NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|62858585|ref|NP_001016353|]
View 

Protein Classification

SANT/Myb-like DNA-binding domain-containing protein (domain architecture ID 10620601)

SANT (SWI3, ADA2, N-CoR and TFIIIB)/Myb-like DNA-binding domain-containing protein may bind DNA and function as a transcription factor

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Myb_DNA-bind_5 pfam13873
Myb/SANT-like DNA-binding domain; This presumed domain appears to be related to other Myb/SANT ...
8-85 9.44e-32

Myb/SANT-like DNA-binding domain; This presumed domain appears to be related to other Myb/SANT like DNA binding domains. This family is greatly expanded in arthropods and higher eukaryotes.


:

Pssm-ID: 404714  Cd Length: 78  Bit Score: 113.14  E-value: 9.44e-32
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 62858585     8 RKMNFSEQEVEIILEEMEKQKHILINHFNAGVPLVTKSNAWHDILKRVNAISTCHRELAEVKKKWSDLKTEVRRKMSQ 85
Cdd:pfam13873   1 RKKNFSEEEKLVLVELVEKNKHILEGKKSDAATWKAKNRAWKEIAERVNALGGVHRTAVELKKKWRDLKRRTKRKLAQ 78
 
Name Accession Description Interval E-value
Myb_DNA-bind_5 pfam13873
Myb/SANT-like DNA-binding domain; This presumed domain appears to be related to other Myb/SANT ...
8-85 9.44e-32

Myb/SANT-like DNA-binding domain; This presumed domain appears to be related to other Myb/SANT like DNA binding domains. This family is greatly expanded in arthropods and higher eukaryotes.


Pssm-ID: 404714  Cd Length: 78  Bit Score: 113.14  E-value: 9.44e-32
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 62858585     8 RKMNFSEQEVEIILEEMEKQKHILINHFNAGVPLVTKSNAWHDILKRVNAISTCHRELAEVKKKWSDLKTEVRRKMSQ 85
Cdd:pfam13873   1 RKKNFSEEEKLVLVELVEKNKHILEGKKSDAATWKAKNRAWKEIAERVNALGGVHRTAVELKKKWRDLKRRTKRKLAQ 78
 
Name Accession Description Interval E-value
Myb_DNA-bind_5 pfam13873
Myb/SANT-like DNA-binding domain; This presumed domain appears to be related to other Myb/SANT ...
8-85 9.44e-32

Myb/SANT-like DNA-binding domain; This presumed domain appears to be related to other Myb/SANT like DNA binding domains. This family is greatly expanded in arthropods and higher eukaryotes.


Pssm-ID: 404714  Cd Length: 78  Bit Score: 113.14  E-value: 9.44e-32
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 62858585     8 RKMNFSEQEVEIILEEMEKQKHILINHFNAGVPLVTKSNAWHDILKRVNAISTCHRELAEVKKKWSDLKTEVRRKMSQ 85
Cdd:pfam13873   1 RKKNFSEEEKLVLVELVEKNKHILEGKKSDAATWKAKNRAWKEIAERVNALGGVHRTAVELKKKWRDLKRRTKRKLAQ 78
MADF_DNA_bdg pfam10545
Alcohol dehydrogenase transcription factor Myb/SANT-like; The myb/SANT-like domain in Adf-1 ...
44-93 8.72e-03

Alcohol dehydrogenase transcription factor Myb/SANT-like; The myb/SANT-like domain in Adf-1 (MADF) is an approximately 80-amino-acid module that directs sequence specific DNA binding to a site consisting of multiple tri-nucleotide repeats. The MADF domain is found in one or more copies in eukaryotic and viral proteins and is often associated with the BESS domain. It is likely that the MADF domain is more closely related to the myb/SANT domain than it is to other HTH domains.


Pssm-ID: 402258  Cd Length: 85  Bit Score: 34.60  E-value: 8.72e-03
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|
gi 62858585    44 KSNAWHDILKRVNAISTCHrelaEVKKKWSDLKTEVRRKMSQARAAVEGE 93
Cdd:pfam10545  25 RERAWEEIAEELGSDVSVE----DCKKKWKNLRDQYRRELRKMKGGRSGE 70
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH