  E-value: 9.13e-42
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759     15 RNQFAPDLEPGGAVSCMRSSLSFLSLVFDAGLRDALSAEAVDGCLVEGGAW--TRASAGGAPPRMCSVVELPTFLEYPSG 92
Cdd:pfam04843    2 RHQFDCKFGPAAGSQCLSNCLSFLHSSYLNGERPVLSREALDGILEEGARLdtLLRTSGMLPPRYAQLHELPGYVRTGAW 81
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759     93 RGLRCVFSRVYGEVAFFGQPSpglletqcpahdFFAGPwarrplSYTLVTIGALGMGLYRDGDDAYLFDPHGLREG--SP 170
Cdd:pfam04843   82 GCKIRRSSEIYGLLGHELSRN------------FNGTP------QYCLITCGSLAMAIVIKGKTYYLFDPHCTPEGnsTA 143
                          170
                   ....*....|....*
gi 56694759    171 AFVAKVRAGEVYTYL 185
Cdd:pfam04843  144 AVIVTVSAGDVYEYL 158
PRK07003 PRK07003
DNA polymerase III subunit gamma/tau;
2788-2944 7.49e-05

DNA polymerase III subunit gamma/tau;


Pssm-ID: 235906 [Multi-domain]  Cd Length: 830  Bit Score: 48.31  E-value: 7.49e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  2788 AVAPGGDFRRRGPSRAAPAPATPRHPPVRRLARPAVSRSTESFALPPDSPERPPPPDSPERPRTPATEEAPASETPAPRT 2867
Cdd:PRK07003  400 TAVTGAAGAALAPKAAAAAAATRAEAPPAAPAPPATADRGDDAADGDAPVPAKANARASADSRCDERDAQPPADSGSASA 479
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  2868 PGRSDAPLAPTTDTAGAGEPTGAAPNPWLGALVPG---RVEVPRRVSSPAPSREAPAPSTSSlhdhdPRLSSWASSLALD 2944
Cdd:PRK07003  480 PASDAPPDAAFEPAPRAAAPSAATPAAVPDARAPAaasREDAPAAAAPPAPEARPPTPAAAA-----PAARAGGAAAALD 554
gliding_GltJ NF033761
adventurous gliding motility protein GltJ; Adventurous gliding motility protein GltJ, also ...
2782-2923 1.37e-03

adventurous gliding motility protein GltJ; Adventurous gliding motility protein GltJ, also known as AgmX, occurs in delta-proteobacteria such as Myxococcus xanthus.


Pssm-ID: 411345 [Multi-domain]  Cd Length: 671  Bit Score: 44.44  E-value: 1.37e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  2782 TLSMGGAVAPGGDFRRRGPSRAAPAPATPRHPPVRrlARPAVSRSTESFALPPDSPERPPPPDSPERPRTPATEEAPASE 2861
Cdd:NF033761  379 VLLLVGGAGAGFWAGGRSQPPPTPAPVVAPAPPPA--PAPPPPPPPAAAQPPPPPAATPPAAATAAATPAAPPAAAPAAA 456
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 56694759  2862 TP-APRTPGRSDAPLAPTTDTAGAGEPTGAAPNPWLGALVPGRVEVPRRVSSPAPSREAPAPS 2923
Cdd:NF033761  457 APaAAGTPPAAPAAAPTPPPAPKAAEPPAAAPAAPARVARPERRTTRRRTSSSRRVPAPTAPV 519
PRK12323 PRK12323
DNA polymerase III subunit gamma/tau;
2788-3013 1.44e-03

DNA polymerase III subunit gamma/tau;


Pssm-ID: 237057 [Multi-domain]  Cd Length: 700  Bit Score: 44.10  E-value: 1.44e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  2788 AVAPGGDFRRRGPSRAAPAPATPRHPPVR--RLARPAVSRSTESFALPPDSPERPPPPDSPERPRTPATE-EAPASETPA 2864
Cdd:PRK12323  362 AFRPGQSGGGAGPATAAAAPVAQPAPAAAapAAAAPAPAAPPAAPAAAPAAAAAARAVAAAPARRSPAPEaLAAARQASA 441
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759  2865 PRTPGRSDAPLAPTTDTAGAGEPTGAAPNPwlgalvpgrvevPRRVSSPAPSREAPAPSTSSLHDHDPRLSSWASSLALD 2944
Cdd:PRK12323  442 RGPGGAPAPAPAPAAAPAAAARPAAAGPRP------------VAAAAAAAPARAAPAAAPAPADDDPPPWEELPPEFASP 509
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 56694759  2945 EETDPRPVSLKQTLWPPDDTEGSDDTEDSDESSVDANPNDPNDPNDPPTPEAGAREDPGSHFGPPPLSA 3013
Cdd:PRK12323  510 APAQPDAAPAGWVAESIPDPATADPDDAFETLAPAPAAAPAPRAAAATEPVVAPRPPRASASGLPDMFD 578
DUF3584 pfam12128
Protein of unknown function (DUF3584); This protein is found in bacteria and eukaryotes. ...
1587-1850 6.17e-03

Protein of unknown function (DUF3584); This protein is found in bacteria and eukaryotes. Proteins in this family are typically between 943 to 1234 amino acids in length. This family contains a P-loop motif suggesting it is a nucleotide binding protein. It may be involved in replication.


Pssm-ID: 403375 [Multi-domain]  Cd Length: 1186  Bit Score: 42.44  E-value: 6.17e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759   1587 EAKDALVRAKQQRA---EATDRVTAALREALAAHER--RAQSEAESLANLKTLLRVAAIPATAAKTLDQARSVPEIVDQI 1661
Cdd:pfam12128  386 ELNRDLSGNKERLAkirEAKDRQLAAIEEVLQALESqlRHQLEQQKLEFNEEQYLLESRLGELKLQLNQATATPELLENI 465
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759   1662 ELlleqtekaaeldpgAVDWLEHARRVFGAhpLTAARDGAPDPLARLHGR----LDALGEACRRTTALRRSLEAAAAEWD 1737
Cdd:pfam12128  466 EQ--------------NDERLERAQEAQEQ--ANASVEAAQSELRQLRKRrdeaDEALRRANRRLEQLKQALQQLELQLS 529
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56694759   1738 ---EVWVRFGRVRGGAWKSPAALEAAREQLCalRT-----------ATNTVLGLMADAHypRLPAKDRGALGAKSAERAG 1803
Cdd:pfam12128  530 pqaGSLLHFLRNEAPDWEQSIGKLISTELLH--RTdldpelvesssQELNLYGVTLDLQ--RIDAPDYAALEEALRERLD 605
                          250       260       270       280       290
                   ....*....|....*....|....*....|....*....|....*....|....*....
gi 56694759   1804 AVEE-MGVAVARHDGLLARL-----------REEVVARVPWEMNADALGRLLVEFDALA 1850
Cdd:pfam12128  606 QAEKaLQAARDKQKAAEEQLvqlnkeleklkREETEAARALKQARLTLGRLQDEKQSLK 664
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH