NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|594684729|ref|XP_007189883|]
View 

Protein Classification

7tmA_prokineticin-R domain-containing protein (domain architecture ID 11606947)

7tmA_prokineticin-R domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
7tmA_prokineticin-R cd15204
prokineticin receptors, member of the class A family of seven-transmembrane G protein-coupled ...
290-580 0e+00

prokineticin receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Prokineticins 1 (PROK1) and 2 (PROK2), also known as endocrine gland vascular endothelial factor and Bombina varigata 8, respectively, are multifunctional chemokine-like peptides that are highly conserved across species. Prokineticins can bind with similar affinities to two closely homologous 7-transmembrane G protein coupled receptors, PROKR1 and PROKR2, which are phylogenetically related to the tachykinin receptors. Prokineticins and their GPCRs are widely distributed in human tissues and are involved in numerous physiological roles, including gastrointestinal motility, generation of circadian rhythms, neuron migration and survival, pain sensation, angiogenesis, inflammation, and reproduction. Moreover, different point mutations in genes encoding PROK2 or its receptor (PROKR2) can lead to Kallmann syndrome, a disease characterized by delayed or absent puberty and impaired olfactory function.


:

Pssm-ID: 320332 [Multi-domain]  Cd Length: 288  Bit Score: 556.89  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 290 IVIGLALVGIMLVCGIGNFIFIAALARYKKLRNLTNLLIANLAISDFLVAVVCCPFEMDYYVVRQLSWEHGHVLCASVNY 369
Cdd:cd15204    1 IVLGVVYVLIMLVCGVGNLLLIAVLARYKKLRTLTNLLIANLALSDFLVAVFCLPFEMDYYVVRQRSWTHGDVLCAVVNY 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 370 LRTVSLYVSTNALLAIAIDRYLAIVHPLRPRMKYQTATGLIALVWMVSILIAIPSAYFTTETVLiivKSQEKIFCGQIWP 449
Cdd:cd15204   81 LRTVSLYVSTNALLVIAIDRYLVIVHPLKPRMKRRTACVVIALVWVVSLLLAIPSAVYSKTTPY---ANQGKIFCGQIWP 157
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 450 VDQQIYYKSYFLFIFSIEFVGPVVTMTLCYARISRELWFKAVPGFQTEQIRKRLRCRRKTVLVLMCILTAYVLCWAPFYG 529
Cdd:cd15204  158 VDQQAYYKAYYLFLFVLEFVLPVLIMTLCYLRIVRKVWFRRVPGQQTEQIRRRLRRRRRKVRLLVVILTAFVLCWAPYYG 237
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|.
gi 594684729 530 FTIVRDFFPTVFVKEKHYLTIFYVVECIAMSNSMVNTVCFVTVKNNTIKYF 580
Cdd:cd15204  238 YAIVRDFFPTLLSKEKLNTTIFYIVEALAMSNSMINTVVYVAFNNNIRKYL 288
 
Name Accession Description Interval E-value
7tmA_prokineticin-R cd15204
prokineticin receptors, member of the class A family of seven-transmembrane G protein-coupled ...
290-580 0e+00

prokineticin receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Prokineticins 1 (PROK1) and 2 (PROK2), also known as endocrine gland vascular endothelial factor and Bombina varigata 8, respectively, are multifunctional chemokine-like peptides that are highly conserved across species. Prokineticins can bind with similar affinities to two closely homologous 7-transmembrane G protein coupled receptors, PROKR1 and PROKR2, which are phylogenetically related to the tachykinin receptors. Prokineticins and their GPCRs are widely distributed in human tissues and are involved in numerous physiological roles, including gastrointestinal motility, generation of circadian rhythms, neuron migration and survival, pain sensation, angiogenesis, inflammation, and reproduction. Moreover, different point mutations in genes encoding PROK2 or its receptor (PROKR2) can lead to Kallmann syndrome, a disease characterized by delayed or absent puberty and impaired olfactory function.


Pssm-ID: 320332 [Multi-domain]  Cd Length: 288  Bit Score: 556.89  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 290 IVIGLALVGIMLVCGIGNFIFIAALARYKKLRNLTNLLIANLAISDFLVAVVCCPFEMDYYVVRQLSWEHGHVLCASVNY 369
Cdd:cd15204    1 IVLGVVYVLIMLVCGVGNLLLIAVLARYKKLRTLTNLLIANLALSDFLVAVFCLPFEMDYYVVRQRSWTHGDVLCAVVNY 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 370 LRTVSLYVSTNALLAIAIDRYLAIVHPLRPRMKYQTATGLIALVWMVSILIAIPSAYFTTETVLiivKSQEKIFCGQIWP 449
Cdd:cd15204   81 LRTVSLYVSTNALLVIAIDRYLVIVHPLKPRMKRRTACVVIALVWVVSLLLAIPSAVYSKTTPY---ANQGKIFCGQIWP 157
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 450 VDQQIYYKSYFLFIFSIEFVGPVVTMTLCYARISRELWFKAVPGFQTEQIRKRLRCRRKTVLVLMCILTAYVLCWAPFYG 529
Cdd:cd15204  158 VDQQAYYKAYYLFLFVLEFVLPVLIMTLCYLRIVRKVWFRRVPGQQTEQIRRRLRRRRRKVRLLVVILTAFVLCWAPYYG 237
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|.
gi 594684729 530 FTIVRDFFPTVFVKEKHYLTIFYVVECIAMSNSMVNTVCFVTVKNNTIKYF 580
Cdd:cd15204  238 YAIVRDFFPTLLSKEKLNTTIFYIVEALAMSNSMINTVVYVAFNNNIRKYL 288
7tm_1 pfam00001
7 transmembrane receptor (rhodopsin family); This family contains, amongst other ...
306-565 5.24e-56

7 transmembrane receptor (rhodopsin family); This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins.


Pssm-ID: 333754 [Multi-domain]  Cd Length: 255  Bit Score: 189.83  E-value: 5.24e-56
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729  306 GNFIFIAALARYKKLRNLTNLLIANLAISDFLVAVVCCPFEMDYYVVRQlsWEHGHVLCASVNYLRTVSLYVSTNALLAI 385
Cdd:pfam00001   1 GNLLVILVILRNKKLRTPTNIFLLNLAVADLLFLLLTLPFWLVYYLHGT--WPFGSALCKLVTFLDVVNGYASILLLTAI 78
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729  386 AIDRYLAIVHPLRPRMKYQTATGLIALVWMVSILIAIPSAYFTTETvliIVKSQEKIFCGQIWPVDqqIYYKSYFLFIFS 465
Cdd:pfam00001  79 SIDRYLAIVHPLRYRRIMRRAKAIILLIWVLALLLSLPPLLGWNTL---DIPSNGVTSCLITFPES--LWPVSYLLFSTV 153
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729  466 IEFVGPVVTMTLCYARISRELWfkavpgFQTEQIRKRLRCRRKTVLVLMCILTAYVLCWAPFYGFTIVRDFFPTVFVK-- 543
Cdd:pfam00001 154 LGFLLPLLVILVCYTRIIRTLR------KQQSSSIRSVRSERKALKTLLVVVVVFILCWLPYHILLLLDSLCDLGIIIsc 227
                         250       260
                  ....*....|....*....|....
gi 594684729  544 --EKHYLTIFYVVECIAMSNSMVN 565
Cdd:pfam00001 228 evVTPPRTLLQLTVWLAYSNSCLN 251
PHA03087 PHA03087
G protein-coupled chemokine receptor-like protein; Provisional
264-591 1.32e-23

G protein-coupled chemokine receptor-like protein; Provisional


Pssm-ID: 222976 [Multi-domain]  Cd Length: 335  Bit Score: 102.16  E-value: 1.32e-23
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 264 FSYGDYDMPLDED-EDVTNSRTFFAAKIVIGLALVGIMLVCGIGNFIFIAALARYKkLRNLTNLLIANLAISDfLVAVVC 342
Cdd:PHA03087  14 TTDYYYDTYYDEDyADCDLNIGYDTNSTILIVVYSTIFFFGLVGNIIVIYVLTKTK-IKTPMDIYLLNLAVSD-LLFVMT 91
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 343 CPFEMDYYVVRQLSWehGHVLCASVNYLRTVSLYVSTNALLAIAIDRYLAIVHPLR--PRMKYQTATGLIALVWMVSILI 420
Cdd:PHA03087  92 LPFQIYYYILFQWSF--GEFACKIVSGLYYIGFYNSMNFITVMSVDRYIAIVHPVKsnKINTVKYGYIVSLVIWIISIIE 169
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 421 AIPsayfttetvLIIVKSQEKIFCGQIWPVDQQIYYKSYFLFI-FSIEFVG---PVVTMTLCYARISRELwfkavpgfQT 496
Cdd:PHA03087 170 TTP---------ILFVYTTKKDHETLICCMFYNNKTMNWKLFInFEINIIGmliPLTILLYCYSKILITL--------KG 232
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 497 EQIRKRlrcRRKTVLVLMCILTAYVLCWAPFYgftivrdffPTVFVKEKHYLTIF-------------YVVECIAMSNSM 563
Cdd:PHA03087 233 INKSKK---NKKAIKLVLIIVILFVIFWLPFN---------VSVFVYSLHILHFKsgckavkyiqyalHVTEIISLSHCC 300
                        330       340
                 ....*....|....*....|....*...
gi 594684729 564 VNTVCFVTVKNNTIKYFKKIILLHWKAS 591
Cdd:PHA03087 301 INPLIYAFVSEFFNKHKKKSLKLMFTSS 328
 
Name Accession Description Interval E-value
7tmA_prokineticin-R cd15204
prokineticin receptors, member of the class A family of seven-transmembrane G protein-coupled ...
290-580 0e+00

prokineticin receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Prokineticins 1 (PROK1) and 2 (PROK2), also known as endocrine gland vascular endothelial factor and Bombina varigata 8, respectively, are multifunctional chemokine-like peptides that are highly conserved across species. Prokineticins can bind with similar affinities to two closely homologous 7-transmembrane G protein coupled receptors, PROKR1 and PROKR2, which are phylogenetically related to the tachykinin receptors. Prokineticins and their GPCRs are widely distributed in human tissues and are involved in numerous physiological roles, including gastrointestinal motility, generation of circadian rhythms, neuron migration and survival, pain sensation, angiogenesis, inflammation, and reproduction. Moreover, different point mutations in genes encoding PROK2 or its receptor (PROKR2) can lead to Kallmann syndrome, a disease characterized by delayed or absent puberty and impaired olfactory function.


Pssm-ID: 320332 [Multi-domain]  Cd Length: 288  Bit Score: 556.89  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 290 IVIGLALVGIMLVCGIGNFIFIAALARYKKLRNLTNLLIANLAISDFLVAVVCCPFEMDYYVVRQLSWEHGHVLCASVNY 369
Cdd:cd15204    1 IVLGVVYVLIMLVCGVGNLLLIAVLARYKKLRTLTNLLIANLALSDFLVAVFCLPFEMDYYVVRQRSWTHGDVLCAVVNY 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 370 LRTVSLYVSTNALLAIAIDRYLAIVHPLRPRMKYQTATGLIALVWMVSILIAIPSAYFTTETVLiivKSQEKIFCGQIWP 449
Cdd:cd15204   81 LRTVSLYVSTNALLVIAIDRYLVIVHPLKPRMKRRTACVVIALVWVVSLLLAIPSAVYSKTTPY---ANQGKIFCGQIWP 157
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 450 VDQQIYYKSYFLFIFSIEFVGPVVTMTLCYARISRELWFKAVPGFQTEQIRKRLRCRRKTVLVLMCILTAYVLCWAPFYG 529
Cdd:cd15204  158 VDQQAYYKAYYLFLFVLEFVLPVLIMTLCYLRIVRKVWFRRVPGQQTEQIRRRLRRRRRKVRLLVVILTAFVLCWAPYYG 237
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|.
gi 594684729 530 FTIVRDFFPTVFVKEKHYLTIFYVVECIAMSNSMVNTVCFVTVKNNTIKYF 580
Cdd:cd15204  238 YAIVRDFFPTLLSKEKLNTTIFYIVEALAMSNSMINTVVYVAFNNNIRKYL 288
7tmA_TACR_family cd14992
tachykinin receptor and closely related proteins, member of the class A family of ...
290-580 1.51e-131

tachykinin receptor and closely related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This subfamily includes G-protein coupled receptors for a variety of neuropeptides of the tachykinin (TK) family as well as closely related receptors. The tachykinins are widely distributed throughout the mammalian central and peripheral nervous systems and act as excitatory transmitters on neurons and cells in the gastrointestinal tract. The TKs are characterized by a common five-amino acid C-terminal sequence, Phe-X-Gly-Leu-Met-NH2, where X is a hydrophobic residue. The three major mammalian tachykinins are substance P (SP), neurokinin A (NKA), and neurokinin B (NKB). The physiological actions of tachykinins are mediated through three types of receptors: neurokinin receptor type 1 (NK1R), NK2R, and NK3R. SP is a high-affinity endogenous ligand for NK1R, which interacts with the Gq protein and activates phospholipase C, leading to elevation of intracellular calcium. NK2R is a high-affinity receptor for NKA, the tachykinin neuropeptide substance K. SP and NKA are found in the enteric nervous system and mediate in the regulation of gastrointestinal motility, secretion, vascular permeability, and pain perception. NK3R is activated by its high-affinity ligand, NKB, which is primarily involved in the central nervous system and plays a critical role in the regulation of gonadotropin hormone release and the onset of puberty.


Pssm-ID: 320123 [Multi-domain]  Cd Length: 291  Bit Score: 387.17  E-value: 1.51e-131
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 290 IVIGLALVGIMLVCGIGNFIFIAALARYKKLRNLTNLLIANLAISDFLVAVVCCPFEMDYYVVRqlSWEHGHVLCASVNY 369
Cdd:cd14992    1 IILGVALVVIILVSVVGNFIVIAALARHKNLRGATNYFIASLAISDLLMALFCTPFNFTYVVSL--SWEYGHFLCKIVNY 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 370 LRTVSLYVSTNALLAIAIDRYLAIVHPLRPR--MKYQTATGLIALVWMVSILIAIPSAYFTTETVLIIVKSQEKIFCGQI 447
Cdd:cd14992   79 LRTVSVYASSLTLTAIAFDRYFAIIHPLKPRhrQSYTTTVIIIITIWVVSLLLAIPQLYYATTEVLFSVKNQEKIFCCQI 158
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 448 WPVDQQIYYKSYFLFIFSIEFVGPVVTMTLCYARISRELWFKAVPGFQ-TEQIRKRLRCRRKTVLVLMCILTAYVLCWAP 526
Cdd:cd14992  159 PPVDNKTYEKVYFLLIFVVIFVLPLIVMTLAYARISRELWFRKVPGFSiKEVERKRLKCKRRVIKMLVCVVVLFVICWLP 238
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|....
gi 594684729 527 FYGFTIVRDFFPTvFVKEKHYLTIFYVVECIAMSNSMVNTVCFVTVKNNTIKYF 580
Cdd:cd14992  239 FHLFFLLRDFFPL-IMKEKHTLQVYYFLHWIAMSNSMYNPIIYVTLNNNFRKNF 291
7tmA_NPYR-like cd15203
neuropeptide Y receptors and related proteins, member of the class A family of ...
298-565 5.46e-68

neuropeptide Y receptors and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; NPY is a 36-amino acid peptide neurotransmitter with a C-terminal tyrosine amide residue that is widely distributed in the brain and the autonomic nervous system of many mammalian species. NPY exerts its functions through five, G-protein coupled receptor subtypes including NPY1R, NPY2R, NPY4R, NPY5R, and NPY6R; however, NPY6R is not functional in humans. NYP receptors are also activated by its two other family members, peptide YY (PYY) and pancreatic polypeptide (PP). They typically couple to Gi or Go proteins, which leads to a decrease in adenylate cyclase activity, thereby decreasing intracellular cAMP levels, and are involved in diverse physiological roles including appetite regulation, circadian rhythm, and anxiety. Also included in this subgroup is prolactin-releasing peptide (PrRP) receptor (previously known as GPR10), which is activated by its endogenous ligand PrRP, a neuropeptide possessing C-terminal Arg-Phe-amide motif. There are two active isoforms of PrRP in mammals: one consists of 20 amino acid residues (PrRP-20) and the other consists of 31 amino acid residues (PrRP-31). PrRP receptor shows significant sequence homology to the NPY receptors, and a micromolar level of NPY can bind and completely inhibit the PrRP-evoked intracellular calcium response in PrRP receptor-expressing cells, suggesting that the PrRP receptor shares a common ancestor with the NPY receptors.


Pssm-ID: 320331 [Multi-domain]  Cd Length: 293  Bit Score: 222.86  E-value: 5.46e-68
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 298 GIMLVCGI-GNFIFIAALARYKKLRNLTNLLIANLAISDFLVAVVCCPFEMDYYVVRQlsWEHGHVLCASVNYLRTVSLY 376
Cdd:cd15203    8 GLIIVLGVvGNLLVIYVVLRNKSMQTVTNIFILNLAVSDLLLCLVSLPFTLIYTLTKN--WPFGSILCKLVPSLQGVSIF 85
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 377 VSTNALLAIAIDRYLAIVHPLRPRMKYQTATGLIALVWMVSILIAIPSAYFTT-ETVLIIVKSQEKIFCGQIWPvdQQIY 455
Cdd:cd15203   86 VSTLTLTAIAIDRYQLIVYPTRPRMSKRHALLIIALIWILSLLLSLPLAIFQElSDVPIEILPYCGYFCTESWP--SSSS 163
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 456 YKSYFLFIFSIEFVGPVVTMTLCYARISREL---WFK--AVPGFQTEQIRKRLRCRRKTVLVLMCILTAYVLCWAPFYGF 530
Cdd:cd15203  164 RLIYTISVLVLQFVIPLLIISFCYFRISLKLrkrVKKkrGKRTLSSRRRRSELRRKRRTNRLLIAMVVVFAVCWLPLNLF 243
                        250       260       270
                 ....*....|....*....|....*....|....*
gi 594684729 531 TIVRDFFPTVFVKEKHYLTIFYVVECIAMSNSMVN 565
Cdd:cd15203  244 NLLRDFEPLPQIDGRHFYLIFLICHLIAMSSACVN 278
7tmA_CCKR-like cd14993
cholecystokinin receptors and related proteins, member of the class A family of ...
290-580 3.31e-66

cholecystokinin receptors and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group represents four G-protein coupled receptors that are members of the RFamide receptor family, including cholecystokinin receptors (CCK-AR and CCK-BR), orexin receptors (OXR), neuropeptide FF receptors (NPFFR), and pyroglutamylated RFamide peptide receptor (QRFPR). These RFamide receptors are activated by their endogenous peptide ligands that share a common C-terminal arginine (R) and an amidated phenylanine (F) motif. CCK-AR (type A, alimentary; also known as CCK1R) is found abundantly on pancreatic acinar cells and binds only sulfated CCK-peptides with very high affinity, whereas CCK-BR (type B, brain; also known as CCK2R), the predominant form in the brain and stomach, binds CCK or gastrin and discriminates poorly between sulfated and non-sulfated peptides. CCK is implicated in regulation of digestion, appetite control, and body weight, and is involved in neurogenesis via CCK-AR. There is some evidence to support that CCK and gastrin, via their receptors, are involved in promoting cancer development and progression, acting as growth and invasion factors. Orexins (OXs; also referred to as hypocretins) are neuropeptide hormones that regulate the sleep-wake cycle and potently influence homeostatic systems regulating appetite and feeding behavior or modulating emotional responses such as anxiety or panic. OXs are synthesized as prepro-orexin (PPO) in the hypothalamus and then proteolytically cleaved into two forms of isoforms: orexin-A (OX-A) and orexin-B (OX-B). OXA is a 33 amino-acid peptide with N-terminal pyroglutamyl residue and two intramolecular disulfide bonds, whereas OXB is a 28 amino-acid linear peptide with no disulfide bonds. OX-A binds orexin receptor 1 (OX1R) with high-affinity, but also binds with somewhat low-affinity to OX2R, and signals primarily to Gq coupling, whereas OX-B shows a strong preference for the orexin receptor 2 (OX2R) and signals through Gq or Gi/o coupling. The 26RFa, also known as QRFP (Pyroglutamylated RFamide peptide), is a 26-amino acid residue peptide that exerts similar orexigenic activity including the regulation of feeding behavior in mammals. It is the ligand for G-protein coupled receptor 103 (GPR103), which is predominantly expressed in paraventricular (PVN) and ventromedial (VMH) nuclei of the hypothalamus. GPR103 shares significant protein sequence homology with orexin receptors (OX1R and OX2R), which have recently shown to produce a neuroprotective effect in Alzheimer's disease by forming a functional heterodimer with GPR103. Neuropeptide FF (NPFF) is a mammalian octapeptide that has been implicated in a wide range of physiological functions in the brain including pain sensitivity, insulin release, food intake, memory, blood pressure, and opioid-induced tolerance and hyperalgesia. The effects of NPFF are mediated through neuropeptide FF1 and FF2 receptors (NPFF1-R and NPFF2-R) which are predominantly expressed in the brain. NPFF induces pro-nociceptive effects, mainly through the NPFF1-R, and anti-nociceptive effects, mainly through the NPFF2-R.


Pssm-ID: 320124 [Multi-domain]  Cd Length: 296  Bit Score: 218.24  E-value: 3.31e-66
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 290 IVIGLALVGIMLVCGIGNFIFIAALARYKKLRNLTNLLIANLAISDFLVAVVCCPFEMDYYVVRqlSWEHGHVLCASVNY 369
Cdd:cd14993    1 IVLIVLYVVVFLLALVGNSLVIAVVLRNKHMRTVTNYFLVNLAVADLLVSLFCMPLTLLENVYR--PWVFGEVLCKAVPY 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 370 LRTVSLYVSTNALLAIAIDRYLAIVHPLRPRMKY--QTATGLIALVWMVSILIAIPSAYFTTETVLIIV--KSQEKIFCG 445
Cdd:cd14993   79 LQGVSVSASVLTLVAISIDRYLAICYPLKARRVStkRRARIIIVAIWVIAIIIMLPLLVVYELEEIISSepGTITIYICT 158
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 446 QIWPvdQQIYYKSYFLFIFSIEFVGPVVTMTLCYARISRELWFKAVPGFQT----EQIRKRLRCRRKTVLVLMCILTAYV 521
Cdd:cd14993  159 EDWP--SPELRKAYNVALFVVLYVLPLLIISVAYSLIGRRLWRRKPPGDRGsansTSSRRILRSKKKVARMLIVVVVLFA 236
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 522 LCWAPFYGFTIVRDFFPTVFVKEKH-YLTIFYVVECIAMSNSMVNTVCFVTVKNNTIKYF 580
Cdd:cd14993  237 LSWLPYYVLSILLDFGPLSSEESDEnFLLILPFAQLLGYSNSAINPIIYCFMSKKFRRGF 296
7tmA_PR4-like cd15392
neuropeptide Y receptor-like found in insect and related proteins, member of the class A ...
290-565 3.58e-61

neuropeptide Y receptor-like found in insect and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This subgroup includes a novel G protein-coupled receptor (also known as PR4 receptor) from Drosophila melanogaster, which can be activated by the members of the neuropeptide Y (NPY) family, including NPY, peptide YY (PYY) and pancreatic polypeptide (PP), when expressed in Xenopus oocytes. These homologous peptides of 36-amino acids in length contain a hairpin-like structural motif, which referred to as the pancreatic polypeptide fold, and function as gastrointestinal hormones and neurotransmitters. The PR4 receptor also shares strong sequence homology to the mammalian tachykinin receptors (NK1R, NK2R, and NK3R), whose endogenous ligands are substance P (SP), neurokinin A (NKA), and neurokinin B (NKB), respectively. The tachykinins function as excitatory transmitters on neurons and cells in the gastrointestinal tract.


Pssm-ID: 320514 [Multi-domain]  Cd Length: 287  Bit Score: 204.90  E-value: 3.58e-61
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 290 IVIGLALVGIMLVCGIGNFIFIAALARYKKLRNLTNLLIANLAISDFLVAVVCCPFEMdYYVVRQLSWEHGHVLCASVNY 369
Cdd:cd15392    1 VIIILMYSTIFVLAVGGNGLVCYIVVSYPRMRTVTNYFIVNLALSDILMAVFCVPFSF-IALLILQYWPFGEFMCPVVNY 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 370 LRTVSLYVSTNALLAIAIDRYLAIVHPLRPRMKYQTATGLIALVWMVSILIAIPSAyFTTETVLIIVKSQEKIFCGQIWP 449
Cdd:cd15392   80 LQAVSVFVSAFTLVAISIDRYVAIMWPLRPRMTKRQALLLIAVIWIFALATALPIA-ITSRLFEDSNASCGQYICTESWP 158
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 450 VDQQIYYKSYFLFIfsIEFVGPVVTMTLCYARISRELWFKAVPGFQTE-QIRKRLRCRRKTVLVLMCILTAYVLCWAPFY 528
Cdd:cd15392  159 SDTNRYIYSLVLMI--LQYFVPLAVLVFTYTRIGIVVWAKRTPGEAENnRDQRMAESKRKLVKMMITVVAIFALCWLPLN 236
                        250       260       270
                 ....*....|....*....|....*....|....*..
gi 594684729 529 GFTIVRDFFPTVFvKEKHYLTIFYVVECIAMSNSMVN 565
Cdd:cd15392  237 ILNLVGDHDESIY-SWPYIPYLWLAAHWLAMSHCCYN 272
7tm_classA_rhodopsin-like cd00637
rhodopsin receptor-like class A family of the seven-transmembrane G protein-coupled receptor ...
294-565 9.58e-61

rhodopsin receptor-like class A family of the seven-transmembrane G protein-coupled receptor superfamily; Class A rhodopsin-like receptors constitute about 90% of all GPCRs. The class A GPCRs include the light-sensitive rhodopsin as well as receptors for biogenic amines, lipids, nucleotides, odorants, peptide hormones, and a variety of other ligands. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes. Based on sequence similarity, GPCRs can be divided into six major classes: class A (rhodopsin-like family), class B (Methuselah-like, adhesion and secretin-like receptor family), class C (metabotropic glutamate receptor family), class D (fungal mating pheromone receptors), class E (cAMP receptor family), and class F (frizzled/smoothened receptor family). Nearly 800 human GPCR genes have been identified and are involved essentially in all major physiological processes. Approximately 40% of clinically marketed drugs mediate their effects through modulation of GPCR function for the treatment of a variety of human diseases including bacterial infections.


Pssm-ID: 341313 [Multi-domain]  Cd Length: 275  Bit Score: 203.28  E-value: 9.58e-61
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 294 LALVGIMLVCGIGNFIFIAALARYKKLRNLTNLLIANLAISDFLVAVVCCPFEMDYYVVRqlSWEHGHVLCASVNYLRTV 373
Cdd:cd00637    3 VLYILIFVVGVVGNLLVILVILRNRRLRTVTNYFILNLAVADLLVGLLVIPFSLVSLLLG--GWWFGDALCKLLGFLQTV 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 374 SLYVSTNALLAIAIDRYLAIVHPLRP--RMKYQTATGLIALVWMVSILIAIPSAYFTTetvliivKSQEKIFCGQIWPVD 451
Cdd:cd00637   81 SLTASILTLTAISVDRYLAIVHPLRYrrRFTRRRAKLVIALIWLLSLLLALPPLLGWK-------VYDYGGYCCCCLCWP 153
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 452 QQIYYKSYFLFIFSIEFVGPVVTMTLCYARISRELWFKAVPGF---QTEQIRKRLRCRRKTVLVLMCILTAYVLCWAPFY 528
Cdd:cd00637  154 DSTLRKAYTIFLFVLLFLLPLLVIIVCYVRIFRKLRRHRRRIRrssSNSSRRRRRRRERKVTKMLLIVVVVFLLCWLPYF 233
                        250       260       270
                 ....*....|....*....|....*....|....*..
gi 594684729 529 GFTIVRDFFPTVFvkeKHYLTIFYVVECIAMSNSMVN 565
Cdd:cd00637  234 ILLLLDVFGPDPS---PLPRILYFLALLLAYLNSAIN 267
7tm_1 pfam00001
7 transmembrane receptor (rhodopsin family); This family contains, amongst other ...
306-565 5.24e-56

7 transmembrane receptor (rhodopsin family); This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins.


Pssm-ID: 333754 [Multi-domain]  Cd Length: 255  Bit Score: 189.83  E-value: 5.24e-56
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729  306 GNFIFIAALARYKKLRNLTNLLIANLAISDFLVAVVCCPFEMDYYVVRQlsWEHGHVLCASVNYLRTVSLYVSTNALLAI 385
Cdd:pfam00001   1 GNLLVILVILRNKKLRTPTNIFLLNLAVADLLFLLLTLPFWLVYYLHGT--WPFGSALCKLVTFLDVVNGYASILLLTAI 78
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729  386 AIDRYLAIVHPLRPRMKYQTATGLIALVWMVSILIAIPSAYFTTETvliIVKSQEKIFCGQIWPVDqqIYYKSYFLFIFS 465
Cdd:pfam00001  79 SIDRYLAIVHPLRYRRIMRRAKAIILLIWVLALLLSLPPLLGWNTL---DIPSNGVTSCLITFPES--LWPVSYLLFSTV 153
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729  466 IEFVGPVVTMTLCYARISRELWfkavpgFQTEQIRKRLRCRRKTVLVLMCILTAYVLCWAPFYGFTIVRDFFPTVFVK-- 543
Cdd:pfam00001 154 LGFLLPLLVILVCYTRIIRTLR------KQQSSSIRSVRSERKALKTLLVVVVVFILCWLPYHILLLLDSLCDLGIIIsc 227
                         250       260
                  ....*....|....*....|....
gi 594684729  544 --EKHYLTIFYVVECIAMSNSMVN 565
Cdd:pfam00001 228 evVTPPRTLLQLTVWLAYSNSCLN 251
7tmA_TACR cd15390
neurokinin receptors (or tachykinin receptors), member of the class A family of ...
293-565 5.39e-54

neurokinin receptors (or tachykinin receptors), member of the class A family of seven-transmembrane G protein-coupled receptors; This group represents G-protein coupled receptors for a variety of neuropeptides of the tachykinin (TK) family. The tachykinins are widely distributed throughout the mammalian central and peripheral nervous systems and act as excitatory transmitters on neurons and cells in the gastrointestinal tract. The TKs are characterized by a common five-amino acid C-terminal sequence, Phe-X-Gly-Leu-Met-NH2, where X is a hydrophobic residue. The three major mammalian tachykinins are substance P (SP), neurokinin A (NKA), and neurokinin B (NKB). The physiological actions of tachykinins are mediated through three types of receptors: neurokinin receptor type 1 (NK1R), NK2R, and NK3R. SP is a high-affinity endogenous ligand for NK1R, which interacts with the Gq protein and activates phospholipase C, leading to elevation of intracellular calcium. NK2R is a high-affinity receptor for NKA, the tachykinin neuropeptide substance K. SP and NKA are found in the enteric nervous system and mediate in the regulation of gastrointestinal motility, secretion, vascular permeability, and pain perception. NK3R is activated by its high-affinity ligand, NKB, which is primarily involved in the central nervous system and plays a critical role in the regulation of gonadotropin hormone release and the onset of puberty.


Pssm-ID: 320512 [Multi-domain]  Cd Length: 289  Bit Score: 185.58  E-value: 5.39e-54
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 293 GLALVGIMLVCGIGNFIFIAALARYKKLRNLTNLLIANLAISDFLVAVVCCPFeMDYYVVRQlSWEHGHVLCASVNYLRT 372
Cdd:cd15390    4 SIVFVVMVLVAIGGNLIVIWIVLAHKRMRTVTNYFLVNLAVADLLISAFNTVF-NFTYLLYN-DWPFGLFYCKFSNFVAI 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 373 VSLYVSTNALLAIAIDRYLAIVHPLRPRMKYQTATGLIALVWMVSILIAIPSAYFTTETVLIIVKSQEKIFCGQIWPVDQ 452
Cdd:cd15390   82 TTVAASVFTLMAISIDRYIAIVHPLRPRLSRRTTKIAIAVIWLASFLLALPQLLYSTTETYYYYTGSERTVCFIAWPDGP 161
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 453 QIYYKS-YFLFIFSIEFVGPVVTMTLCYARISRELWFKAVPGFQTEQIRKRLRCRRKTVLVLMCILTAYVLCWAPFYGFT 531
Cdd:cd15390  162 NSLQDFvYNIVLFVVTYFLPLIIMAVAYTRVGVELWGSKTIGENTPRQLESVRAKRKVVKMMIVVVVIFAICWLPYHLYF 241
                        250       260       270
                 ....*....|....*....|....*....|....
gi 594684729 532 IVRDFFPTVFVKeKHYLTIFYVVECIAMSNSMVN 565
Cdd:cd15390  242 ILTYLYPDINSW-KYIQQIYLAIYWLAMSNSMYN 274
7tmA_NPFFR cd15207
neuropeptide FF receptors, member of the class A family of seven-transmembrane G ...
290-565 8.98e-54

neuropeptide FF receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Neuropeptide FF (NPFF) is a mammalian octapeptide that belongs to a family of neuropeptides containing an RF-amide motif at their C-terminus that have been implicated in a wide range of physiological functions in the brain including pain sensitivity, insulin release, food intake, memory, blood pressure, and opioid-induced tolerance and hyperalgesia. The effects of these peptides are mediated through neuropeptide FF1 and FF2 receptors (NPFF1-R and NPFF2-R) which are predominantly expressed in the brain. NPFF induces pro-nociceptive effects, mainly through the NPFF1-R, and anti-nociceptive effects, mainly through the NPFF2-R. NPFF has been shown to inhibit adenylate cyclase via the Gi protein coupled to NPFF1-R.


Pssm-ID: 320335 [Multi-domain]  Cd Length: 291  Bit Score: 185.13  E-value: 8.98e-54
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 290 IVIGLALVGIMLVCGIGNFIFIAALARYKKLRNLTNLLIANLAISDFLVAVVCCPFEMDYYVVrqLSWEHGHVLCASVNY 369
Cdd:cd15207    1 VLFIVSYSLIFLLCVVGNVLVCLVVAKNPRMRTVTNYFILNLAVSDLLVGVFCMPFTLVDNIL--TGWPFGDVMCKLSPL 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 370 LRTVSLYVSTNALLAIAIDRYLAIVHPLRPRMKYQTATGLIALVWMVSILIAIPSAYFTTETVLIIVKSQEKIFCGQIWP 449
Cdd:cd15207   79 VQGVSVAASVFTLVAIAVDRYRAVVHPTEPKLTNRQAFVIIVAIWVLALAIMIPQALVLEVKEYQFFRGQTVHICVEFWP 158
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 450 VDqqIYYKSYFLFIFSIEFVGPVVTMTLCYARISRELWFKAVPG---FQTEQIRKRLRCRRKTVLVLMCILTAYVLCWAP 526
Cdd:cd15207  159 SD--EYRKAYTTSLFVLCYVAPLLIIAVLYVRIGYRLWFKPVPGggsASREAQAAVSKKKVRVIKMLIVVVVLFALSWLP 236
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|.
gi 594684729 527 FYGFTIVRDFFPtVFVKEKH--YLTIFYVVECIAMSNSMVN 565
Cdd:cd15207  237 LHTVTMLDDFGN-LSPNQREvlYVYIYPIAHWLAYFNSCVN 276
7tmA_TACR-like cd15202
tachykinin receptors and related receptors, member of the class A family of ...
299-565 3.00e-48

tachykinin receptors and related receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes the neurokinin/tachykinin receptors and its closely related receptors such as orphan GPR83 and leucokinin-like peptide receptor. The tachykinins are widely distributed throughout the mammalian central and peripheral nervous systems and act as excitatory transmitters on neurons and cells in the gastrointestinal tract. The TKs are characterized by a common five-amino acid C-terminal sequence, Phe-X-Gly-Leu-Met-NH2, where X is a hydrophobic residue. The three major mammalian tachykinins are substance P (SP), neurokinin A (NKA), and neurokinin B (NKB). The physiological actions of tachykinins are mediated through three types of receptors: neurokinin receptor type 1 (NK1R), NK2R, and NK3R. SP is a high-affinity endogenous ligand for NK1R, which interacts with the Gq protein and activates phospholipase C, leading to elevation of intracellular calcium. NK2R is a high-affinity receptor for NKA, the tachykinin neuropeptide substance K. SP and NKA are found in the enteric nervous system and mediate in the regulation of gastrointestinal motility, secretion, vascular permeability, and pain perception. NK3R is activated by its high-affinity ligand, NKB, which is primarily involved in the central nervous system and plays a critical role in the regulation of gonadotropin hormone release and the onset of puberty.


Pssm-ID: 320330 [Multi-domain]  Cd Length: 288  Bit Score: 170.38  E-value: 3.00e-48
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 299 IMLVCGIGNFIFIAALARYKKLRNLTNLLIANLAISDFLVAVVCCPFEMDYYVVRQlsWEHGHVLCASVNYLRTVSLYVS 378
Cdd:cd15202   10 IIVFSLFGNVLVCWIIFKNQRMRTVTNYFIVNLAVADIMITLFNTPFTFVRAVNNT--WIFGLFMCHFSNFAQYCSVHVS 87
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 379 TNALLAIAIDRYLAIVHPLRPRMKYQTATGLIALVWMVSILIAIPSAYFTTETVLIIVKSQEKIFCGQIWPVDQQIYYKS 458
Cdd:cd15202   88 AYTLTAIAVDRYQAIMHPLKPRISKTKAKFIIAVIWTLALAFALPHAICSKLETFKYSEDIVRSLCLEDWPERADLFWKY 167
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 459 YFLFIFSIEFVGPVVTMTLCYARISRELWFKAVPG-FQTEQIRKRLRCRRKTVLVLMCILTAYVLCWAPFYGFTIVRDFF 537
Cdd:cd15202  168 YDLALFILQYFLPLLVISFAYARVGIKLWASNMPGdATTERYFALRRKKKKVIKMLMVVVVLFALCWLPFNIYVLLLSSK 247
                        250       260
                 ....*....|....*....|....*...
gi 594684729 538 PtvFVKEKHYLTIFYVVECIAMSNSMVN 565
Cdd:cd15202  248 P--DYLIKTINAVYFAFHWLAMSSTCYN 273
7tmA_PrRP_R cd15394
prolactin-releasing peptide receptor, member of the class A family of seven-transmembrane G ...
299-565 7.17e-47

prolactin-releasing peptide receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; Prolactin-releasing peptide (PrRP) receptor (previously known as GPR10) is expressed in the central nervous system with the highest levels located in the anterior pituitary and is activated by its endogenous ligand PrRP, a neuropeptide possessing a C-terminal Arg-Phe-amide motif. There are two active isoforms of PrRP in mammals: one consists of 20 amino acids (PrRP-20) and the other consists of 31 amino acids (PrRP-31), where PrRP-20 is a C-terminal fragment of PrRP-31. Binding of PrRP to the receptor coupled to G(i/o) proteins activates the extracellular signal-related kinase (ERK) and it can also couple to G(q) protein leading to an increase in intracellular calcium and activation of c-Jun N-terminal protein kinase (JNK). The PrRP receptor shares significant sequence homology with the neuropeptide Y (NPY) receptor, and micromolar levels of NPY can bind and completely inhibit the PrRP-evoked intracellular calcium response in PrRP receptor-expressing cells, suggesting that the PrRP receptor shares a common ancestor with the NPY receptors. PrRP has been shown to reduce food intake and body weight and modify body temperature when administered in rats. It also has been shown to decrease circulating growth hormone levels by activating somatostatin-secreting neurons in the hypothalamic periventricular nucleus.


Pssm-ID: 320516 [Multi-domain]  Cd Length: 286  Bit Score: 166.45  E-value: 7.17e-47
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 299 IMLVCGIGNFIFIAALARYKKLRNLTNLLIANLAISDFLVAVVCCPFEMdYYVVRQLSWEHGHVLCASVNYLRTVSLYVS 378
Cdd:cd15394   10 VVLVGVVGNYLLIYVICRTKKMHNVTNFLIGNLAFSDMLMCATCVPLTL-AYAFEPRGWVFGRFMCYFVFLMQPVTVYVS 88
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 379 TNALLAIAIDRYLAIVHPLRPRMKYQTATGLIALVWMVSILIAIPSAyftTETVLIIVKSQEKIFCGQIW---PVDQQIY 455
Cdd:cd15394   89 VFTLTAIAVDRYYVTVYPLRRRISRRTCAYIVAAIWLLSCGLALPAA---AHTYYVEFKGLDFSICEEFWfgqEKQRLAY 165
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 456 ykSYFLFIfsIEFVGPVVTMTLCYARISRELWFKAVPGFQTE-QIRKRLRCRRKTVLVLMCILTAYVLCWAPFYGFTIVR 534
Cdd:cd15394  166 --ACSTLL--ITYVLPLLAISLSYLRISVKLRNRVVPGSMTQsQAEWDRARRRKTFRLLVVVVVAFAICWLPLHIFNVIR 241
                        250       260       270
                 ....*....|....*....|....*....|.
gi 594684729 535 DFFPTvFVKEKHYLTIFYVVECIAMSNSMVN 565
Cdd:cd15394  242 DIDID-LIDKQYFNLIQLLCHWLAMSSACYN 271
7tmA_amine_R-like cd14967
amine receptors and similar proteins, member of the class A family of seven-transmembrane G ...
291-565 6.80e-44

amine receptors and similar proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; Amine receptors of the class A family of GPCRs include adrenoceptors, 5-HT (serotonin) receptors, muscarinic cholinergic receptors, dopamine receptors, histamine receptors, and trace amine receptors. The receptors of amine subfamily are major therapeutic targets for the treatment of neurological disorders and psychiatric diseases. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320098 [Multi-domain]  Cd Length: 259  Bit Score: 157.34  E-value: 6.80e-44
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 291 VIGLALVGIMLVCGIGNFIFIAALARYKKLRNLTNLLIANLAISDFLVAVVCCPFEMDYYVVRqlSWEHGHVLCASVNYL 370
Cdd:cd14967    1 LLAVFLSLIILVTVFGNLLVILAVYRNRRLRTVTNYFIVSLAVADLLVALLVMPFSAVYTLLG--YWPFGPVLCRFWIAL 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 371 RTVSLYVSTNALLAIAIDRYLAIVHPL--RPRMKYQTATGLIALVWMVSILIAIPSayftteTVLIIVKSQEKIFCGQIW 448
Cdd:cd14967   79 DVLCCTASILNLCAISLDRYLAITRPLryRQLMTKKRALIMIAAVWVYSLLISLPP------LVGWRDETQPSVVDCECE 152
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 449 PVDQQIYYksyfLFIFSIEFVGPVVTMTLCYARISRELwfkavpgfQTEqirkrlrcrRKTVLVLMCILTAYVLCWAPFY 528
Cdd:cd14967  153 FTPNKIYV----LVSSVISFFIPLLIMIVLYARIFRVA--------RRE---------LKAAKTLAIIVGAFLLCWLPFF 211
                        250       260       270
                 ....*....|....*....|....*....|....*..
gi 594684729 529 GFTIVRDFFPTVFVKEkHYLTIFYvveCIAMSNSMVN 565
Cdd:cd14967  212 IIYLVSAFCPPDCVPP-ILYAVFF---WLGYLNSALN 244
7tmA_GPR83 cd15389
G protein-coupled receptor 83, member of the class A family of seven-transmembrane G ...
290-565 1.02e-42

G protein-coupled receptor 83, member of the class A family of seven-transmembrane G protein-coupled receptors; GPR83, also known as GPR72, is widely expressed in the brain, including hypothalamic nuclei which is involved in regulating energy balance and food intake. The hypothalamic expression of GPR83 is tightly regulated in response to nutrient availability and is decreased in obese mice. A recent study suggests that GPR83 has a critical role in the regulation of systemic energy metabolism via ghrelin-dependent and ghrelin-independent mechanisms. GPR83 shares a significant amino acid sequence identity with the tachykinin receptors, however its endogenous ligand is unknown.


Pssm-ID: 320511 [Multi-domain]  Cd Length: 285  Bit Score: 155.19  E-value: 1.02e-42
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 290 IVIGLALVGIMLVCGIGNFIFIAALARYKKLRNLTNLLIANLAISDFLVAVVCCPFEMDYYVVRQlsWEHGHVLCASVNY 369
Cdd:cd15389    1 ALLIVAYSIIIVISLFGNSLVCHVIFKNKRMHTATNLFIVNLAVSDILITLLNTPFTLVRFVNST--WVFGKIMCHLSRF 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 370 LRTVSLYVSTNALLAIAIDRYLAIVHPLRPRMKYQTATGLIALVWMVSILIAIPSAYFTTETVLIIVKSQEKIFCGQIWP 449
Cdd:cd15389   79 AQYCSVYVSTLTLTAIALDRHRVILHPLKPRITPCQGVVVIAIIWIMASCLSLPHAIYQKLVEFEYSNERTRSRCLPSFP 158
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 450 VDQQIYYKSYFLFIFSIEFVGPVVTMTLCYARISRELWF-KAVPGFQTEQIRKRLRCRRKTVLVLMCILTAYVLCWAPFY 528
Cdd:cd15389  159 EPSDLFWKYLDLATFILQYVLPLLIIGVAYTRVAKKLWLrNAIGDVTTEQYVAQRRKKKKTIKMLMLVVLLFAICWLPLN 238
                        250       260       270
                 ....*....|....*....|....*....|....*..
gi 594684729 529 GFTIVRDFFPTvfvkeKHYLTIFYVVECIAMSNSMVN 565
Cdd:cd15389  239 CYHVLLSSHPI-----RSNSALFFAFHWLAMSSTCYN 270
7tmA_leucokinin-like cd15393
leucokinin-like peptide receptor from tick and related proteins, member of the class A family ...
298-565 3.21e-42

leucokinin-like peptide receptor from tick and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This subgroup includes a leucokinin-like peptide receptor from the Southern cattle tick, Boophilus microplus, a pest of cattle world-wide. Leucokinins are invertebrate neuropeptides that exhibit myotropic and diuretic activity. This receptor is the first neuropeptide receptor known from the Acari and the second known in the subfamily of leucokinin-like peptide G-protein-coupled receptors. The other known leucokinin-like peptide receptor is a lymnokinin receptor from the mollusc Lymnaeastagnalis.


Pssm-ID: 320515 [Multi-domain]  Cd Length: 288  Bit Score: 153.72  E-value: 3.21e-42
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 298 GIMLVCGIGNFIFIAALARYKKLRNLTNLLIANLAISDFLVAVVCCPFEMDYYVVRqlSWEHGHVLCASVNYLRTVSLYV 377
Cdd:cd15393    9 IISLVAVVGNFLVIWVVAKNRRMRTVTNIFIANLAVADIIIGLFSIPFQFQAALLQ--RWVLPRFMCPFCPFVQVLSVNV 86
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 378 STNALLAIAIDRYLAIVHPLRPRMKYQTATGLIALVWMVSILIAIPSA-YFTTETVLIIVKSQEKIFCGQIWPVDQQiyY 456
Cdd:cd15393   87 SVFTLTVIAVDRYRAVIHPLKARCSKKSAKIIILIIWILALLVALPVAlALRVEELTDKTNNGVKPFCLPVGPSDDW--W 164
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 457 KSYFLFIFSIEFVGPVVTMTLCYARISRELWFKAVPG-FQTEQIRKRLRCRRKTVLVLMCILTAYVLCWAPFYGFTIVRD 535
Cdd:cd15393  165 KIYNLYLVCVQYFVPLVIICYAYTRIAVKIWGTKAPGnAQDVRDDEILKNKKKVIKMLIIVVALFALCWLPLQTYNLLNE 244
                        250       260       270
                 ....*....|....*....|....*....|
gi 594684729 536 FFPTVfVKEKHYLTIFYVVECIAMSNSMVN 565
Cdd:cd15393  245 IKPEI-NKYKYINIIWFCSHWLAMSNSCYN 273
7tmA_NPY2R cd15399
neuropeptide Y receptor type 2, member of the class A family of seven-transmembrane G ...
290-580 3.00e-41

neuropeptide Y receptor type 2, member of the class A family of seven-transmembrane G protein-coupled receptors; NPY is a 36-amino acid peptide neurotransmitter with a C-terminal tyrosine amide residue that is widely distributed in the brain and the autonomic nervous system of many mammalian species. NPY exerts its functions through five, G-protein coupled receptor subtypes including NPY1R, NPY2R, NPY4R, NPY5R, and NPY6R; however, NPY6R is not functional in humans. NYP receptors are also activated by its two other family members, peptide YY (PYY) and pancreatic polypeptide (PP). They typically couple to G(i) or G(o) proteins, which leads to a decrease in adenylate cyclase activity, thereby decreasing intracellular cAMP levels, and are involved in diverse physiological roles including appetite regulation, circadian rhythm, and anxiety. When NPY signals through NPY2R in concert with NPY5R, it induces angiogenesis and consequently plays an important role in revascularization and wound healing. On the other hand, when NPY acts through NPY1R and NPYR5, it acts as a vascular mitogen, leading to restenosis and atherosclerosis.


Pssm-ID: 320521 [Multi-domain]  Cd Length: 285  Bit Score: 151.13  E-value: 3.00e-41
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 290 IVIGLALVGIMLVCGIGNFIFIAALARYKKLRNLTNLLIANLAISDFLVAVVCCPFEMDYYVVRQlsWEHGHVLCASVNY 369
Cdd:cd15399    1 IVLILAYCSIILLGVVGNSLVIYVVIKFKNMRTVTNFFIANLAVADLMVNTLCLPFTLVYTLLDE--WKFGAVLCHLVPY 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 370 LRTVSLYVSTNALLAIAIDRYLAIVHPLRPRMKYQTATGLIALVWMVSILIAIPSAYFTTETVLIIVKSQEKIFCGQIWP 449
Cdd:cd15399   79 AQALAVHVSTVTLTVIALDRHRCIVYHLESKISKKISFLIIGLTWAASALLASPLAIFREYSVIEISPDFKIQACSEKWP 158
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 450 VDQQIYYKSYFLFIFSIEFVGPVVTMTLCYARISRELWFKAVPGFQTEQIRKRlrcRRKTVLVLMCILTAYVLCWAPFYG 529
Cdd:cd15399  159 NGTLNDGTIYSVSMLLIQYVLPLAIISYAYIRIWTKLKNHVSPGGGNDHYHQR---RRKTTKMLVCVVVVFAVSWLPFHA 235
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|.
gi 594684729 530 FTIVRDFFPTVFvKEKHYLTIFYVVECIAMSNSMVNTVCFVTVKNNTIKYF 580
Cdd:cd15399  236 FQLASDIDSKVL-DLKEYKLIYTIFHVIAMCSTFANPLLYGWMNNNYRTAF 285
7tmA_KiSS1R cd15095
KiSS1-derived peptide (kisspeptin) receptor, member of the class A family of ...
290-580 6.48e-41

KiSS1-derived peptide (kisspeptin) receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; The G protein-coupled KiSS1-derived peptide receptor (GPR54 or kisspeptin receptor) binds the peptide hormone kisspeptin (previously known as metastin), which encoded by the metastasis suppressor gene (KISS1) expressed in various endocrine and reproductive tissues. The KiSS1 receptor is coupled to G proteins of the G(q/11) family, which lead to activation of phospholipase C and increase of intracellular calcium. This signaling cascade plays an important role in reproduction by regulating the secretion of gonadotropin-releasing hormone.


Pssm-ID: 320223 [Multi-domain]  Cd Length: 288  Bit Score: 150.13  E-value: 6.48e-41
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 290 IVIGLALVGIMLVCGIGNFIFIAALARYKKLRNLTNLLIANLAISDFLVAVVCCPFEMDYYVVrqLSWEHGHVLCASVNY 369
Cdd:cd15095    1 WLVPLIFAIIFLVGLAGNSLVIYVVSRHREMRTVTNYYIVNLAVTDLAFLVCCVPFTAALYAT--PSWVFGDFMCKFVNY 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 370 LRTVSLYVSTNALLAIAIDRYLAIVHPLRpRMKYQT---ATGLIALVWMVSILIAIPSAYFTteTVLIIVKSQEKIFCGQ 446
Cdd:cd15095   79 MMQVTVQATCLTLTALSVDRYYAIVHPIR-SLRFRTprvAVVVSACIWIVSFLLSIPVAIYY--RLEEGYWYGPQTYCRE 155
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 447 IWPVDQqiYYKSYFLFIFSIEFVGPVVTMTLCYARISRELWFKAVPGFQTEQI--RKRLRCRRKTVLVLMCILTAYVLCW 524
Cdd:cd15095  156 VWPSKA--FQKAYMIYTVLLTYVIPLAIIAVCYGLILRRLWRRSVDGNNQSEQlsERALRQKRKVTRMVIVVVVLFAICW 233
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|....*...
gi 594684729 525 APFYGFTIVRDFFPTvfvKEKHYLTIFYVVECIAMS--NSMVNTVCFVTVKNNTIKYF 580
Cdd:cd15095  234 LPNHVLNLWQRFDPN---FPETYATYALKIAALCLSyaNSAVNPFVYAFMGENFRKYF 288
7tmA_GPRnna14-like cd15001
GPRnna14 and related proteins, member of the class A family of seven-transmembrane G ...
299-569 1.89e-40

GPRnna14 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes the orphan G-protein coupled receptor GPRnna14 found in body louse (Pediculus humanus humanus) as well as its closely related proteins of unknown function. These receptors are members of the class A rhodopsin-like G-protein coupled receptors. As an obligatory parasite of humans, the body louse is an important vector for human diseases, including epidemic typhus, relapsing fever, and trench fever. GPRnna14 shares significant sequence similarity with the members of the neurotensin receptor family. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320132 [Multi-domain]  Cd Length: 266  Bit Score: 148.19  E-value: 1.89e-40
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 299 IMLVCGIGNFIFIAALARYKKLRNLTNLLIANLAISDFLVAVVCCPFEMDYYVVrqLSWEHGHVLCASVNYLRTVSLYVS 378
Cdd:cd15001    9 TFVLGLIGNSLVIFVVARFRRMRSVTNVFLASLATADLLLLVFCVPLKTAEYFS--PTWSLGAFLCKAVAYLQLLSFICS 86
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 379 TNALLAIAIDRYLAIVHPlrprMKYQTATGL------IALVWMVSILIAIPSAYFTTETVLIIVKSQEKIFCGQIWPvdQ 452
Cdd:cd15001   87 VLTLTAISIERYYVILHP----MKAKSFCTIgrarkvALLIWILSAILASPVLFGQGLVRYESENGVTVYHCQKAWP--S 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 453 QIYYKSYFLFIFSIEFVGPVVTMTLCYARISrelwfkavpgfqteqirkrlrcRRKTVLVLMCILTAYVLCWAPF--YGF 530
Cdd:cd15001  161 TLYSRLYVVYLAIVIFFIPLIVMTFAYARDT----------------------RKQVIKMLISVVVLFAVCWGPLliDNL 218
                        250       260       270
                 ....*....|....*....|....*....|....*....
gi 594684729 531 TIVRDFFPTVFVKEKHYLTIFYvvECIAMSNSMVNTVCF 569
Cdd:cd15001  219 LVSFDVISTLHTQALKYMRIAF--HLLSYANSCINPIIY 255
7tmA_Opioid_R-like cd14970
opioid receptors and related proteins, member of the class A family of seven-transmembrane G ...
291-582 2.43e-40

opioid receptors and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes opioid receptors, somatostatin receptors, melanin-concentrating hormone receptors (MCHRs), and neuropeptides B/W receptors. Together they constitute the opioid receptor-like family, members of the class A G-protein coupled receptors. Opioid receptors are coupled to inhibitory G proteins of the G(i/o) family and are involved in regulating a variety of physiological functions such as pain, addiction, mood, stress, epileptic seizure, and obesity, among many others. G protein-coupled somatostatin receptors (SSTRs), which display strong sequence similarity with opioid receptors, binds somatostatin (somatotropin release inhibiting factor), a polypeptide hormone that regulates a wide variety of physiological functions such as neurotransmission, cell proliferation, contractility of smooth muscle cells, and endocrine signaling as well as inhibition of the release of many secondary hormones. MCHR binds melanin concentrating hormone and is presumably involved in the neuronal regulation of food intake. Despite strong homology with somatostatin receptors, MCHR does not appear to bind somatostatin. Neuropeptides B/W receptors are primarily expressed in the CNS and stimulate the cortisol secretion by activating the adenylate cyclase- and the phospholipase C-dependent signaling pathways.


Pssm-ID: 320101 [Multi-domain]  Cd Length: 282  Bit Score: 148.21  E-value: 2.43e-40
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 291 VIGLALVGIMLVCG-IGNFIFIAALARYKKLRNLTNLLIANLAISDFLVAVVCcPFEMDYYVVRqlSWEHGHVLCASVNY 369
Cdd:cd14970    1 IVIPAVYSVVCVVGlTGNSLVIYVILRYSKMKTVTNIYILNLAVADELFLLGL-PFLATSYLLG--YWPFGEVMCKIVLS 77
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 370 LRTVSLYVSTNALLAIAIDRYLAIVHPLRpRMKYQT---ATGLIALVWMVSILIAIPSAYFTTetvlIIVKSQEKIFCGQ 446
Cdd:cd14970   78 VDAYNMFTSIFCLTVMSVDRYLAVVHPVK-SLRFRTprkAKLVSLCVWALSLVLGLPVIIFAR----TLQEEGGTISCNL 152
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 447 IWPVDQQIYYKSYFLFIFSIEFVGPVVTMTLCYARISRELwfKAV-PGFQTEQIRKRLRCRRKTVLVLMcILTAYVLCWA 525
Cdd:cd14970  153 QWPDPPDYWGRVFTIYTFVLGFAVPLLVITVCYSLIIRRL--RSSrNLSTSGAREKRRARRKVTRLVLV-VVAVFVVCWL 229
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 526 PFYGFTIVR---DFFPTVFVkekhyLTIFYVVECIAMSNSMVNTVCFVTVKNNtikyFKK 582
Cdd:cd14970  230 PFHVFQIVRlliDPPETLTV-----VGVFLFCIALSYANSCLNPILYAFLDEN----FRK 280
7tmA_NPR-like_invertebrate cd15391
invertebrate neuropeptide receptor-like, member of the class A family of seven-transmembrane G ...
306-569 4.47e-40

invertebrate neuropeptide receptor-like, member of the class A family of seven-transmembrane G protein-coupled receptors; This subgroup includes putative neuropeptide receptor found in invertebrates, which is a member of class A of 7-transmembrane G protein-coupled receptors. This orphan receptor shares a significant amino acid sequence identity with the neurokinin 1 receptor (NK1R). The endogenous ligand for NK1R is substance P, an 11-amino acid peptide that functions as a vasodilator and neurotransmitter and is released from the autonomic sensory nerve fibers.


Pssm-ID: 320513 [Multi-domain]  Cd Length: 289  Bit Score: 148.05  E-value: 4.47e-40
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 306 GNFIFIAALARYKKLRNLTNLLIANLAISDFLVAVVCCPFEMDYYVVRQlsWEHGHVLCASVNYLRTVSLYVSTNALLAI 385
Cdd:cd15391   17 GNYSVIVVFYDGRRSRTDLNYYLINLAVSDLIMALFCMPFTFTQIMLGH--WVFPAPMCPIVLYVQLVSVTASVLTNTAI 94
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 386 AIDRYLAIVHPLRPRMKYQTATGLIALVWMVSILIAiPSAYFTTETVLIIVKSQEKIFCGQIWPvdQQIYYKS-YFLFIF 464
Cdd:cd15391   95 GIDRFFAVIFPLRSRHTKSRTKCIIASIWAISFSLS-SVQLFAGRTQRYGQYSEGRVLCGESWP--GPDTSRSaYTVFVM 171
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 465 SIEFVGPVVTMTLCYARISRELWFKAVPGFQTEQI-RKRLRCRRKTVLVLMCILTAYVLCWAPFYGFTIVRDfFPTVFVK 543
Cdd:cd15391  172 LLTYIIPLLILTSTYGYVGFRLWNRTAPGNADKGRdDMQIKSKRKVIKMLVFVVLMFGICWLPLHLFNLVQD-FSTVFRN 250
                        250       260
                 ....*....|....*....|....*...
gi 594684729 544 EKHYLT--IFYVVECIAMSNSMVNTVCF 569
Cdd:cd15391  251 MPQHTTrlIYGACHWIAMSNSFVNPIIY 278
7tmA_OXR cd15208
orexin receptors, member of the class A family of seven-transmembrane G protein-coupled ...
290-537 4.63e-40

orexin receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Orexins (OXs, also referred to as hypocretins) are neuropeptide hormones that regulate the sleep-wake cycle and potently influence homeostatic systems regulating appetite and feeding behavior or modulating emotional responses such as anxiety or panic. OXs are synthesized as prepro-orexin (PPO) in the hypothalamus and then proteolytically cleaved into two forms of isoforms: orexin-A (OX-A) and orexin-B (OX-B). OXA is a 33 amino-acid peptide with N-terminal pyroglutamyl residue and two intramolecular disulfide bonds, whereas OXB is a 28 amino-acid linear peptide with no disulfide bonds. OX-A binds orexin receptor 1 (OX1R) with high-affinity, but also binds with somewhat low-affinity to OX2R, and signals primarily to Gq coupling, whereas OX-B shows a strong preference for the orexin receptor 2 (OX2R) and signals through Gq or Gi/o coupling. Thus, activation of OX1R or OX2R will activate phospholipase activity and the phosphatidylinositol and calcium signaling pathways. Additionally, OX2R activation can also lead to inhibition of adenylate cyclase.


Pssm-ID: 320336 [Multi-domain]  Cd Length: 303  Bit Score: 148.31  E-value: 4.63e-40
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 290 IVIGLALVGIMLVCgignfifiAALARYKKLRNLTNLLIANLAISDFLVAVVCCPFEMDYYVVRqlSWEHGHVLCASVNY 369
Cdd:cd15208    9 LVFIVGLVGNVLVC--------FAVWRNHHMRTVTNYFIVNLSLADFLVIIICLPATLLVDVTE--TWFFGQVLCKIIPY 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 370 LRTVSLYVSTNALLAIAIDRYLAIVHPLRPRMKYQTATGLIALVWMVSILIAIPSAYF--TTETVLIIVKSQEKIFCGQI 447
Cdd:cd15208   79 LQTVSVSVSVLTLSCIALDRWYAICHPLMFKSTAKRARVSILIIWIVSLLIMIPQAIVmeCSRVVPLANKTILLTVCDER 158
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 448 WPvdQQIYYKSYFLFIFSIEFVGPVVTMTLCYARISRELWFKAVPGFQTEQIR--------------KRLRCRRKTVLVL 513
Cdd:cd15208  159 WS--DSIYQKVYHICFFLVTYLLPLCLMILAYFQIFRKLWCRQIPGTSSVVQRkwnkprksavaaeeKQLRSRRKTAKML 236
                        250       260
                 ....*....|....*....|....
gi 594684729 514 MCILTAYVLCWAPFYGFTIVRDFF 537
Cdd:cd15208  237 IVVVIMFAICYLPVHLLNILRYVF 260
7tmA_QRFPR cd15205
pyroglutamylated RFamide peptide receptor, member of the class A family of seven-transmembrane ...
299-582 7.33e-40

pyroglutamylated RFamide peptide receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; 26RFa, also known as QRFP (Pyroglutamylated RFamide peptide), is a 26-amino acid residue peptide that belongs to a family of neuropeptides containing an Arg-Phe-NH2 (RFamide) motif at its C-terminus. 26Rfa/QRFP exerts similar orexigenic activity including the regulation of feeding behavior in mammals. It is the ligand for G-protein coupled receptor 103 (GPR103), which is predominantly expressed in paraventricular (PVN) and ventromedial (VMH) nuclei of the hypothalamus. GPR103 shares significant protein sequence homology with orexin receptors (OX1R and OX2R), which have recently shown to produce a neuroprotective effect in Alzheimer's disease by forming a functional heterodimer with GPR103.


Pssm-ID: 320333 [Multi-domain]  Cd Length: 298  Bit Score: 147.62  E-value: 7.33e-40
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 299 IMLVCGIGNFIFIAALARYKKLRNLTNLLIANLAISDFLVAVVCCPFEMDYYVVRQlsWEHGHVLCASVNYLRTVSLYVS 378
Cdd:cd15205   10 IFVLALFGNSLVIYVVTRKRAMRTATNIFICSLALSDLLITFFCIPFTLLQNISSN--WLGGAFMCKMVPFVQSTAVVTS 87
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 379 TNALLAIAIDRYLAIVHPLRPRMKY--QTATGLIALVWMVSILIAIPSAYF-TTETVLIIVKSQEKIFCGQIWpvDQQIY 455
Cdd:cd15205   88 ILTMTCIAVERHQGIVHPLKMKWQYtnRRAFTMLGLVWIVSVIVGSPMLFVqQLEVKYDFLYEKRHVCCLERW--YSPTQ 165
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 456 YKSYFLFIFSIEFVGPVVTMTLCYARISRELWFK----------AVPGFQTEQIrkrLRCRRKTVLVLMCILTAYVLCWA 525
Cdd:cd15205  166 QKIYTTFILVILFLLPLTTMLFLYSRIGYELWIKkrvgdasvlqTIHGIEMSKI---SRKKKRAVKMMVTVVLLFAVCWA 242
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|....*...
gi 594684729 526 PFYGFTIVRDF-FPTVFVKEKHYLTIFYVVECIAMSNSMVNTVCFVTVKNNtikyFKK 582
Cdd:cd15205  243 PFHVVHMMIEYsNLENKYDGVTIKLIFAIVQLIGFSNSFNNPIVYAFMNEN----FKK 296
7tmA_Galanin_R-like cd14971
galanin receptor and related proteins, member of the class A family of seven-transmembrane G ...
299-580 3.75e-38

galanin receptor and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This subfamily includes G-protein coupled galanin receptors, kisspeptin receptor and allatostatin-A receptor (AstA-R) in insects. These receptors, which are members of the class A of seven transmembrane GPCRs, share a high degree of sequence homology among themselves. The galanin receptors bind galanin, a neuropeptide that is widely expressed in the brain, peripheral tissues, and endocrine glands. Galanin is implicated in numerous neurological and psychiatric diseases including Alzheimer's disease, eating disorders, and epilepsy, among many others. KiSS1-derived peptide receptor (also known as GPR54 or kisspeptin receptor) binds the peptide hormone kisspeptin (metastin), which encoded by the metastasis suppressor gene (KISS1) expressed in various endocrine and reproductive tissues. AstA-R is a G-protein coupled receptor that binds allatostatin A. Three distinct types of allatostatin have been identified in the insects and crustaceans: AstA, AstB, and AstC. They both inhibit the biosynthesis of juvenile hormone and exert an inhibitory influence on food intake. Therefore, allatostatins are considered as potential targets for insect control.


Pssm-ID: 320102 [Multi-domain]  Cd Length: 281  Bit Score: 142.22  E-value: 3.75e-38
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 299 IMLVCGIGNFIFIAALARYKKLRNLTNLLIANLAISDFLVAVVCCPFEMDYYVVRqlSWEHGHVLCASVNYLRTVSLYVS 378
Cdd:cd14971   10 IFLLGLVGNSLVILVVARNKPMRSTTNLFILNLAVADLTFLLFCVPFTATIYPLP--GWVFGDFMCKFVHYFQQVSMHAS 87
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 379 TNALLAIAIDRYLAIVHPLRPRMKY--QTATGLIALVWMVSILIAIPSAYFTTETVliiVKSQEKIFCGQIWPvdQQIYY 456
Cdd:cd14971   88 IFTLVAMSLDRFLAVVYPLRSLHIRtpRNALAASGCIWVVSLAVAAPVLALHRLRN---YTPGNRTVCSEAWP--SRAHR 162
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 457 KSYFLFIFSIEFVGPVVTMTLCYARISRELWFKAVPGFQTEQIRkrlRCRRKTVLVLMCILTAYVLCWAPFYGFTIVRDF 536
Cdd:cd14971  163 RAFALCTFLFGYLLPLLLICVCYAAMLRHLWRVAVRPVLSEGSR---RAKRKVTRLVLVVVVLFAACWGPIHAILLLVAL 239
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....
gi 594684729 537 FPTVFVKEKHYLTIFyvVECIAMSNSMVNTVCFVTVKNNTIKYF 580
Cdd:cd14971  240 GPFPLTYATYALRIW--AHCLAYSNSAVNPVLYAFLSEHFRKAF 281
7tmA_Vasopressin-like cd14986
vasopressin receptors and its related G protein-coupled receptors, member of the class A ...
291-569 8.57e-38

vasopressin receptors and its related G protein-coupled receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Members of this group form a subfamily within the class A G-protein coupled receptors (GPCRs), which includes the vasopressin and oxytocin receptors, the gonadotropin-releasing hormone receptors (GnRHRs), the neuropeptide S receptor (NPSR), and orphan GPR150. These receptors share significant sequence homology with each other, suggesting that they have a common evolutionary origin. Vasopressin, also known as arginine vasopressin or anti-diuretic hormone, is a neuropeptide synthesized in the hypothalamus. The actions of vasopressin are mediated by the interaction of this hormone with three tissue-specific subtypes: V1AR, V1BR, and V2R. Although vasopressin differs from oxytocin by only two amino acids, they have divergent physiological functions. Vasopressin is involved in regulating osmotic and cardiovascular homeostasis, whereas oxytocin plays an important role in the uterus during childbirth and in lactation. GnRHR, also known as luteinizing hormone releasing hormone receptor (LHRHR), plays an central role in vertebrate reproductive function; its activation by binding to GnRH leads to the release of follicle stimulating hormone (FSH) and luteinizing hormone (LH) from the pituitary gland. Neuropeptide S (NPS) promotes arousal and anxiolytic-like effects by activating its cognate receptor NPSR. NPSR has also been associated with asthma and allergy. GPR150 is an orphan receptor closely related to the oxytocin and vasopressin receptors.


Pssm-ID: 320117 [Multi-domain]  Cd Length: 295  Bit Score: 141.74  E-value: 8.57e-38
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 291 VIGLALVGIMLVCGI-GNFIFIAALARYKKLRNLTNLLIANLAISDFLVAVVCcpfemdyyVVRQLSWEH------GHVL 363
Cdd:cd14986    1 VSRVAVLGVLFVFTLvGNGLVILVLRRKRKKRSRVNIFILNLAIADLVVAFFT--------VLTQIIWEAtgewvaGDVL 72
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 364 CASVNYLRTVSLYVSTNALLAIAIDRYLAIVHPLRPRMKYQTATGLIALVWMVSILIAIPSAY-FTTETVLIIVKSqeki 442
Cdd:cd14986   73 CRIVKYLQVVGLFASTYILVSMSLDRYQAIVKPMSSLKPRKRARLMIVVAWVLSFLFSIPQLViFVERELGDGVHQ---- 148
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 443 fCGQIWPvdQQIYYKSYFLFIFSIEFVGPVVTMTLCYARISRELW-----FKAVPGFQTEQIRKRLRCRR---------- 507
Cdd:cd14986  149 -CWSSFY--TPWQRKVYITWLATYVFVIPLIILSYCYGRILRTIWirsrqKTDRPIAPTAMSCRSVSCVSsrvslisrak 225
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 594684729 508 -KTVLVLMCILTAYVLCWAPFYGFTIVRDFFPTVFVKEkhylTIFYVVECIAMSNSMVNTVCF 569
Cdd:cd14986  226 iKTIKMTLVIILAFILCWTPYFIVQLLDVYAGMQQLEN----DAYVVSETLASLNSALNPLIY 284
7tmA_Gal1_R cd15098
galanin receptor subtype 1, member of the class A family of seven-transmembrane G ...
291-582 4.68e-37

galanin receptor subtype 1, member of the class A family of seven-transmembrane G protein-coupled receptors; The G protein-coupled galanin receptors bind galanin, a neuropeptide that is widely expressed in the brain, peripheral tissues, and endocrine glands. Three receptors subtypes have been so far identified: GAL1, GAL2, and GAL3. The specific functions of each subtype remains mostly unknown, although galanin is thought to be involved in a variety of neuronal functions such as hormone release and food intake. Galanin is implicated in numerous neurological and psychiatric diseases including Alzheimer's disease, depression, eating disorders, epilepsy and stroke, among many others.


Pssm-ID: 320226 [Multi-domain]  Cd Length: 282  Bit Score: 139.09  E-value: 4.68e-37
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 291 VIGLALVGIMLVCGI-GNFIFIAALARYKKL--RNLTNLLIANLAISDFLVAVVCCPFEMDYYVVRqlSWEHGHVLCASV 367
Cdd:cd15098    1 VIVPVVFGLIFCLGVlGNSLVITVLARVKPGkrRSTTNVFILNLSIADLFFLLFCVPFQATIYSLP--EWVFGAFMCKFV 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 368 NYLRTVSLYVSTNALLAIAIDRYLAIVHPLRPR--MKYQTATGLIALVWMVSILIAIPSAYftTETVLIIVKSQEKIFCG 445
Cdd:cd15098   79 HYFFTVSMLVSIFTLVAMSVDRYIAVVHSRTSSslRTRRNALLGVLVIWVLSLAMASPVAV--HQDLVHHWTASNQTFCW 156
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 446 QIWPVDQQiyYKSYFLFIFSIEFVGPVVTMTLCYARISRELWFKAvpgfqTEQIRKRLRCRRKTVLVLMCILTAYVLCWA 525
Cdd:cd15098  157 ENWPEKQQ--KPVYVVCTFVFGYLLPLLLITFCYAKVLNHLHKKL-----KNMSKKSERSKKKTAQTVLVVVVVFGISWL 229
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|....*....
gi 594684729 526 PFYGFTIVRDF--FPtvFVKEKHYLTIFyvVECIAMSNSMVNTVCFVTVKNNtikyFKK 582
Cdd:cd15098  230 PHHIIHLWVEFgdFP--LTQASFVLRIT--AHCLAYANSCVNPIIYAFLSEN----FRK 280
7tmA_NKR_NK3R cd16003
neuromedin-K receptor, member of the class A family of seven-transmembrane G protein-coupled ...
294-569 1.42e-36

neuromedin-K receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; The neuromedin-K receptor (NKR), also known as tachykinin receptor 3 (TACR3) or neurokinin B receptor or NK3R, is a G-protein coupled receptor that specifically binds to neurokinin B. The tachykinins (TKs) act as excitatory transmitters on neurons and cells in the gastrointestinal tract. The TKs are characterized by a common five-amino acid C-terminal sequence, Phe-X-Gly-Leu-Met-NH2, where X is a hydrophobic residue. The three major mammalian tachykinins are substance P (SP), neurokinin A (NKA), and neurokinin B (NKB). The physiological actions of tachykinins are mediated through three types of receptors: neurokinin receptor type 1 (NK1R), NK2R, and NK3R. NK3R is activated by its high-affinity ligand, NKB, which is primarily involved in the central nervous system and plays a critical role in the regulation of gonadotropin hormone release and the onset of puberty.


Pssm-ID: 320669 [Multi-domain]  Cd Length: 282  Bit Score: 138.14  E-value: 1.42e-36
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 294 LALVGIMLVCGIGNFIFIAALARYKKLRNLTNLLIANLAISDFLVAVVCCPFEMDYYVVRQlsWEHGHVLCASVNYLRTV 373
Cdd:cd16003    5 LAYGFVVAVAVFGNLIVIWIILAHKRMRTVTNYFLVNLAFSDASMAAFNTLINFIYALHSE--WYFGEAYCRFHNFFPIT 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 374 SLYVSTNALLAIAIDRYLAIVHPLRPRMKYQTATGLIALVWMVSILIAIPSAYFTTETVLiivksQEKIFCGQIWPVDQQ 453
Cdd:cd16003   83 SVFASIYSMTAIAVDRYMAIIDPLKPRLSATATKVVIGSIWILAFLLAFPQCLYSKTKVM-----PGRTLCFVAWPGGPD 157
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 454 IYYKSYFLFIFSIeFVGPVVTMTLCYARISRELWFKAVPGFQTEQIRKRLRCRRKTVLVLMCILTAYVLCWAPFYGFTIV 533
Cdd:cd16003  158 QHFTYHIIVIVLV-YCLPLLVMGITYTIVGITLWGGEIPGDTSDKYHEQLRAKRKVVKMMIIVVLTFAICWLPYHIYFIV 236
                        250       260       270
                 ....*....|....*....|....*....|....*.
gi 594684729 534 RDFFPTVfVKEKHYLTIFYVVECIAMSNSMVNTVCF 569
Cdd:cd16003  237 TGLYQQL-NRWKYIQQVYLASFWLAMSSTMYNPIIY 271
7tmA_CCK_R cd15206
cholecystokinin receptors, member of the class A family of seven-transmembrane G ...
299-569 5.42e-35

cholecystokinin receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Cholecystokinin receptors (CCK-AR and CCK-BR) are a group of G-protein coupled receptors which bind the peptide hormones cholecystokinin (CCK) or gastrin. CCK, which facilitates digestion in the small intestine, and gastrin, a major regulator of gastric acid secretion, are highly similar peptides. Like gastrin, CCK is a naturally-occurring linear peptide that is synthesized as a preprohormone, then proteolytically cleaved to form a family of peptides with the common C-terminal sequence (Gly-Trp-Met-Asp-Phe-NH2), which is required for full biological activity. CCK-AR (type A, alimentary; also known as CCK1R) is found abundantly on pancreatic acinar cells and binds only sulfated CCK-peptides with very high affinity, whereas CCK-BR (type B, brain; also known as CCK2R), the predominant form in the brain and stomach, binds CCK or gastrin and discriminates poorly between sulfated and non-sulfated peptides. CCK is implicated in regulation of digestion, appetite control, and body weight, and is involved in neurogenesis via CCK-AR. There is some evidence to support that CCK and gastrin, via their receptors, are involved in promoting cancer development and progression, acting as growth and invasion factors.


Pssm-ID: 320334 [Multi-domain]  Cd Length: 269  Bit Score: 133.28  E-value: 5.42e-35
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 299 IMLVCGIGNFIFIAALARYKKLRNLTNLLIANLAISDFLVAVVCCPFEMDYYVVRQLSWehGHVLCASVNYLRTVSLYVS 378
Cdd:cd15206   10 IFLLAVVGNILVIVTLVQNKRMRTVTNVFLLNLAVSDLLLAVFCMPFTLVGQLLRNFIF--GEVMCKLIPYFQAVSVSVS 87
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 379 TNALLAIAIDRYLAIVHPLRPRmKYQT---ATGLIALVWMVSILIAIPSAYFTTetvLIIVKSQEKIFCGQIWPvdQQIY 455
Cdd:cd15206   88 TFTLVAISLERYFAICHPLKSR-VWQTlshAYKVIAGIWLLSFLIMSPILVFSN---LIPMSRPGGHKCREVWP--NEIA 161
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 456 YKSYFLFIFSIEFVGPVVTMTLCYARISRELWfkavpgfqteqirkrlRCRRKTVLVLMCILTAYVLCWAPFYGFTIVRD 535
Cdd:cd15206  162 EQAWYVFLDLMLLVIPGLVMSVAYGLISWTLL----------------EAKKRVIRMLFVIVVEFFICWTPLYVINTWKA 225
                        250       260       270
                 ....*....|....*....|....*....|....*.
gi 594684729 536 FFPTVFVKEKHYLTIfYVVECIAMSNSMVN--TVCF 569
Cdd:cd15206  226 FDPPSAARYVSSTTI-SLIQLLAYISSCVNpiTYCF 260
7tmA_NPY4R cd15397
neuropeptide Y receptor type 4, member of the class A family of seven-transmembrane G ...
299-582 7.48e-35

neuropeptide Y receptor type 4, member of the class A family of seven-transmembrane G protein-coupled receptors; NPY is a 36-amino acid peptide neurotransmitter with a C-terminal tyrosine amide residue that is widely distributed in the brain and the autonomic nervous system of many mammalian species. NPY exerts its functions through five, G-protein coupled receptor subtypes including NPY1R, NPY2R, NPY4R, NPY5R, and NPY6R; however, NPY6R is not functional in humans. NYP receptors are also activated by its two other family members, peptide YY (PYY) and pancreatic polypeptide (PP). They typically couple to G(i) or G(o) proteins, which leads to a decrease in adenylate cyclase activity, thereby decreasing intracellular cAMP levels, and are involved in diverse physiological roles including appetite regulation, circadian rhythm, and anxiety.


Pssm-ID: 320519  Cd Length: 293  Bit Score: 133.33  E-value: 7.48e-35
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 299 IMLVCG-IGNFIFIAALARYKKLRNLTNLLIANLAISDFLVAVVCCPFE-----MDYyvvrqlsWEHGHVLCASVNYLRT 372
Cdd:cd15397    9 LVMAVGlLGNICLICVIARQKEKTNVTNILIANLSFSDILVCLVCLPFTvvytlMDY-------WIFGEVLCKMTPFIQC 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 373 VSLYVSTNALLAIAIDRYLAIVHPLRPRMKYQTATGLIALVWMVSILIAIPSAYFTTET-------VLIIVKSQEKIFCG 445
Cdd:cd15397   82 MSVTVSILSLVLIALERHQLIINPTGWKPSVSQAYLAVVVIWMLACFISLPFLAFHILTdepyknlSHFFAPLADKAVCT 161
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 446 QIWPVDQQ--IYYKSYFLFIFSIefvgPVVTMTLCYARISRELWFKAVPGFQTEQIRKRLRCRRKTVLVLMCILTAYVLC 523
Cdd:cd15397  162 ESWPSEHHklAYTTWLLLFQYCL----PLLFILVCYLRIYLRLRRRKDMLERRGEYNRRAGHSKRINVMLVSLVAAFALC 237
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|....*....
gi 594684729 524 WAPFYGFTIVRDFFPTVFVKEKHYLtIFYVVECIAMSNSMVNTVCFVTVKNNtikyFKK 582
Cdd:cd15397  238 WLPLNVFNAIADWNHEAIPHCQHNL-IFSLCHLAAMASTCVNPIIYGFLNSN----FKK 291
7tmA_Bombesin_R-like cd15927
bombesin receptor subfamily, member of the class A family of seven-transmembrane G ...
299-567 8.17e-35

bombesin receptor subfamily, member of the class A family of seven-transmembrane G protein-coupled receptors; This bombesin subfamily of G-protein coupled receptors consists of neuromedin B receptor (NMBR), gastrin-releasing peptide receptor (GRPR), and bombesin receptor subtype 3 (BRS-3). Bombesin is a tetradecapeptide, originally isolated from frog skin. Mammalian bombesin-related peptides are widely distributed in the gastrointestinal and central nervous systems. The bombesin family receptors couple mainly to the G proteins of G(q/11) family. NMBR functions as the receptor for the neuropeptide neuromedin B, a potent mitogen and growth factor for normal and cancerous lung and for gastrointestinal epithelial tissues. Gastrin-releasing peptide is an endogenous ligand for GRPR and shares high sequence homology with NMB in the C-terminal region. Both NMB and GRP possess bombesin-like biochemical properties. BRS-3 is classified as an orphan receptor and suggested to play a role in sperm cell division and maturation. BRS-3 interacts with known naturally-occurring bombesin-related peptides with low affinity; however, no endogenous high-affinity ligand to the receptor has been identified. The bombesin receptor family belongs to the seven transmembrane rhodopsin-like G-protein coupled receptors (class A GPCRs), which perceive extracellular signals and transduce them to guanine nucleotide-binding (G) proteins.


Pssm-ID: 320593 [Multi-domain]  Cd Length: 294  Bit Score: 133.16  E-value: 8.17e-35
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 299 IMLVCGIGNFIFIAALARYKKLRNLTNLLIANLAISDFLVAVVCCPFEMDYYVVRqlSWEHGHVLCASVNYLRTVSLYVS 378
Cdd:cd15927   10 IFLVGVLGNGTLILIFLRNKSMRNVPNIFILSLALGDLLLLLTCVPFTSTIYTLD--SWPFGEFLCKLSEFLKDTSIGVS 87
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 379 TNALLAIAIDRYLAIVHPLrpRMKYQTATGLIAL----VWMVSILIAIPSAYFTTETVLIIVKSQEKIFCgQIWPVDQQI 454
Cdd:cd15927   88 VFTLTALSADRYFAIVNPM--RKHRSQATRRTLVtaasIWIVSILLAIPEAIFSHVVTFTLTDNQTIQIC-YPYPQELGP 164
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 455 YY-KSYFLFIFSIEFVGPVVTMTLCYARISRELW--FKAVPGFQTEQIRKRLRCRRK---TVLVLMCIltaYVLCWAPFY 528
Cdd:cd15927  165 NYpKIMVLLRFLVYYLIPLLIIGVFYVLMARHLIrsTRNIGSGQNQAAQRQIEARKKvakTVLAFVVL---FAVCWLPRH 241
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|..
gi 594684729 529 GFTIVRDFFPTVFVKEK---HYLTIfyVVECIAMSNSMVNTV 567
Cdd:cd15927  242 VFMLWFHFAPNGLVDYNafwHVLKI--VGFCLSFINSCVNPV 281
7tmA_AstA_R_insect cd15096
allatostatin-A receptor in insects, member of the class A family of seven-transmembrane G ...
291-565 2.36e-33

allatostatin-A receptor in insects, member of the class A family of seven-transmembrane G protein-coupled receptors; The G protein-coupled AstA receptor binds allatostatin A. Three distinct types of allatostatin have been identified in the insects and crustaceans: AstA, AstB, and AstC. They both inhibit the biosynthesis of juvenile hormone and exert an inhibitory influence on food intake. Therefore, allatostatins are considered as potential targets for insect control.


Pssm-ID: 320224 [Multi-domain]  Cd Length: 284  Bit Score: 128.95  E-value: 2.36e-33
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 291 VIGLALVGIMLVCG-IGN-FIFIAALARyKKLRNLTNLLIANLAISDFLVAVVCCPFEMDYYVVRQlsWEHGHVLCASVN 368
Cdd:cd15096    1 IVVPVIFGLIFIVGlIGNsLVILVVLSN-QQMRSTTNILILNLAVADLLFVVFCVPFTATDYVLPT--WPFGDVWCKIVQ 77
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 369 YLRTVSLYVSTNALLAIAIDRYLAIVHPLRPRM--KYQTATGLIALVWMVSILIAIPSAyFTTETVLIIVKSQEKIFCGQ 446
Cdd:cd15096   78 YLVYVTAYASVYTLVLMSLDRYLAVVHPITSMSirTERNTLIAIVGIWIVILVANIPVL-FLHGVVSYGFSSEAYSYCTF 156
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 447 IWPVDQ--QIYYKSYFLFIFSIefvgPVVTMTLCYARISRELWFKAVPGFQ--TEQIRKRlrcRRKTVLVLmCILTAYVL 522
Cdd:cd15096  157 LTEVGTaaQTFFTSFFLFSYLI----PLTLICVLYMLMLRRLRRQKSPGGRrsAESQRGK---RRVTRLVV-VVVVVFAI 228
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*...
gi 594684729 523 CWAPfygftIVRDFFPTVFVKEKHylTIFYVV-----ECIAMSNSMVN 565
Cdd:cd15096  229 CWLP-----IHIILLLKYYGVLPE--TVLYVViqilsNCLAYGNSCVN 269
7tmA_SKR_NK2R cd16004
substance-K receptor, member of the class A family of seven-transmembrane G protein-coupled ...
299-569 9.52e-33

substance-K receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; The substance-K receptor (SKR), also known as tachykinin receptor 2 (TACR2) or neurokinin A receptor or NK2R, is a G-protein coupled receptor that specifically binds to neurokinin A. The tachykinins are widely distributed throughout the mammalian central and peripheral nervous systems and act as excitatory transmitters on neurons and cells in the gastrointestinal tract. The TKs are characterized by a common five-amino acid C-terminal sequence, Phe-X-Gly-Leu-Met-NH2, where X is a hydrophobic residue. The three major mammalian tachykinins are substance P (SP), neurokinin A (NKA), and neurokinin B (NKB). The physiological actions of tachykinins are mediated through three types of receptors: neurokinin receptor type 1 (NK1R), NK2R, and NK3R. SP is a high-affinity endogenous ligand for NK1R, which interacts with the Gq protein and activates phospholipase C, leading to elevation of intracellular calcium. NK2R is a high-affinity receptor for NKA, the tachykinin neuropeptide substance K. SP and NKA are found in the enteric nervous system and mediate the regulation of gastrointestinal motility, secretion, vascular permeability, and pain perception.


Pssm-ID: 320670 [Multi-domain]  Cd Length: 285  Bit Score: 127.27  E-value: 9.52e-33
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 299 IMLVCGIGNFIFIAALARYKKLRNLTNLLIANLAISDFLVAVVCCPFEMDYyvVRQLSWEHGHVLCASVNYLRTVSLYVS 378
Cdd:cd16004   10 IVLVAVTGNATVIWIILAHRRMRTVTNYFIVNLALADLSMAAFNTAFNFVY--ASHNDWYFGLEFCRFQNFFPITAMFVS 87
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 379 TNALLAIAIDRYLAIVHPLRPRMKYQTATGLIALVWMVSILIAIPSAYFTTetvliIVKSQEKIFCGQIWPVDQQIYYK- 457
Cdd:cd16004   88 IYSMTAIAADRYMAIIHPFKPRLSAGSTKVVIAGIWLVALALAFPQCFYST-----VTMDQGRTKCIVAWPGDSGGKHQl 162
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 458 SYFLFIFSIEFVGPVVTMTLCYARISRELWFKAVPGFQ-TEQIRKRLRCRRKTVLVLMCILTAYVLCWAPFYGFTIVRDF 536
Cdd:cd16004  163 TYHLAVIVLIYLLPLAVMFVTYSIIGITLWRSAVPGHQaHGAYHRQLQAKKKFVKTMVVVVVTFAICWLPYHLYFILGSF 242
                        250       260       270
                 ....*....|....*....|....*....|....*.
gi 594684729 537 FPTVFVK---EKHYLTIFYvvecIAMSNSMVNTVCF 569
Cdd:cd16004  243 NEDIYCQkyiQQVYLAIFW----LAMSSTMYNPIIY 274
7tmA_NK1R cd16002
neurokinin 1 receptor, member of the class A family of seven-transmembrane G protein-coupled ...
299-569 1.38e-32

neurokinin 1 receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; The neurokinin 1 receptor (NK1R), also known as tachykinin receptor 1 (TACR1) or substance P receptor (SPR), is a G-protein coupled receptor found in the mammalian central nervous and peripheral nervous systems. The tachykinins act as excitatory transmitters on neurons and cells in the gastrointestinal tract. The TKs are characterized by a common five-amino acid C-terminal sequence, Phe-X-Gly-Leu-Met-NH2, where X is a hydrophobic residue. The three major mammalian tachykinins are substance P (SP), neurokinin A (NKA), and neurokinin B (NKB). The physiological actions of tachykinins are mediated through three types of receptors: neurokinin receptor type 1 (NK1R), NK2R, and NK3R. SP is a high-affinity endogenous ligand for NK1R, which interacts with the Gq protein and activates phospholipase C, leading to elevation of intracellular calcium. SP is an extremely potent vasodilator through endothelium dependent mechanism and is released from the autonomic sensory nerves. NK2R is a high-affinity receptor for NKA, the tachykinin neuropeptide substance K. SP and NKA are found in the enteric nervous system and mediate in the regulation of gastrointestinal motility, secretion, vascular permeability, and pain perception.


Pssm-ID: 320668 [Multi-domain]  Cd Length: 284  Bit Score: 126.90  E-value: 1.38e-32
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 299 IMLVCGIGNFIFIAALARYKKLRNLTNLLIANLAISDFLVAVVCCPFEMDYYVVRQlsWEHGHVLCASVNYLRTVSLYVS 378
Cdd:cd16002   10 IVVVSVVGNIIVMWIILAHKRMRTVTNYFLVNLAFAEASMSAFNTVINFTYAIHNE--WYYGLEYCKFHNFFPIAAVFAS 87
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 379 TNALLAIAIDRYLAIVHPLRPRMKYQTATGLIALVWMVSILIAIPSAYF-TTETVliivksQEKIFCGQIWP-VDQQIYY 456
Cdd:cd16002   88 IYSMTAIALDRYMAIIHPLQPRLSATATKVVICVIWVLAFLLAFPQGYYsDTEEM------PGRVVCYVEWPeHEERKYE 161
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 457 KSYFLFIFSIEFVGPVVTMTLCYARISRELWFKAVPGFQTEQIRKRLRCRRKTVLVLMCILTAYVLCWAPFYGFTIVRDF 536
Cdd:cd16002  162 TVYHVCVTVLIYFLPLLVIGCAYTVVGITLWASEIPGDSSDRYHEQVSAKRKVVKMMIVVVCTFAICWLPYHIYFLLQYF 241
                        250       260       270
                 ....*....|....*....|....*....|...
gi 594684729 537 FPTVFVKeKHYLTIFYVVECIAMSNSMVNTVCF 569
Cdd:cd16002  242 HPELYEQ-KFIQQVYLAIMWLAMSSTMYNPIIY 273
7tmA_Chemokine_R cd14984
classical and atypical chemokine receptors, member of the class A family of ...
302-573 1.56e-31

classical and atypical chemokine receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Chemokines are principal regulators for leukocyte trafficking, recruitment, and activation. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling. Currently, there are ten known receptors for CC chemokines, seven for CXC chemokines, and single receptors for the XC and CX3C chemokines. In addition to these classical chemokine receptors, there exists a subfamily of atypical chemokine receptors (ACKRs) that are unable to couple to G-proteins and, instead, they preferentially mediate beta-arrestin dependent processes, such as receptor internalization, after ligand binding. The classical chemokine receptors contain a conserved DRYLAIV motif in the second intracellular loop, which is required for G-protein coupling. However, the ACKRs lack this conserved motif and fail to couple to G-proteins and induce classical GPCR signaling. Five receptors have been identified for the ACKR family, including CC-chemokine receptors like 1 and 2 (CCRL1 and CCRL2), CXCR7, Duffy antigen receptor for chemokine (DARC), and D6. Both ACKR1 (DARC) and ACKR3 (CXCR7) show low sequence homology to the classic chemokine receptors.


Pssm-ID: 341319 [Multi-domain]  Cd Length: 278  Bit Score: 123.48  E-value: 1.56e-31
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 302 VCG-IGNFIFIAALARYKKLRNLTNLLIANLAISDfLVAVVCCPFEMDYYVVrqlSWEHGHVLCASVNYLRTVSLYVSTN 380
Cdd:cd14984   12 LLGlVGNSLVLLVLLYYRKLRSMTDVYLLNLALAD-LLFVLTLPFWAVYAAD---GWVFGSFLCKLVSALYTINFYSGIL 87
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 381 ALLAIAIDRYLAIVHPL----RPRMKYQTATGLIalVWMVSILIAIPSAYFTTetvliiVKSQEKIF-CGQIWPVDQQIY 455
Cdd:cd14984   88 FLACISIDRYLAIVHAVsalrARTLLHGKLTCLG--VWALALLLSLPEFIFSQ------VSEENGSSiCSYDYPEDTATT 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 456 YKSYFLFI-FSIEFVGPVVTMTLCYARISRELwfkavpgfqteqIRKRLRCRRKTVLVLMCILTAYVLCWAPFYGFTIVR 534
Cdd:cd14984  160 WKTLLRLLqNILGFLLPLLVMLFCYSRIIRTL------------LRARNHKKHRALRVIFAVVVVFFLCWLPYNIVLLLD 227
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*.
gi 594684729 535 DFFPTVFVK-----EKHYLTIFYVVECIAMSNSMVNTV--CFVTVK 573
Cdd:cd14984  228 TLQLLGIISrscelSKSLDYALQVTESLAFSHCCLNPVlyAFVGVK 273
7tmA_SSTR1 cd15970
somatostatin receptor type 1, member of the class A family of seven-transmembrane G ...
290-580 3.39e-31

somatostatin receptor type 1, member of the class A family of seven-transmembrane G protein-coupled receptors; G protein-coupled somatostatin receptors (SSTRs) are composed of five distinct subtypes (SSTR1-5) that display strong sequence similarity with opioid receptors. All five receptor subtypes bind the natural somatostatin (somatotropin release inhibiting factor), a polypeptide hormone that regulates a wide variety of physiological functions such as neurotransmission, cell proliferation, contractility of smooth muscle cells, and endocrine signaling as well as inhibition of the release of many secondary hormones. SSTR1 is coupled to a Na/H exchanger, voltage-dependent calcium channels, and AMPA/kainate glutamate channels. SSTR1 is expressed in the normal human pituitary and in nearly half of all pituitary adenoma subtypes.


Pssm-ID: 320636 [Multi-domain]  Cd Length: 276  Bit Score: 122.71  E-value: 3.39e-31
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 290 IVIGLALVGIMLVCGIGNFIFIAALARYKKLRNLTNLLIANLAISDFLVaVVCCPFEMDYYVVRQlsWEHGHVLCASVNY 369
Cdd:cd15970    1 ILISFIYSVVCLVGLCGNSMVIYVILRYAKMKTATNIYILNLAIADELL-MLSVPFLVTSTLLRH--WPFGSLLCRLVLS 77
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 370 LRTVSLYVSTNALLAIAIDRYLAIVHPLR-PRMKYQTATGLIAL-VWMVSILIAIPSAYFTTETvliiVKSQEKIFCGQI 447
Cdd:cd15970   78 VDAINMFTSIYCLTVLSIDRYIAVVHPIKaARYRRPTVAKMVNLgVWVFSILVILPIIIFSNTA----PNSDGSVACNMQ 153
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 448 WPVDQQIYYKSYFLFIFSIEFVGPVVTMTLCYARISRELWFKAV-PGFQteqirKRLRCRRKTVLVLMCILTAYVLCWAP 526
Cdd:cd15970  154 MPEPSQRWLAVFVVYTFLMGFLLPVIAICLCYILIIVKMRVVALkAGWQ-----QRKRSERKITLMVMMVVTVFVICWMP 228
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|....
gi 594684729 527 FYGFTIVrdffpTVFVkEKHYLTIFYVVECIAMSNSMVNTVCFVTVKNNTIKYF 580
Cdd:cd15970  229 FYVVQLV-----SVFV-GQHDATVSQLSVILGYANSCANPILYGFLSDNFKRSF 276
7tmA_CCK-BR cd15979
cholecystokinin receptor type B, member of the class A family of seven-transmembrane G ...
299-538 2.23e-30

cholecystokinin receptor type B, member of the class A family of seven-transmembrane G protein-coupled receptors; Cholecystokinin receptors (CCK-AR and CCK-BR) are a group of G-protein coupled receptors which bind the peptide hormones cholecystokinin (CCK) or gastrin. CCK, which facilitates digestion in the small intestine, and gastrin, a major regulator of gastric acid secretion, are highly similar peptides. Like gastrin, CCK is a naturally-occurring linear peptide that is synthesized as a preprohormone, then proteolytically cleaved to form a family of peptides with the common C-terminal sequence (Gly-Trp-Met-Asp-Phe-NH2), which is required for full biological activity. CCK-AR (type A, alimentary; also known as CCK1R) is found abundantly on pancreatic acinar cells and binds only sulfated CCK-peptides with very high affinity, whereas CCK-BR (type B, brain; also known as CCK2R), the predominant form in the brain and stomach, binds CCK or gastrin and discriminates poorly between sulfated and non-sulfated peptides. CCK is implicated in regulation of digestion, appetite control, and body weight, and is involved in neurogenesis via CCK-AR. There is some evidence to support that CCK and gastrin, via their receptors, are involved in promoting cancer development and progression, acting as growth and invasion factors.


Pssm-ID: 320645 [Multi-domain]  Cd Length: 275  Bit Score: 120.30  E-value: 2.23e-30
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 299 IMLVCGIGNFIFIAALARYKKLRNLTNLLIANLAISDFLVAVVCCPFEMDYYVVRQLSWehGHVLCASVNYLRTVSLYVS 378
Cdd:cd15979   10 IFLLSVFGNMLIIVVLGLNKRLRTVTNSFLLSLALSDLMLAVFCMPFTLIPNLMGTFIF--GEVICKAVAYLMGVSVSVS 87
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 379 TNALLAIAIDRYLAIVHPLRPRMkYQT---ATGLIALVWMVSILIAIPSAYFTTETVLIIVKSQEKIFCGQIWPVDQqiY 455
Cdd:cd15979   88 TFSLVAIAIERYSAICNPLQSRV-WQTrshAYRVIAATWLLSGLIMIPYPVYSVTVPVPVGDRPRGHQCRHAWPSAQ--V 164
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 456 YKSYFLFIFSIEFVGPVVTMTLCYARISRELWfkavpgfqteqirKRLRCRRKTVLVLMCILTAYVLCWAPFYGFTIVRD 535
Cdd:cd15979  165 RQAWYVLLLLILFFIPGVVMIVAYGLISRELY-------------RGLLAKKRVIRMLVVIVAMFFLCWLPIFSANTWRA 231

                 ...
gi 594684729 536 FFP 538
Cdd:cd15979  232 FDP 234
7tmA_Angiotensin_R-like cd14985
angiotesin receptor family and its related G protein-coupled receptors, member of the class A ...
295-574 7.43e-30

angiotesin receptor family and its related G protein-coupled receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes the angiotensin receptors, the bradykinin receptors, apelin receptor as well as putative G-protein coupled receptors (GPR15 and GPR25). Angiotensin II (Ang II), the main effector in the renin-angiotensin system, plays a crucial role in the regulation of cardiovascular homeostasis through its type 1 (AT1) and type 2 (AT2) receptors. Ang II contributes to cardiovascular diseases such as hypertension and atherosclerosis via AT1R activation. Ang II increases blood pressure through Gq-mediated activation of phospholipase C, resulting in phosphoinositide (PI) hydrolysis and increased intracellular calcium levels. Through the AT2 receptor, Ang II counteracts the vasoconstrictor action of AT1R and thereby induces vasodilation, sodium excretion, and reduction of blood pressure. Bradykinins (BK) are pro-inflammatory peptides that mediate various vascular and pain responses to tissue injury through its B1 and B2 receptors. Apelin (APJ) receptor binds the endogenous peptide ligands, apelin and Toddler/Elabela. APJ is an adipocyte-derived hormone that is ubiquitously expressed throughout the human body, and Toddler/Elabela is a short secretory peptide that is required for normal cardiac development in zebrafish. Activation of APJ receptor plays key roles in diverse physiological processes including vasoconstriction and vasodilation, cardiac muscle contractility, angiogenesis, and regulation of water balance and food intake. Orphan receptors, GPR15 and GPR25, share strong sequence homology to the angiotensin II type AT1 and AT2 receptors.


Pssm-ID: 341320  Cd Length: 284  Bit Score: 119.02  E-value: 7.43e-30
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 295 ALVGIMLVCGI-GNFIFIAALARYKKLRNLTNLLIANLAISDfLVAVVCCPFEMDYYVvRQLSWEHGHVLCASVNYLRTV 373
Cdd:cd14985    5 ALYIAIFLVGLlGNLFVVWVFLFPRGPKRVADIFIANLAAAD-LVFVLTLPLWATYTA-NQYDWPFGAFLCKVSSYVISV 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 374 SLYVSTNALLAIAIDRYLAIVHPL--RPRMKYQTATGLIALVWMVSILIAIPSAYFTTetvLIIVKSQEKIFCGQIWPVD 451
Cdd:cd14985   83 NMFASIFLLTCMSVDRYLAIVHPVasRRLRRRRQARVTCALIWVVACLLSLPTFLLRS---LQAIENLNKTACIMLYPHE 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 452 QQIYYKSYFLFIFSieFVGPVVTMTLCYARISRELWFKavpgfqTEQIRKRLRCRRKTVLVLMCILTAYVLCWAPFYGFT 531
Cdd:cd14985  160 AWHFGLSLELNILG--FVLPLLIILTCYFHIARSLRKR------YERTGKNGRKRRKSLKIIFALVVAFLVCWLPFHFFK 231
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|..
gi 594684729 532 ---------IVRDFFPTVFVKekhylTIFYVVECIAMSNSMVNTVCFVTVKN 574
Cdd:cd14985  232 fldflaqlgAIRPCFWELFLD-----LGLPIATCLAFTNSCLNPFIYVFVDR 278
7tmA_MCHR-like cd15088
melanin concentrating hormone receptor, member of the class A family of seven-transmembrane G ...
291-575 8.18e-30

melanin concentrating hormone receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; Melanin-concentrating hormone receptor (MCHR) binds melanin concentrating hormone and is presumably involved in the neuronal regulation of food intake and energy homeostasis. Despite strong homology with somatostatin receptors, MCHR does not appear to bind somatostatin. Two MCHRs have been characterized in vertebrates, MCHR1 and MCHR2. MCHR1 is expressed in all mammals, whereas MCHR2 is only expressed in the higher order mammals, such as humans, primates, and dogs, and is not found in rodents. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320216 [Multi-domain]  Cd Length: 278  Bit Score: 118.71  E-value: 8.18e-30
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 291 VIGLALVGIMLVCG-IGNFIFIAALARYKKLRNLTNLLIANLAISDfLVAVVCCPFeMDYYVVRQLSWEHGHVLCASVNY 369
Cdd:cd15088    1 VIMPSVFGCICVVGlVGNGIVLYVLVRCSKLRTAPDIFIFNLAVAD-LLFMLGMPF-LIHQFAIDGQWYFGEVMCKIITA 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 370 LRTVSLYVSTNALLAIAIDRYLAIVHPLRpRMKYQT---ATGLIALVWMVSILIAIPSAYFTTetvlIIVKSQEKIFCGQ 446
Cdd:cd15088   79 LDANNQFTSTYILTAMSVDRYLAVVHPIR-STKYRTrfvAKLVNVGLWAASFLSILPVWVYSS----LIYFPDGTTFCYV 153
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 447 IWPVDQQIYYksYFLFIFSIEFVGPVVTMTLCYARISRELWFKAVPGFQTeQIRKRLrcrRKTVLVLMCILTAYVLCWAP 526
Cdd:cd15088  154 SLPSPDDLYW--FTIYHFILGFAVPLVVITVCYILILHRLARGVAPGNQS-HGSSRT---KRVTKMVILIVVVFIVCWLP 227
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|.
gi 594684729 527 FY--GFTIVRDFFPTVFVKEKHYLTIfyvveCIAMSNSMVNTVCFVTVKNN 575
Cdd:cd15088  228 FHvvQLVNLAMNRPTLAFEVAYFLSI-----CLGYANSCLNPFVYILVSEN 273
7tmA_ET_R-like cd14977
endothelin receptors and related proteins, member of the class A family of seven-transmembrane ...
290-580 3.13e-29

endothelin receptors and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This subfamily of G-protein coupled receptors includes endothelin receptors, bombesin receptor subtype 3 (BRS-3), gastrin-releasing peptide receptor (GRPR), neuromedin B receptor (NMB-R), endothelin B receptor-like 2 (ETBR-LP-2), and GRP37. The endothelin receptors and related proteins are members of the seven transmembrane rhodopsin-like G-protein coupled receptor family (class A GPCRs) which activate multiple effectors via different types of G protein.


Pssm-ID: 320108 [Multi-domain]  Cd Length: 292  Bit Score: 117.52  E-value: 3.13e-29
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 290 IVIGLALVgIMLVCGIGNFIFIAALARYKKLRNLTNLLIANLAISDFLVAVVCCPFEMDYYVVRQlsWEHGHVLCASVNY 369
Cdd:cd14977    2 VIMSLSLV-IFAVGIIGNLMVLCIVCTNYYMRSVPNILIASLALGDLLLLLLCVPLNAYNLLTKD--WLFGDVMCKLVPF 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 370 LRTVSLYVSTNALLAIAIDRYLAIVHPLRPRM--KYQTATGLIALVWMVSILIAIPSAYFTTETVLIIVKSQEKIFCG-Q 446
Cdd:cd14977   79 IQVTSLGVTVFSLCALSIDRYRAAVNSMPMQTigACLSTCVKLAVIWVGSVLLAVPEAVLSTVARESSLDNSSLTVCImK 158
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 447 IWPVDQQIYYKSYFLFIFSIEFVGPVVTMTLCYARISRELWFKAVPGfqTEQIRKRLRCRRKTVLVLMCILTAYVLCWAP 526
Cdd:cd14977  159 PSTPFAETYPKARSWWLFGCYFCLPLAFTAVCYLLMARTLIRAAKEY--TRGTKKHMKQRRQLAKTVLCLVLVFAFCWLP 236
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|....*.
gi 594684729 527 FYGFTIVRDFFPT-VFVKEKHYLTIF-YVVECIAMSNSMVNTVCFVTVKNNTIKYF 580
Cdd:cd14977  237 EHISNILRATLYNeVLIDTRSTLDILdLIGQFLSFFNSCVNPIALYLLSEPFRRAF 292
7tmA_Opsins_type2_animals cd14969
type 2 opsins in animals, member of the class A family of seven-transmembrane G ...
295-526 3.79e-29

type 2 opsins in animals, member of the class A family of seven-transmembrane G protein-coupled receptors; This rhodopsin family represents the type 2 opsins found in vertebrates and invertebrates except sponge. Type 2 opsins primarily function as G protein coupled receptors and are responsible for vision as well as for circadian rhythm and pigment regulation. On the contrary, type 1 opsins such as bacteriorhodopsin and proteorhodopsin are found in both prokaryotic and eukaryotic microbes, functioning as light-gated ion channels, proton pumps, sensory receptors and in other unknown functions. Although these two opsin types share seven-transmembrane domain topology and a conserved lysine reside in the seventh helix, type 1 opsins do not activate G-proteins and are not evolutionarily related to type 2. Type 2 opsins can be classified into six distinct subfamilies including the vertebrate opsins/encephalopsins, the G(o) opsins, the G(s) opsins, the invertebrate G(q) opsins, the photoisomerases, and the neuropsins.


Pssm-ID: 320100 [Multi-domain]  Cd Length: 284  Bit Score: 116.92  E-value: 3.79e-29
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 295 ALVGIMLVCGI-GNFIFIAALARYKKLRNLTNLLIANLAISDFLVAVVCCPFEMDYYVVRQLSWehGHVLCASVNYLRTV 373
Cdd:cd14969    5 VYLSLIGVLGVvLNGLVILVFLKKKKLRTPLNLFLLNLALADLLMSVVGYPLSFYSNLSGRWSF--GDPGCVIYGFAVTF 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 374 SLYVSTNALLAIAIDRYLAIVHPLRP-RMKYQTATGLIALVWMVSILIAIP-----SAYfTTETVliivksqeKIFCGQI 447
Cdd:cd14969   83 LGLVSISTLAALAFERYLVIVRPLKAfRLSKRRALILIAFIWLYGLFWALPplfgwSSY-VPEGG--------GTSCSVD 153
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 448 WpVDQQIYYKSYFLFIFSIEFVGPVVTMTLCYARISRELWFK---AVPGFQTEQIRKRLRCRRKTVLVLMCILTAYVLCW 524
Cdd:cd14969  154 W-YSKDPNSLSYIVSLFVFCFFLPLAIIIFCYYKIYRTLRKMskrAARRKNSAITKRTKKAEKKVAKMVLVMIVAFLIAW 232

                 ..
gi 594684729 525 AP 526
Cdd:cd14969  233 TP 234
7tmA_purinoceptor-like cd14982
purinoceptor and its related proteins, member of the class A family of seven-transmembrane G ...
299-569 5.55e-29

purinoceptor and its related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; Members of this subfamily include lysophosphatidic acid receptor, P2 purinoceptor, protease-activated receptor, platelet-activating factor receptor, Epstein-Barr virus induced gene 2, proton-sensing G protein-coupled receptors, GPR35, and GPR55, among others. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 341318 [Multi-domain]  Cd Length: 283  Bit Score: 116.60  E-value: 5.55e-29
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 299 IMLVCGIGNFIFIAALARYKKLRNLTNLLIANLAISDFLVaVVCCPFEMDYYVVRQlSWEHGHVLCASVNYLRTVSLYVS 378
Cdd:cd14982   10 IFILGLLGNILALWVFLRKMKKRSPTTIYMINLALADLLF-VLTLPFRIYYYLNGG-WWPFGDFLCRLTGLLFYINMYGS 87
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 379 TNALLAIAIDRYLAIVHPLRPRMKYQT--ATGLIALVWMVSILIAIPsAYFTTETvliIVKSQEKIFCGQIWPVDQQIYY 456
Cdd:cd14982   88 ILFLTCISVDRYLAVVHPLKSRRLRRKryAVGVCAGVWILVLVASVP-LLLLRST---IAKENNSTTCFEFLSEWLASAA 163
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 457 KsYFLFIFSIEFVGPVVTMTLCYARISRELwfkavpgFQTEQIRKRLRCRRKTVLVLMCILTAYVLCWAPFYGFTIVRDF 536
Cdd:cd14982  164 P-IVLIALVVGFLIPLLIILVCYSLIIRAL-------RRRSKQSQKSVRKRKALRMILIVLAVFLVCFLPYHVTRILYLL 235
                        250       260       270
                 ....*....|....*....|....*....|....*..
gi 594684729 537 FPTVFVKE---KHYLTIFYVV-ECIAMSNSMVNTVCF 569
Cdd:cd14982  236 VRLSFIADcsaRNSLYKAYRItLCLASLNSCLDPLIY 272
7tmA_GnRHR_invertebrate cd15384
invertebrate gonadotropin-releasing hormone receptors, member of the class A family of ...
288-569 5.81e-29

invertebrate gonadotropin-releasing hormone receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; GnRHR, also known as luteinizing hormone releasing hormone receptor (LHRHR), plays an central role in vertebrate reproductive function; its activation by binding to GnRH leads to the release of follicle stimulating hormone (FSH) and luteinizing hormone (LH) from the pituitary gland. GnRHR is expressed predominantly in the gonadotrope membrane of the anterior pituitary as well as found in nuemerous extrapituitary tissues including lymphocytes, breast, ovary, prostate, and cancer cell lines. There are at least two types of GnRH receptors, GnRHR1 and GnRHR2, which couple primarily to G proteins of the Gq/11 family. GnRHR is closely related to the adipokinetic hormone receptor (AKH), which binds to a lipid-mobilizing hormone that is involved in control of insect metabolism. They share a common ancestor and are members of the class A of the seven-transmembrane, G-protein coupled receptor (GPCR) superfamily.


Pssm-ID: 320506 [Multi-domain]  Cd Length: 293  Bit Score: 116.77  E-value: 5.81e-29
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 288 AKIVIglaLVGIMLVCGIGNFIFIAALARYKKLRNLTNLLIANLAISDFLVAVVCCPFEMDY-YVVrqlSWEHGHVLCAS 366
Cdd:cd15384    2 LKIVV---LAVMFVISFIGNLLTIIQIYRLRRSRRTIYSLLLHLAIADLLVTFFCIPSEAIWaYTV---AWLAGNTMCKL 75
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 367 VNYLRTVSLYVSTNALLAIAIDRYLAIVHPLRPRMKYQTATGLIALVWMVSILIAIPSAYFTTETVLIIVKSQEKI---- 442
Cdd:cd15384   76 VKYLQVFGLYLSTYITVLISLDRCVAILYPMKRNQAPERVRRMVTVAWILSPIFSIPQAVIFHVERGPFVEDFHQCvtyg 155
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 594684729 443 FCGQIWpvDQ