NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|634349315|gb|KDE04645|]
View 

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
PRP1_N pfam06424
PRP1 splicing factor, N-terminal; This domain is specific to the N-terminal part of the prp1 ...
1132-1271 2.74e-34

PRP1 splicing factor, N-terminal; This domain is specific to the N-terminal part of the prp1 splicing factor, which is involved in mRNA splicing (and possibly also poly(A)+ RNA nuclear export and cell cycle progression). This domain is specific to the N-terminus of the RNA splicing factor encoded by prp1. It is involved in mRNA splicing and possibly also poly(A)and RNA nuclear export and cell cycle progression.


:

Pssm-ID: 399435  Cd Length: 109  Bit Score: 127.63  E-value: 2.74e-34
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  1132 APAAYVAGLGRGASGFTTrsdigpareqvtdeaaedknagrgEEIDGdlpdryqdpeNETGLFAGMVYEADDEEADRIYE 1211
Cdd:pfam06424    1 APPGYVAGLGRGATGFTT------------------------DEFEG----------YNGGLFAGGPYDKDDEEADRIYE 46
                           90       100       110       120       130       140
                   ....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  1212 AVDAQMDERRKKRREAREKEEEERFRAERPTIQAQFADLKRGLADMTDQEWDSLPEVNNL 1271
Cdd:pfam06424   47 EIDERMDERRKKRREAREKEEIEKYRAENPKIQQQFADLKRGLATVSEDEWANIPEVGDL 106
Uds1 pfam15456
Up-regulated During Septation; Uds1 is a domain family is found mostly in fungi, and is ...
275-403 2.15e-28

Up-regulated During Septation; Uds1 is a domain family is found mostly in fungi, and is typically between 120 and 138 amino acids in length. The GO annotation for the S.pombe protein describes the protein as barrier septum assembly involved in cell cycle cytokinesis, GO:0071937. Many of the uncharacterized members are listed as being involucrin repeat proteins, but this can not be substantiated.


:

Pssm-ID: 406020 [Multi-domain]  Cd Length: 120  Bit Score: 111.49  E-value: 2.15e-28
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   275 LLSGQAVVETKDFPILGWEEMQDVKKEHAVLAIKIASLSRSLALETRLRDSAAKLVRLSSPipipgsptpaSASGSDASN 354
Cdd:pfam15456    1 LLVETALLDSQEFEILSFEEVEELKKELRALDSRLEYLRRKLALETKLRDAARSLHRLYSS----------YLRSPRNSK 70
                           90       100       110       120
                   ....*....|....*....|....*....|....*....|....*....
gi 634349315   355 RARVTKAQAESQVQQANEKIESIQTELYKVGWKEAESRTKLLRHMAGVL 403
Cdd:pfam15456   71 FSRESLLKAEEELAESDRKIDELAQELEKLENRRAEVRRRLLEHTAAVL 119
SMC_prok_B super family cl37069
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
497-1123 6.50e-20

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


The actual alignment was detected with superfamily member TIGR02168:

Pssm-ID: 274008 [Multi-domain]  Cd Length: 1179  Bit Score: 97.43  E-value: 6.50e-20
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   497 DTSHAAVRDLETQVAGLQRALNEQRDRPIQ---QVDSAQLRELQEEVTQARAAERWARDEHTQTRNELDRHLMELSSIKN 573
Cdd:TIGR02168  361 EELEAELEELESRLEELEEQLETLRSKVAQlelQIASLNNEIERLEARLERLEDRRERLQQEIEELLKKLEEAELKELQA 440
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   574 SHGSLQRELEQTkqgQGQGEDAQRELERLRQEIDEMTDKMQELEQELNDLEERAVASDRRVTDVEGLLEDMK--IKHAHE 651
Cdd:TIGR02168  441 ELEELEEELEEL---QEELERLEEALEELREELEEAEQALDAAERELAQLQARLDSLERLQENLEGFSEGVKalLKNQSG 517
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   652 MQRAQGDL----------QVAKEEAERARLAVARVPTPNGTEEEEQRLRDEVVSMRS--ERTKISQTLADVLQRHRAHAN 719
Cdd:TIGR02168  518 LSGILGVLselisvdegyEAAIEAALGGRLQAVVVENLNAAKKAIAFLKQNELGRVTflPLDSIKGTEIQGNDREILKNI 597
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   720 SLGTELPKDFDETAvdhhDDWSGYVASSLGDhfdhitshaTAVSDELSLA-----RLAQENSANDLEGEL-----RQTQE 789
Cdd:TIGR02168  598 EGFLGVAKDLVKFD----PKLRKALSYLLGG---------VLVVDDLDNAlelakKLRPGYRIVTLDGDLvrpggVITGG 664
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   790 HRdhwqdEAEQHRLAREQlevEHDDLKATVQGHEERLASLaltHQELEVSAEEKEHLRAQLEQAHGRITELEKQIADHDA 869
Cdd:TIGR02168  665 SA-----KTNSSILERRR---EIEELEEKIEELEEKIAEL---EKALAELRKELEELEEELEQLRKELEELSRQISALRK 733
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   870 TQAALKKLWQSLpaidTRRRAGDSHDLATLKaafdpsqslgdssaqfsidalvERVRALLTDDAKLVETLMKIESGTASA 949
Cdd:TIGR02168  734 DLARLEAEVEQL----EERIAQLSKELTELE----------------------AEIEELEERLEEAEEELAEAEAEIEEL 787
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   950 QQEVETHRSNA----ERYQNLAEQHST---NLTVTQSKVKDLEERIEVSSQQAVTMLERLNDLTESLESTRAERRKLETA 1022
Cdd:TIGR02168  788 EAQIEQLKEELkalrEALDELRAELTLlneEAANLRERLESLERRIAATERRLEDLEEQIEELSEDIESLAAEIEELEEL 867
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  1023 GKGLEGQVEAAEEEKNRLAAIVVGLKEENRAMkerpdhTAKLASLENTVQDLKDQLTDLEEELEDTKKREQKTRGQLLE- 1101
Cdd:TIGR02168  868 IEELESELEALLNERASLEEALALLRSELEEL------SEELRELESKRSELRRELEELREKLAQLELRLEGLEVRIDNl 941
                          650       660       670
                   ....*....|....*....|....*....|..
gi 634349315  1102 ----------ELNAAQAEVSALRTKLRQAERK 1123
Cdd:TIGR02168  942 qerlseeyslTLEEAEALENKIEDDEEEARRR 973
PEP_TPR_lipo super family cl37187
putative PEP-CTERM system TPR-repeat lipoprotein; This protein family occurs in strictly ...
1315-1864 8.99e-06

putative PEP-CTERM system TPR-repeat lipoprotein; This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator.


The actual alignment was detected with superfamily member TIGR02917:

Pssm-ID: 274350 [Multi-domain]  Cd Length: 899  Bit Score: 50.85  E-value: 8.99e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  1315 TKTSMNALTDFAEIGQAREKMLSIKLEQQAGTDSVSGSTTIDPKGYLTGLQSQVLKTATeiGDIKRARQLLQSLTKTNPK 1394
Cdd:TIGR02917  114 PGKTLLDDEGAAELLALRGLAYLGLGQLELAQKSYEQALAIDPRSLYAKLGLAQLALAE--NRFDEARALIDEVLTADPG 191
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  1395 HAPGWVAAAWLENVAGKSVQARKIIAEGCQHCPKNEDVWIAAS----ELNTNDNAKVILANAVQELPQSVR-------IW 1463
Cdd:TIGR02917  192 NVDALLLKGDLLLSLGNIELALAAYRKAIALRPNNIAVLLALAtiliEAGEFEEAEKHADALLKKAPNSPLahylkalVD 271
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  1464 MRAVELENDPSAKKRVLRKALEYIPAsVKLWKETVKREENPEDARILLARAVEVIPHSQELWLALA----RLETPDRARQ 1539
Cdd:TIGR02917  272 FQKKNYEDARETLQDALKSAPEYLPA-LLLAGASEYQLGNLEQAYQYLNQILKYAPNSHQARRLLAsiqlRLGRVDEAIA 350
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  1540 VLNKARKTIPTSHEIWIAAGRLQEQEGNTSQVDAIIANgVTALK-KNGAILTRE--QWLGEAERCESAGSIVTAQAI--- 1613
Cdd:TIGR02917  351 TLSPALGLDPDDPAALSLLGEAYLALGDFEKAAEYLAK-ATELDpENAAARTQLgiSKLSQGDPSEAIADLETAAQLdpe 429
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  1614 ------LKATLHLDVEEEDR----LERWLE----DAQTMTSKGLIgcaraifaYSLNVFPQK-QALWRKAAELEKAHgtr 1678
Cdd:TIGR02917  430 lgradlLLILSYLRSGQFDKalaaAKKLEKkqpdNASLHNLLGAI--------YLGKGDLAKaREAFEKALSIEPDF--- 498
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  1679 etllallnkavesVPQAEVLWLMAAKEswlgGDVPGARAILGRAFEANPESEGIWLAAAKLEAENGQIEAARELMRRAVE 1758
Cdd:TIGR02917  499 -------------FPAAANLARIDIQE----GNPDDAIQRFEKVLTIDPKNLRAILALAGLYLRTGNEEEAVAWLEKAAE 561
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  1759 RVGTE-RIWIKSAVFERQHATADSALSTAKAGLAKYDRSAKLYLIHAQLLLAQEppATNAAREVLATAAKKCPTSVPIWL 1837
Cdd:TIGR02917  562 LNPQEiEPALALAQYYLGKGQLKKALAILNEAADAAPDSPEAWLMLGRAQLAAG--DLNKAVSSFKKLLALQPDSALALL 639
                          570       580
                   ....*....|....*....|....*..
gi 634349315  1838 LASRLEENIGLRIKARALLEKARNLNP 1864
Cdd:TIGR02917  640 LLADAYAVMKNYAKAITSLKRALELKP 666
 
Name Accession Description Interval E-value
PRP1_N pfam06424
PRP1 splicing factor, N-terminal; This domain is specific to the N-terminal part of the prp1 ...
1132-1271 2.74e-34

PRP1 splicing factor, N-terminal; This domain is specific to the N-terminal part of the prp1 splicing factor, which is involved in mRNA splicing (and possibly also poly(A)+ RNA nuclear export and cell cycle progression). This domain is specific to the N-terminus of the RNA splicing factor encoded by prp1. It is involved in mRNA splicing and possibly also poly(A)and RNA nuclear export and cell cycle progression.


Pssm-ID: 399435  Cd Length: 109  Bit Score: 127.63  E-value: 2.74e-34
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  1132 APAAYVAGLGRGASGFTTrsdigpareqvtdeaaedknagrgEEIDGdlpdryqdpeNETGLFAGMVYEADDEEADRIYE 1211
Cdd:pfam06424    1 APPGYVAGLGRGATGFTT------------------------DEFEG----------YNGGLFAGGPYDKDDEEADRIYE 46
                           90       100       110       120       130       140
                   ....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  1212 AVDAQMDERRKKRREAREKEEEERFRAERPTIQAQFADLKRGLADMTDQEWDSLPEVNNL 1271
Cdd:pfam06424   47 EIDERMDERRKKRREAREKEEIEKYRAENPKIQQQFADLKRGLATVSEDEWANIPEVGDL 106
Uds1 pfam15456
Up-regulated During Septation; Uds1 is a domain family is found mostly in fungi, and is ...
275-403 2.15e-28

Up-regulated During Septation; Uds1 is a domain family is found mostly in fungi, and is typically between 120 and 138 amino acids in length. The GO annotation for the S.pombe protein describes the protein as barrier septum assembly involved in cell cycle cytokinesis, GO:0071937. Many of the uncharacterized members are listed as being involucrin repeat proteins, but this can not be substantiated.


Pssm-ID: 406020 [Multi-domain]  Cd Length: 120  Bit Score: 111.49  E-value: 2.15e-28
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   275 LLSGQAVVETKDFPILGWEEMQDVKKEHAVLAIKIASLSRSLALETRLRDSAAKLVRLSSPipipgsptpaSASGSDASN 354
Cdd:pfam15456    1 LLVETALLDSQEFEILSFEEVEELKKELRALDSRLEYLRRKLALETKLRDAARSLHRLYSS----------YLRSPRNSK 70
                           90       100       110       120
                   ....*....|....*....|....*....|....*....|....*....
gi 634349315   355 RARVTKAQAESQVQQANEKIESIQTELYKVGWKEAESRTKLLRHMAGVL 403
Cdd:pfam15456   71 FSRESLLKAEEELAESDRKIDELAQELEKLENRRAEVRRRLLEHTAAVL 119
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
497-1123 6.50e-20

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274008 [Multi-domain]  Cd Length: 1179  Bit Score: 97.43  E-value: 6.50e-20
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   497 DTSHAAVRDLETQVAGLQRALNEQRDRPIQ---QVDSAQLRELQEEVTQARAAERWARDEHTQTRNELDRHLMELSSIKN 573
Cdd:TIGR02168  361 EELEAELEELESRLEELEEQLETLRSKVAQlelQIASLNNEIERLEARLERLEDRRERLQQEIEELLKKLEEAELKELQA 440
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   574 SHGSLQRELEQTkqgQGQGEDAQRELERLRQEIDEMTDKMQELEQELNDLEERAVASDRRVTDVEGLLEDMK--IKHAHE 651
Cdd:TIGR02168  441 ELEELEEELEEL---QEELERLEEALEELREELEEAEQALDAAERELAQLQARLDSLERLQENLEGFSEGVKalLKNQSG 517
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   652 MQRAQGDL----------QVAKEEAERARLAVARVPTPNGTEEEEQRLRDEVVSMRS--ERTKISQTLADVLQRHRAHAN 719
Cdd:TIGR02168  518 LSGILGVLselisvdegyEAAIEAALGGRLQAVVVENLNAAKKAIAFLKQNELGRVTflPLDSIKGTEIQGNDREILKNI 597
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   720 SLGTELPKDFDETAvdhhDDWSGYVASSLGDhfdhitshaTAVSDELSLA-----RLAQENSANDLEGEL-----RQTQE 789
Cdd:TIGR02168  598 EGFLGVAKDLVKFD----PKLRKALSYLLGG---------VLVVDDLDNAlelakKLRPGYRIVTLDGDLvrpggVITGG 664
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   790 HRdhwqdEAEQHRLAREQlevEHDDLKATVQGHEERLASLaltHQELEVSAEEKEHLRAQLEQAHGRITELEKQIADHDA 869
Cdd:TIGR02168  665 SA-----KTNSSILERRR---EIEELEEKIEELEEKIAEL---EKALAELRKELEELEEELEQLRKELEELSRQISALRK 733
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   870 TQAALKKLWQSLpaidTRRRAGDSHDLATLKaafdpsqslgdssaqfsidalvERVRALLTDDAKLVETLMKIESGTASA 949
Cdd:TIGR02168  734 DLARLEAEVEQL----EERIAQLSKELTELE----------------------AEIEELEERLEEAEEELAEAEAEIEEL 787
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   950 QQEVETHRSNA----ERYQNLAEQHST---NLTVTQSKVKDLEERIEVSSQQAVTMLERLNDLTESLESTRAERRKLETA 1022
Cdd:TIGR02168  788 EAQIEQLKEELkalrEALDELRAELTLlneEAANLRERLESLERRIAATERRLEDLEEQIEELSEDIESLAAEIEELEEL 867
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  1023 GKGLEGQVEAAEEEKNRLAAIVVGLKEENRAMkerpdhTAKLASLENTVQDLKDQLTDLEEELEDTKKREQKTRGQLLE- 1101
Cdd:TIGR02168  868 IEELESELEALLNERASLEEALALLRSELEEL------SEELRELESKRSELRRELEELREKLAQLELRLEGLEVRIDNl 941
                          650       660       670
                   ....*....|....*....|....*....|..
gi 634349315  1102 ----------ELNAAQAEVSALRTKLRQAERK 1123
Cdd:TIGR02168  942 qerlseeyslTLEEAEALENKIEDDEEEARRR 973
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
531-1126 8.70e-19

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 93.63  E-value: 8.70e-19
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  531 AQLRELQEEVTQARAAERWARDEHTQT-RNELDRHLMELSSIKNSHGSLQRELEQTKQgqgqgedaqrELERLRQEIDEM 609
Cdd:COG1196   354 AELEEAKEELEEKLSALLEELEELFEAlREELAELEAELAEIRNELEELKREIESLEE----------RLERLSERLEDL 423
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  610 TDKMQELEQELNDLEERAVASDRRVTDVEGLLEDMKIKHAH---EMQRAQGDLQVAKEEAERARLAVARVPTPngtEEEE 686
Cdd:COG1196   424 KEELKELEAELEELQTELEELNEELEELEEQLEELRDRLKElerELAELQEELQRLEKELSSLEARLDRLEAE---QRAS 500
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  687 QRLRDEVVSMRSERTKISQTLADVLQRHRAHANSLGTELPKDFDETAVD------------------------------- 735
Cdd:COG1196   501 QGVRAVLEALESGLPGVYGPVAELIKVKEKYETALEAALGNRLQAVVVEneevakkaieflkenkagratflpldrikpl 580
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  736 -----HHDDWSGYVASSL---GDHFDHITSHA---TAVSDELSLAR-LAQENSAND----LEGELR-----QTQEHRDHW 794
Cdd:COG1196   581 rslksDAAPGFLGLASDLidfDPKYEPAVRFVlgdTLVVDDLEQARrLARKLRIKYrivtLDGDLVepsgsITGGSRNKR 660
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  795 QDEAEQHRLarEQLEVEHDDLKATVQGHEERLASLALTHQELEvsaEEKEHLRAQLEQAHGRITELEKQIAdhdATQAAL 874
Cdd:COG1196   661 SSLAQKREL--KELEEELAELEAQLEKLEEELKSLKNELRSLE---DLLEELRRQLEELERQLEELKRELA---ALEEEL 732
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  875 KKLWQSLPAIDTRRRAGDSHDLatlkaafdpsqslgdsSAQFSIDALVERVRALLTDDAKLVETLMKIESGTASAQQEVE 954
Cdd:COG1196   733 EQLQSRLEELEEELEELEEELE----------------ELQERLEELEEELESLEEALAKLKEEIEELEEKRQALQEELE 796
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  955 THRSNAERYQNLAEQHSTNLTVTQSKVKDLEERIEVSSQQAVTMLERLNDLTESLESTRAERRKletagkgLEGQVEAAE 1034
Cdd:COG1196   797 ELEEELEEAERRLDALERELESLEQRRERLEQEIEELEEEIEELEEKLDELEEELEELEKELEE-------LKEELEELE 869
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315 1035 EEKNRLAAIVVGLKEENRAMKERpdhtakLASLENTVQDLKDQLTDLEEELEDTKKREQKTRGQLLEELNAAQAEVSALR 1114
Cdd:COG1196   870 AEKEELEDELKELEEEKEELEEE------LRELESELAELKEEIEKLRERLEELEAKLERLEVELPELEEELEEEYEDTL 943
                         650
                  ....*....|..
gi 634349315 1115 TKLRQAERKASK 1126
Cdd:COG1196   944 ETELEREIERLE 955
PRK02224 PRK02224
DNA double-strand break repair Rad50 ATPase;
593-1121 1.75e-16

DNA double-strand break repair Rad50 ATPase;


Pssm-ID: 179385 [Multi-domain]  Cd Length: 880  Bit Score: 85.86  E-value: 1.75e-16
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  593 EDAQRELERLRQEIDEMTDKmqELEQELNDLEERAVASDrrvTDVEGLLEDmkiKHAHEMQRAQGDLQVAKEEAERARLA 672
Cdd:PRK02224  183 SDQRGSLDQLKAQIEEKEEK--DLHERLNGLESELAELD---EEIERYEEQ---REQARETRDEADEVLEEHEERREELE 254
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  673 VarvptpngTEEEEQRLRDEVVSMRSERTkisqTLADVLQRHRAHANSLGTELPKDFDETAVDHHDDwsgyvaSSLGDHF 752
Cdd:PRK02224  255 T--------LEAEIEDLRETIAETERERE----ELAEEVRDLRERLEELEEERDDLLAEAGLDDADA------EAVEARR 316
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  753 DHITSHATAVSDELSLARLAQENSANDLEGELrqtqEHRDHWQDEAEQHRLAREQLEVEHDDLKATVQGHEERLASLalt 832
Cdd:PRK02224  317 EELEDRDEELRDRLEECRVAAQAHNEEAESLR----EDADDLEERAEELREEAAELESELEEAREAVEDRREEIEEL--- 389
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  833 HQELEVSAEEKEHLRAQLEQAHGRITELEkqiADHDATQAALKKLWQSLPAIDTRRRAGDshdlATLKAAFDPS--QSLG 910
Cdd:PRK02224  390 EEEIEELRERFGDAPVDLGNAEDFLEELR---EERDELREREAELEATLRTARERVEEAE----ALLEAGKCPEcgQPVE 462
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  911 DSSAQFSIDALVERVralltddAKLVETLMKIESGTASAQQEVEthrsnaeRYQNLAEqhstnltvTQSKVKDLEERIEV 990
Cdd:PRK02224  463 GSPHVETIEEDRERV-------EELEAELEDLEEEVEEVEERLE-------RAEDLVE--------AEDRIERLEERRED 520
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  991 SSQQAVTMLERLNDLTESLESTRAERRKLETAGKGLEGQVEAAEEEKNRLAAIVVGLKEENRAMKERPDHTAKLASLENT 1070
Cdd:PRK02224  521 LEELIAERRETIEEKRERAEELRERAAELEAEAEEKREAAAEAEEEAEEAREEVAELNSKLAELKERIESLERIRTLLAA 600
                         490       500       510       520       530
                  ....*....|....*....|....*....|....*....|....*....|....*....
gi 634349315 1071 VQDLKDQLTDLEEELEDTKKREQKTRGQLLE------ELNAA--QAEVSALRTKLRQAE 1121
Cdd:PRK02224  601 IADAEDEIERLREKREALAELNDERRERLAEkrerkrELEAEfdEARIEEAREDKERAE 659
DUF3584 pfam12128
Protein of unknown function (DUF3584); This protein is found in bacteria and eukaryotes. ...
500-1139 4.12e-11

Protein of unknown function (DUF3584); This protein is found in bacteria and eukaryotes. Proteins in this family are typically between 943 to 1234 amino acids in length. This family contains a P-loop motif suggesting it is a nucleotide binding protein. It may be involved in replication.


Pssm-ID: 403375 [Multi-domain]  Cd Length: 1186  Bit Score: 68.63  E-value: 4.12e-11
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   500 HAAVRDLETQVAGLQRALNEQRDRPIQQVDS--AQLRELQEEVTQARAA--ERWARDEHtqtrneldrhlmELSSIKNSH 575
Cdd:pfam12128  263 HVELKADELRIATEQEERQELKNELKSQLRTleDELAEKIDELNGRLSAadAALAAKRS------------ELEALDDQK 330
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   576 GSLQRE-LEQTKQGQGQGEDAQRELERLRQEIDEMTDKMQELEQELNDLeeRAVASDRRVTDVEGLLEDM-KIKHAHEMQ 653
Cdd:pfam12128  331 GAFQDDdIETLAADQEQLPSIQSELEEVEERLDALTGNHQDVTQKYERL--KQKISEELNRDLSGNKERLaKIREAKDRQ 408
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   654 RA--QGDLQV---------------AKEEAERARLAVA----RVPTPNGTEEEEQRLRDEVVSMRSERTKISQTLADVLQ 712
Cdd:pfam12128  409 LAaiEEVLQAlesqlrhqleqqkleFNEEQYLLESRLGelklQLNQATATPELLENIEQNDERLERAQEAQEQANASVEA 488
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   713 RHRAHanslgTELPKDFDEtAVDHHDDWSGYVASSLGDHfdhitshatavsDELSLARLAQENSandLEGELR-QTQEHR 791
Cdd:pfam12128  489 AQSEL-----RQLRKRRDE-ADEALRRANRRLEQLKQAL------------QQLELQLSPQAGS---LLHFLRnEAPDWE 547
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   792 DHWQDEAEQHRLAREQLEVEHDDlkatVQGHEERLASLALTHQELEV--SAEEKEHLRAQLEQAHGRITELEKQIADHDA 869
Cdd:pfam12128  548 QSIGKLISTELLHRTDLDPELVE----SSSQELNLYGVTLDLQRIDApdYAALEEALRERLDQAEKALQAARDKQKAAEE 623
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   870 TQAALKKLWQSLPAIDTRRRAGDSHDLATLKAAFDPSQSLGDSSAQfsidALVERVRALLTDDAKLVETLMKIESGTASA 949
Cdd:pfam12128  624 QLVQLNKELEKLKREETEAARALKQARLTLGRLQDEKQSLKDKLQK----ALKARKQQAETQLQTLDAQLKQLLKKQQAA 699
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   950 QQEvethrsnaeryqnLAEQHSTNLTVTQSKVKDLEERIEVSsqqavtmLERLNDLTESLESTRAER-------RKLETA 1022
Cdd:pfam12128  700 LEE-------------QKEQLRELRTEKQEKWQVVVGDLDAQ-------LALLSAAIAALRTQAKAQlkaleeqYKRDLA 759
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  1023 GKGLEGQVEAA-----EEEKNRLAAIVVGLKEEN--------RAMKERPDHTAKLASLENTVQDLKDQLTDLEEELEDTK 1089
Cdd:pfam12128  760 SLGVDPETLKKlkreiETLERKIEQIAVRRQEVReyrdfmqeTWLLQRPRLATQKSEIESSAEELRQQLTRLQADTKLRR 839
                          650       660       670       680       690
                   ....*....|....*....|....*....|....*....|....*....|
gi 634349315  1090 KREQKTRGQlleeLNAAQAEVSALRTKLRQAERKASkTLKMKAPAAYVAG 1139
Cdd:pfam12128  840 AKLEQERKA----SEKQLVRLSENLRKLRCEMSKLA-ELAEDANANQADG 884
PEP_TPR_lipo TIGR02917
putative PEP-CTERM system TPR-repeat lipoprotein; This protein family occurs in strictly ...
1315-1864 8.99e-06

putative PEP-CTERM system TPR-repeat lipoprotein; This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator.


Pssm-ID: 274350 [Multi-domain]  Cd Length: 899  Bit Score: 50.85  E-value: 8.99e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  1315 TKTSMNALTDFAEIGQAREKMLSIKLEQQAGTDSVSGSTTIDPKGYLTGLQSQVLKTATeiGDIKRARQLLQSLTKTNPK 1394
Cdd:TIGR02917  114 PGKTLLDDEGAAELLALRGLAYLGLGQLELAQKSYEQALAIDPRSLYAKLGLAQLALAE--NRFDEARALIDEVLTADPG 191
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  1395 HAPGWVAAAWLENVAGKSVQARKIIAEGCQHCPKNEDVWIAAS----ELNTNDNAKVILANAVQELPQSVR-------IW 1463
Cdd:TIGR02917  192 NVDALLLKGDLLLSLGNIELALAAYRKAIALRPNNIAVLLALAtiliEAGEFEEAEKHADALLKKAPNSPLahylkalVD 271
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  1464 MRAVELENDPSAKKRVLRKALEYIPAsVKLWKETVKREENPEDARILLARAVEVIPHSQELWLALA----RLETPDRARQ 1539
Cdd:TIGR02917  272 FQKKNYEDARETLQDALKSAPEYLPA-LLLAGASEYQLGNLEQAYQYLNQILKYAPNSHQARRLLAsiqlRLGRVDEAIA 350
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  1540 VLNKARKTIPTSHEIWIAAGRLQEQEGNTSQVDAIIANgVTALK-KNGAILTRE--QWLGEAERCESAGSIVTAQAI--- 1613
Cdd:TIGR02917  351 TLSPALGLDPDDPAALSLLGEAYLALGDFEKAAEYLAK-ATELDpENAAARTQLgiSKLSQGDPSEAIADLETAAQLdpe 429
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  1614 ------LKATLHLDVEEEDR----LERWLE----DAQTMTSKGLIgcaraifaYSLNVFPQK-QALWRKAAELEKAHgtr 1678
Cdd:TIGR02917  430 lgradlLLILSYLRSGQFDKalaaAKKLEKkqpdNASLHNLLGAI--------YLGKGDLAKaREAFEKALSIEPDF--- 498
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  1679 etllallnkavesVPQAEVLWLMAAKEswlgGDVPGARAILGRAFEANPESEGIWLAAAKLEAENGQIEAARELMRRAVE 1758
Cdd:TIGR02917  499 -------------FPAAANLARIDIQE----GNPDDAIQRFEKVLTIDPKNLRAILALAGLYLRTGNEEEAVAWLEKAAE 561
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  1759 RVGTE-RIWIKSAVFERQHATADSALSTAKAGLAKYDRSAKLYLIHAQLLLAQEppATNAAREVLATAAKKCPTSVPIWL 1837
Cdd:TIGR02917  562 LNPQEiEPALALAQYYLGKGQLKKALAILNEAADAAPDSPEAWLMLGRAQLAAG--DLNKAVSSFKKLLALQPDSALALL 639
                          570       580
                   ....*....|....*....|....*..
gi 634349315  1838 LASRLEENIGLRIKARALLEKARNLNP 1864
Cdd:TIGR02917  640 LLADAYAVMKNYAKAITSLKRALELKP 666
dapto_LiaX NF038025
daptomycin-sensing surface protein LiaX; LiaX (lipid-II###interacting antibiotics X), as ...
922-1080 1.14e-03

daptomycin-sensing surface protein LiaX; LiaX (lipid-II###interacting antibiotics X), as described in Enterococcus faecalis, is expressed under control of the the LiaR response regulator, and is involved in the process of resistance to daptomycin and to antimicrobial peptides of the innate immune response.


Pssm-ID: 411618  Cd Length: 513  Bit Score: 43.85  E-value: 1.14e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  922 VERVRALLTDDAKLVETLMKIESGTASAQQEVETHRSNAERYQNLAEQHSTNLTVTQSKVKDLEERIEvSSQQAVTMLER 1001
Cdd:NF038025   44 VTAEKDDLLDELENEQEEEPETFTEQKEEEDKEDLEAILDELATEANKASAELDEVNAEIQGVKEEIK-EKQEQLMVLDT 122
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 634349315 1002 LNDLTESLESTRAERRKLETAGKGLEGQVEAAEEEKNRLAAIVVGLKEENRAMKERpdhtaKLASLENTVQDLKDQLTD 1080
Cdd:NF038025  123 KEELDELSEEELAERQELEAEIKQLEAQLDELEEEKEELEEELKTIRKDQWSQTKE-----KISEKFDIPDDWKEQATE 196
Spc7 smart00787
Spc7 kinetochore protein; This domain is found in cell division proteins which are required ...
505-626 1.25e-03

Spc7 kinetochore protein; This domain is found in cell division proteins which are required for kinetochore-spindle association.


Pssm-ID: 197874 [Multi-domain]  Cd Length: 312  Bit Score: 43.08  E-value: 1.25e-03
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315    505 DLETQVAGLQRALNEQRDRpIQQVDS--AQLRE----LQEEVTQARAAERWARDEHTqtrNELDRHLMELSSIKNSHGSL 578
Cdd:smart00787  148 GLDENLEGLKEDYKLLMKE-LELLNSikPKLRDrkdaLEEELRQLKQLEDELEDCDP---TELDRAKEKLKKLLQEIMIK 223
                            90       100       110       120
                    ....*....|....*....|....*....|....*....|....*...
gi 634349315    579 QRELEQTkqgqgqgedaQRELERLRQEIDEMTDKMQELEQELNDLEER 626
Cdd:smart00787  224 VKKLEEL----------EEELQELESKIEDLTNKKSELNTEIAEAEKK 261
pgaA PRK10049
outer membrane protein PgaA; Provisional
1364-1570 2.61e-03

outer membrane protein PgaA; Provisional


Pssm-ID: 236644 [Multi-domain]  Cd Length: 765  Bit Score: 42.78  E-value: 2.61e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315 1364 LQSQVLKTATEIGDIKRARQLLQSLTKTNPKhAPGWVAAAWLENVAGKSVQARKIIAEGCQHCPKNEDVW---------- 1433
Cdd:PRK10049   85 YQRGLILTLADAGQYDEALVKAKQLVSGAPD-KANLLALAYVYKRAGRHWDELRAMTQALPRAPQTQQYPteyvqalrnn 163
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315 1434 -IAASELNTNDNAKV-------ILANAVQELpqsVRIWMRAVELENdpsAKKRVLRKALEYIPASVKLWKETVKREENPE 1505
Cdd:PRK10049  164 rLSAPALGAIDDANLtpaekrdLEADAAAEL---VRLSFMPTRSEK---ERYAIADRALAQYDALEALWHDNPDATADYQ 237
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 634349315 1506 DARI-----LLARA--VEVIPHSQELwlalarletpdrarqvlNKARKTIPTSHEIWIAAGRLQEQEGNTSQ 1570
Cdd:PRK10049  238 RARIdrlgaLLARDryKDVISEYQRL-----------------KAEGQIIPPWAQRWVASAYLKLHQPEKAQ 292
COG5191 COG5191
Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function ...
1650-1740 3.46e-03

Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only];


Pssm-ID: 227518  Cd Length: 435  Bit Score: 42.26  E-value: 3.46e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315 1650 IFAYSLNVFPQKQALWRKAAELEKAHGTRETLLALLNKAVESVPQAEVLWLMAAK-ESWLGGDVPGARAILGRAFEANPE 1728
Cdd:COG5191    95 ELYRSTNKFFNDPKIWSQYAAYVIKKKMYGEMKNIFAECLTKHPLNVDLWIYCCAfELFEIANIESSRAMFLKGLRMNSR 174
                          90
                  ....*....|..
gi 634349315 1729 SEGIWLAAAKLE 1740
Cdd:COG5191   175 SPRIWIEYFRME 186
pneumo_PspA NF033930
pneumococcal surface protein A; The pneumococcal surface protein proteins, found in ...
859-1134 4.07e-03

pneumococcal surface protein A; The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.


Pssm-ID: 411490 [Multi-domain]  Cd Length: 660  Bit Score: 42.20  E-value: 4.07e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  859 ELEKQIAD--HDATQAALKKLWQSLPAIDTRRRAGDSHDLATLKAAFDPSQSLGDSSAQFsidalvERVRALLTDDAK-L 935
Cdd:NF033930   86 KKEKKASEeeQKANLAVQKAYVKYRKAQRRKKSDYKKKLAEADKKIDEAKKKQKEAKAEF------NKVRAKVVPEAEeL 159
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  936 VETLMKIESGTAS---AQQEVETHRSNAERYQNLAEQHSTNLTVTQSKVKDLEERIeVSSQQAVTMLERLNDLTESLEST 1012
Cdd:NF033930  160 AETKKKAEEAKAEepvAKKKVDEAKKKVEEAKKKVEAEEAEIEKLQNEEVALEAKI-AELENQVDNLEKELAEIDESDSE 238
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315 1013 RAERRKLEtagKGLEGQVEAAEEE----KNRLAAIVVGLKEENRAMKErPDHTAKLASLENTVQDLKDQLTDLEEELEDT 1088
Cdd:NF033930  239 DYIKEGLR---APLESELDAKQAKlakkQTELEKLLDSLDPEGKTQDE-LDKEAAEEELSKKIDELDNEVAKLEKEVSDL 314
                         250       260       270       280
                  ....*....|....*....|....*....|....*....|....*.
gi 634349315 1089 KKREQKTRGQLLEELNAAQAEVSALRTKLRQAERKASKTLKMKAPA 1134
Cdd:NF033930  315 ENSDNNVADYYKEALEKDLATKKAELEKTQKDLDKALNELGPDGDE 360
C39_PA2778_fam NF033920
PA2778 family cysteine peptidase; Members of this family are MEROPS classification C39 family ...
1662-1761 4.61e-03

PA2778 family cysteine peptidase; Members of this family are MEROPS classification C39 family cysteine peptidases, a group that includes many processing enzyme for peptide natural products such as lantibiotics and other bacteriocins. This family, more specifically, includes PA2778 as found in Pseudomonas aeruginosa. All members of the defining seed alignment are encoded in the vicinity of a homolog of PA2779 (see HMM NF033919). Note that the C-terminal region consists largely of tetratricopeptide repeats (TPR), so classification using this HMM must be based on comparing the top domain score to the second gathering threshold (GA2).


Pssm-ID: 411481 [Multi-domain]  Cd Length: 255  Bit Score: 40.99  E-value: 4.61e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315 1662 QALWRKAAELEKAHGTRETLLALlNKAVESVPQAEVLWLMAAKESWLGGDVPGARAILGRAFEANPESEGIWLAAAKLEA 1741
Cdd:NF033920  157 LAYLRAAQDLEQTGQPEAALAAY-QTATKRWPDSWLAYFGLGNAAYAAGDYAAAAAAFRQAVERHPDSAAAWNNLAYALA 235
                          90       100
                  ....*....|....*....|
gi 634349315 1742 ENGQIEAARELMRRAVERVG 1761
Cdd:NF033920  236 AQGCTAQARAAAECALALAP 255
MARTX_Nterm NF012221
MARTX multifunctional-autoprocessing repeats-in-toxin holotoxin N-terminal region; This model ...
530-670 4.63e-03

MARTX multifunctional-autoprocessing repeats-in-toxin holotoxin N-terminal region; This model describes the N-terminal 1900 amino acids of MARTX family multifunctional-autoprocessing repeats-in-toxin holotoxins, which contain both repeat regions that facilitate their entry into eukaryotic target cells, and multiple effector domains.


Pssm-ID: 380155 [Multi-domain]  Cd Length: 1848  Bit Score: 42.13  E-value: 4.63e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  530 SAQLRELQEEVTQARAAERWARDehtQTRNELDRHLME------LSSIKNShgslQRELEQTKQgQGQGEDAQRELERLR 603
Cdd:NF012221 1541 SQQADAVSKHAKQDDAAQNALAD---KERAEADRQRLEqekqqqLAAISGS----QSQLESTDQ-NALETNGQAQRDAIL 1612
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  604 QEIDEMTDKMQELEQELNDLEERAVAS------------DRRVTDVEGLLEDMK---------IKHAHEMQRAQGDLQVA 662
Cdd:NF012221 1613 EESRAVTKELTTLAQGLDALDSQATYAgesgdqwrnpfaGGLLDRVQEQLDDAKkisgkqladAKQRHVDNQQKVKDAVA 1692

                  ....*...
gi 634349315  663 KEEAERAR 670
Cdd:NF012221 1693 KSEAGVAQ 1700
pneumo_PspA NF033930
pneumococcal surface protein A; The pneumococcal surface protein proteins, found in ...
501-685 4.78e-03

pneumococcal surface protein A; The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.


Pssm-ID: 411490 [Multi-domain]  Cd Length: 660  Bit Score: 41.82  E-value: 4.78e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  501 AAVRDLETQVAGLQRALNEqrdrpiqqVDSAQLRELQEEVTQARAaerwardehtqtRNELDRHLMELSSIKNSHGSLQR 580
Cdd:NF033930  213 AKIAELENQVDNLEKELAE--------IDESDSEDYIKEGLRAPL------------ESELDAKQAKLAKKQTELEKLLD 272
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  581 ELEQTKQGQGQgEDAQRELERLRQEIDEMTDKMQELEQELNDLEEravaSDRRVTD--VEGLLEDMKIKHAhEMQRAQGD 658
Cdd:NF033930  273 SLDPEGKTQDE-LDKEAAEEELSKKIDELDNEVAKLEKEVSDLEN----SDNNVADyyKEALEKDLATKKA-ELEKTQKD 346
                         170       180
                  ....*....|....*....|....*..
gi 634349315  659 LQVAKEEaerarlavarvPTPNGTEEE 685
Cdd:NF033930  347 LDKALNE-----------LGPDGDEEE 362
PIN_VapC4-5_FitB-like cd18754
uncharacterized subgroup of the PIN_VapC4-5_FitB-like subfamily of the PIN domain superfamily; ...
1523-1591 5.47e-03

uncharacterized subgroup of the PIN_VapC4-5_FitB-like subfamily of the PIN domain superfamily; The PIN_VapC4-5_FitB-like subfamily includes the Virulence associated protein C (VapC)-like PIN (PilT N terminus) domain of Mycobacterium tuberculosis VapC4 and VapC5 ribonuclease toxins of the VapBC toxin/antitoxin (TA) system, and Neisseria gonorrhoeae FitB toxin of the FitAB TA system. This subfamily belongs to the VapC-like family of the PIN domain nuclease superfamily. VapC is the PIN-domain ribonuclease toxin from prokaryotic VapBC toxin-antitoxin (TA) systems. VapB is a transcription factor-like protein antitoxin acting as an inhibitor. Other members of the VapC-like nuclease family include eukaryotic ribonucleases such as Smg6, ribosome assembly factor NOB1, exosome subunit Rrp44 endoribonuclease and rRNA-processing protein Fcf1. The structural properties of the PIN (PilT N terminus) domain indicate its active center, consisting of three highly conserved catalytic residues which coordinate metal ions, in some members, additional metal coordinating residues can be found. Some members of the superfamily lack several of these key catalytic residues. The PIN active site is geometrically similar in the active center of structure-specific 5' nucleases, PIN-domain ribonucleases of eukaryotic rRNA editing proteins, and bacterial toxins of toxin-antitoxin (TA) operons.


Pssm-ID: 350321  Cd Length: 128  Bit Score: 38.74  E-value: 5.47e-03
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 634349315 1523 ELWLALARLETPDRARQ----VLNkARKTIPTSHEIWIAAGRLQEQ---EGNT-SQVDAIIANgvTALKKNGAILTR 1591
Cdd:cd18754    40 ELYVGVGLSAAPEEEREriesVLE-SKPILPLDGESARKAGRIDGQlrrEGEPiDPGDAMIAA--TALVHDEPVLTR 113
TPR_19 pfam14559
Tetratricopeptide repeat;
1710-1759 9.17e-03

Tetratricopeptide repeat;


Pssm-ID: 405276 [Multi-domain]  Cd Length: 68  Bit Score: 36.43  E-value: 9.17e-03
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|
gi 634349315  1710 GDVPGARAILGRAFEANPESEGIWLAAAKLEAENGQIEAARELMRRAVER 1759
Cdd:pfam14559    5 GDYAEALALLEQALAEDPDNADARLGLARALLALGRLDEAEALLAALPLE 54
M_group_A_cterm NF033777
M protein C-terminal domain; M protein (emm) is an important virulence protein and ...
963-1124 9.31e-03

M protein C-terminal domain; M protein (emm) is an important virulence protein and serology-defining surface antigen of Streptococcus pyogenes (group A Streptococcus). M protein has an amino-terminal YSIRK-type signal sequence (associated with cross-wall targeting in dividing cells), and a C-terminal LPXTG domain for processing by sortase and covalent attachment to the Gram-positive cell wall. Past the signal peptide, M protein has a hypervariable region, but this HMM describes only the well-conserved region C-terminal to the hypervariable region. It discriminates M protein from two related proteins, Enn and Mrp.


Pssm-ID: 411361 [Multi-domain]  Cd Length: 218  Bit Score: 39.82  E-value: 9.31e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  963 YQNLAEQHSTNLTVTQSKVKDLEerievSSQQAVTMLER-LNDLTESLESTRAERRKLETAGKGLEGQVEAAEEEKNRLA 1041
Cdd:NF033777    4 LQKLEEQNKISEASRKGLRRDLD-----ASREAKKQVEKdLANLTAELDKVKEEKQISDASRQGLRRDLDASREAKKQVE 78
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315 1042 AivvGLKEENramkerpdhtAKLASLENtvqdlkdqltdLEEELEDTKKREQKTRGQLLEELnaaQAEVSALRTKL-RQA 1120
Cdd:NF033777   79 K---ALEEAN----------SKLAALEK-----------LNKELEESKKLTEKEKAELQAKL---EAEAKALKEQLaKQA 131

                  ....
gi 634349315 1121 ERKA 1124
Cdd:NF033777  132 EELA 135
 
Name Accession Description Interval E-value
PRP1_N pfam06424
PRP1 splicing factor, N-terminal; This domain is specific to the N-terminal part of the prp1 ...
1132-1271 2.74e-34

PRP1 splicing factor, N-terminal; This domain is specific to the N-terminal part of the prp1 splicing factor, which is involved in mRNA splicing (and possibly also poly(A)+ RNA nuclear export and cell cycle progression). This domain is specific to the N-terminus of the RNA splicing factor encoded by prp1. It is involved in mRNA splicing and possibly also poly(A)and RNA nuclear export and cell cycle progression.


Pssm-ID: 399435  Cd Length: 109  Bit Score: 127.63  E-value: 2.74e-34
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  1132 APAAYVAGLGRGASGFTTrsdigpareqvtdeaaedknagrgEEIDGdlpdryqdpeNETGLFAGMVYEADDEEADRIYE 1211
Cdd:pfam06424    1 APPGYVAGLGRGATGFTT------------------------DEFEG----------YNGGLFAGGPYDKDDEEADRIYE 46
                           90       100       110       120       130       140
                   ....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  1212 AVDAQMDERRKKRREAREKEEEERFRAERPTIQAQFADLKRGLADMTDQEWDSLPEVNNL 1271
Cdd:pfam06424   47 EIDERMDERRKKRREAREKEEIEKYRAENPKIQQQFADLKRGLATVSEDEWANIPEVGDL 106
Uds1 pfam15456
Up-regulated During Septation; Uds1 is a domain family is found mostly in fungi, and is ...
275-403 2.15e-28

Up-regulated During Septation; Uds1 is a domain family is found mostly in fungi, and is typically between 120 and 138 amino acids in length. The GO annotation for the S.pombe protein describes the protein as barrier septum assembly involved in cell cycle cytokinesis, GO:0071937. Many of the uncharacterized members are listed as being involucrin repeat proteins, but this can not be substantiated.


Pssm-ID: 406020 [Multi-domain]  Cd Length: 120  Bit Score: 111.49  E-value: 2.15e-28
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   275 LLSGQAVVETKDFPILGWEEMQDVKKEHAVLAIKIASLSRSLALETRLRDSAAKLVRLSSPipipgsptpaSASGSDASN 354
Cdd:pfam15456    1 LLVETALLDSQEFEILSFEEVEELKKELRALDSRLEYLRRKLALETKLRDAARSLHRLYSS----------YLRSPRNSK 70
                           90       100       110       120
                   ....*....|....*....|....*....|....*....|....*....
gi 634349315   355 RARVTKAQAESQVQQANEKIESIQTELYKVGWKEAESRTKLLRHMAGVL 403
Cdd:pfam15456   71 FSRESLLKAEEELAESDRKIDELAQELEKLENRRAEVRRRLLEHTAAVL 119
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
497-1123 6.50e-20

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274008 [Multi-domain]  Cd Length: 1179  Bit Score: 97.43  E-value: 6.50e-20
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   497 DTSHAAVRDLETQVAGLQRALNEQRDRPIQ---QVDSAQLRELQEEVTQARAAERWARDEHTQTRNELDRHLMELSSIKN 573
Cdd:TIGR02168  361 EELEAELEELESRLEELEEQLETLRSKVAQlelQIASLNNEIERLEARLERLEDRRERLQQEIEELLKKLEEAELKELQA 440
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   574 SHGSLQRELEQTkqgQGQGEDAQRELERLRQEIDEMTDKMQELEQELNDLEERAVASDRRVTDVEGLLEDMK--IKHAHE 651
Cdd:TIGR02168  441 ELEELEEELEEL---QEELERLEEALEELREELEEAEQALDAAERELAQLQARLDSLERLQENLEGFSEGVKalLKNQSG 517
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   652 MQRAQGDL----------QVAKEEAERARLAVARVPTPNGTEEEEQRLRDEVVSMRS--ERTKISQTLADVLQRHRAHAN 719
Cdd:TIGR02168  518 LSGILGVLselisvdegyEAAIEAALGGRLQAVVVENLNAAKKAIAFLKQNELGRVTflPLDSIKGTEIQGNDREILKNI 597
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   720 SLGTELPKDFDETAvdhhDDWSGYVASSLGDhfdhitshaTAVSDELSLA-----RLAQENSANDLEGEL-----RQTQE 789
Cdd:TIGR02168  598 EGFLGVAKDLVKFD----PKLRKALSYLLGG---------VLVVDDLDNAlelakKLRPGYRIVTLDGDLvrpggVITGG 664
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   790 HRdhwqdEAEQHRLAREQlevEHDDLKATVQGHEERLASLaltHQELEVSAEEKEHLRAQLEQAHGRITELEKQIADHDA 869
Cdd:TIGR02168  665 SA-----KTNSSILERRR---EIEELEEKIEELEEKIAEL---EKALAELRKELEELEEELEQLRKELEELSRQISALRK 733
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   870 TQAALKKLWQSLpaidTRRRAGDSHDLATLKaafdpsqslgdssaqfsidalvERVRALLTDDAKLVETLMKIESGTASA 949
Cdd:TIGR02168  734 DLARLEAEVEQL----EERIAQLSKELTELE----------------------AEIEELEERLEEAEEELAEAEAEIEEL 787
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   950 QQEVETHRSNA----ERYQNLAEQHST---NLTVTQSKVKDLEERIEVSSQQAVTMLERLNDLTESLESTRAERRKLETA 1022
Cdd:TIGR02168  788 EAQIEQLKEELkalrEALDELRAELTLlneEAANLRERLESLERRIAATERRLEDLEEQIEELSEDIESLAAEIEELEEL 867
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  1023 GKGLEGQVEAAEEEKNRLAAIVVGLKEENRAMkerpdhTAKLASLENTVQDLKDQLTDLEEELEDTKKREQKTRGQLLE- 1101
Cdd:TIGR02168  868 IEELESELEALLNERASLEEALALLRSELEEL------SEELRELESKRSELRRELEELREKLAQLELRLEGLEVRIDNl 941
                          650       660       670
                   ....*....|....*....|....*....|..
gi 634349315  1102 ----------ELNAAQAEVSALRTKLRQAERK 1123
Cdd:TIGR02168  942 qerlseeyslTLEEAEALENKIEDDEEEARRR 973
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
531-1126 8.70e-19

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 93.63  E-value: 8.70e-19
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  531 AQLRELQEEVTQARAAERWARDEHTQT-RNELDRHLMELSSIKNSHGSLQRELEQTKQgqgqgedaqrELERLRQEIDEM 609
Cdd:COG1196   354 AELEEAKEELEEKLSALLEELEELFEAlREELAELEAELAEIRNELEELKREIESLEE----------RLERLSERLEDL 423
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  610 TDKMQELEQELNDLEERAVASDRRVTDVEGLLEDMKIKHAH---EMQRAQGDLQVAKEEAERARLAVARVPTPngtEEEE 686
Cdd:COG1196   424 KEELKELEAELEELQTELEELNEELEELEEQLEELRDRLKElerELAELQEELQRLEKELSSLEARLDRLEAE---QRAS 500
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  687 QRLRDEVVSMRSERTKISQTLADVLQRHRAHANSLGTELPKDFDETAVD------------------------------- 735
Cdd:COG1196   501 QGVRAVLEALESGLPGVYGPVAELIKVKEKYETALEAALGNRLQAVVVEneevakkaieflkenkagratflpldrikpl 580
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  736 -----HHDDWSGYVASSL---GDHFDHITSHA---TAVSDELSLAR-LAQENSAND----LEGELR-----QTQEHRDHW 794
Cdd:COG1196   581 rslksDAAPGFLGLASDLidfDPKYEPAVRFVlgdTLVVDDLEQARrLARKLRIKYrivtLDGDLVepsgsITGGSRNKR 660
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  795 QDEAEQHRLarEQLEVEHDDLKATVQGHEERLASLALTHQELEvsaEEKEHLRAQLEQAHGRITELEKQIAdhdATQAAL 874
Cdd:COG1196   661 SSLAQKREL--KELEEELAELEAQLEKLEEELKSLKNELRSLE---DLLEELRRQLEELERQLEELKRELA---ALEEEL 732
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  875 KKLWQSLPAIDTRRRAGDSHDLatlkaafdpsqslgdsSAQFSIDALVERVRALLTDDAKLVETLMKIESGTASAQQEVE 954
Cdd:COG1196   733 EQLQSRLEELEEELEELEEELE----------------ELQERLEELEEELESLEEALAKLKEEIEELEEKRQALQEELE 796
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  955 THRSNAERYQNLAEQHSTNLTVTQSKVKDLEERIEVSSQQAVTMLERLNDLTESLESTRAERRKletagkgLEGQVEAAE 1034
Cdd:COG1196   797 ELEEELEEAERRLDALERELESLEQRRERLEQEIEELEEEIEELEEKLDELEEELEELEKELEE-------LKEELEELE 869
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315 1035 EEKNRLAAIVVGLKEENRAMKERpdhtakLASLENTVQDLKDQLTDLEEELEDTKKREQKTRGQLLEELNAAQAEVSALR 1114
Cdd:COG1196   870 AEKEELEDELKELEEEKEELEEE------LRELESELAELKEEIEKLRERLEELEAKLERLEVELPELEEELEEEYEDTL 943
                         650
                  ....*....|..
gi 634349315 1115 TKLRQAERKASK 1126
Cdd:COG1196   944 ETELEREIERLE 955
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
514-1169 2.75e-18

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 92.08  E-value: 2.75e-18
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  514 QRALNEQRDRPIQQVDSAQLRELQEEVTQARAAERWARDEHTQTRNELDRHLMELSSIKNSHGSLQRELE----QTKQGQ 589
Cdd:COG1196   352 LLAELEEAKEELEEKLSALLEELEELFEALREELAELEAELAEIRNELEELKREIESLEERLERLSERLEdlkeELKELE 431
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  590 GQGEDAQRELERLRQEIDEMTDKMQELEQELNDLEERAVASDRRVTDVEGLLEDMKIKHA---HEMQRAQGDLQVAKEEA 666
Cdd:COG1196   432 AELEELQTELEELNEELEELEEQLEELRDRLKELERELAELQEELQRLEKELSSLEARLDrleAEQRASQGVRAVLEALE 511
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  667 ERARLAVARVPTPNGTEEEEQ---------RLRDEVVsmrsERTKISQTLADVLQRHRAHANS-LGTELPKDFDETAVDH 736
Cdd:COG1196   512 SGLPGVYGPVAELIKVKEKYEtaleaalgnRLQAVVV----ENEEVAKKAIEFLKENKAGRATfLPLDRIKPLRSLKSDA 587
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  737 HDDWSGYVA------SSLGDHFDHITSHaTAVSDELSLAR-LAQENSAND----LEGELR-----QTQEHRDHWQDEAEQ 800
Cdd:COG1196   588 APGFLGLASdlidfdPKYEPAVRFVLGD-TLVVDDLEQARrLARKLRIKYrivtLDGDLVepsgsITGGSRNKRSSLAQK 666
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  801 HRLarEQLEVEHDDLKATVQGHEERLASLALTHQELEvsaEEKEHLRAQLEQAHGRITELEKQIAdhdATQAALKKLWQS 880
Cdd:COG1196   667 REL--KELEEELAELEAQLEKLEEELKSLKNELRSLE---DLLEELRRQLEELERQLEELKRELA---ALEEELEQLQSR 738
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  881 LPAIDTRRRAGDSHDLatlkaafdpsqslgdsSAQFSIDALVERVRALLTDDAKLVETLMKIESGTASAQQEVETHRSNA 960
Cdd:COG1196   739 LEELEEELEELEEELE----------------ELQERLEELEEELESLEEALAKLKEEIEELEEKRQALQEELEELEEEL 802
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  961 ERYQNLAEQHSTNLTVTQSKVKDLEERIEVSSQQAVTMLERLNDLTESLESTRAERRKLETAGKGLEGQVEAAEEEKNRL 1040
Cdd:COG1196   803 EEAERRLDALERELESLEQRRERLEQEIEELEEEIEELEEKLDELEEELEELEKELEELKEELEELEAEKEELEDELKEL 882
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315 1041 AAIVVGLKEENRAMKerpdhtAKLASLENTVQDLKDQLTDLEEELEDTKKREQKTRGQLLEELNAAQAEVSALRTKLRQA 1120
Cdd:COG1196   883 EEEKEELEEELRELE------SELAELKEEIEKLRERLEELEAKLERLEVELPELEEELEEEYEDTLETELEREIERLEE 956
                         650       660       670       680
                  ....*....|....*....|....*....|....*....|....*....
gi 634349315 1121 ERKASKTLKMKAPAAYVAGLGRGASGFTTRSDIGPAREQVTDEAAEDKN 1169
Cdd:COG1196   957 EIEALGPVNLRAIEEYEEVEERYEELKSQREDLEEAKEKLLEVIEELDK 1005
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
532-1126 9.21e-18

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 90.16  E-value: 9.21e-18
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  532 QLRELQEEVTQA------RAAERWArdEHTQTRNELDRHLMELSSIKNSHGSLQRELEQTKQGQGQGEDAQRELERLRQE 605
Cdd:COG1196   201 QLEKLERQAEKAeryqelKAELREL--ELALLLAKLKELRKELEELEEELSRLEEELEELQEELEEAEKEIEELKSELEE 278
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  606 IDEMTDKMQ-----------ELEQELNDLEERAVASDRRVTDVEGllEDMKIKHAHEMQRAQGDLQVAKEEAERARLAVA 674
Cdd:COG1196   279 LREELEELQeellelkeeieELEGEISLLRERLEELENELEELEE--RLEELKEKIEALKEELEERETLLEELEQLLAEL 356
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  675 rvptpNGTEEEEQRLRDEVVSMRSERTKISQTLADVLQRHRAHANSLGTELPKDFDEtavdhhddwsgyvASSLGDHFDH 754
Cdd:COG1196   357 -----EEAKEELEEKLSALLEELEELFEALREELAELEAELAEIRNELEELKREIES-------------LEERLERLSE 418
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  755 ITSHATAVSDELSLARLAQENSANDLEGELRQTQEHRDHWQDEAEQHRLAREQLEVEHDDLKATVQGHEERLASLALTHQ 834
Cdd:COG1196   419 RLEDLKEELKELEAELEELQTELEELNEELEELEEQLEELRDRLKELERELAELQEELQRLEKELSSLEARLDRLEAEQR 498
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  835 ELEVSAEEKEHLRAQLEQAHGRITELEKQIADHD-ATQAALKKlwqSLPAIDTRRRAGDSHDLATLK------AAFDPSQ 907
Cdd:COG1196   499 ASQGVRAVLEALESGLPGVYGPVAELIKVKEKYEtALEAALGN---RLQAVVVENEEVAKKAIEFLKenkagrATFLPLD 575
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  908 SLGDSSAQFS--IDALVERVRALLTDDAKLVETLMKIESGTAsaqqeVETHRSNAERYQNL------------------- 966
Cdd:COG1196   576 RIKPLRSLKSdaAPGFLGLASDLIDFDPKYEPAVRFVLGDTL-----VVDDLEQARRLARKlrikyrivtldgdlvepsg 650
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  967 ----AEQHSTNLTVTQSKVKDLEERIEVSSQQAVTMLERLNDLTESLESTRAERRKLETAGKGLEGQVEAAEEEKNRLAA 1042
Cdd:COG1196   651 sitgGSRNKRSSLAQKRELKELEEELAELEAQLEKLEEELKSLKNELRSLEDLLEELRRQLEELERQLEELKRELAALEE 730
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315 1043 IVVGLKEENRAMKErpdhtaKLASLENTVQDLKDQLTDLEEEL---EDTKKREQKTRGQLLEELNAAQAEVSALRTKLRQ 1119
Cdd:COG1196   731 ELEQLQSRLEELEE------ELEELEEELEELQERLEELEEELeslEEALAKLKEEIEELEEKRQALQEELEELEEELEE 804

                  ....*..
gi 634349315 1120 AERKASK 1126
Cdd:COG1196   805 AERRLDA 811
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
501-1121 3.11e-17

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 88.62  E-value: 3.11e-17
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  501 AAVRDLETQVAGLQRALNEQRdrpiqqvdsAQLRELQEEVTQARAAERWARDEHTQTRNELDRHLMELSSIKNSHGSLQR 580
Cdd:COG1196   383 EELAELEAELAEIRNELEELK---------REIESLEERLERLSERLEDLKEELKELEAELEELQTELEELNEELEELEE 453
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  581 ELEQTKQGQgqgEDAQRELERLRQEIDEMTDKMQELEQELNDLEERAVASD----------RRVTDVEGLLEDM---KIK 647
Cdd:COG1196   454 QLEELRDRL---KELERELAELQEELQRLEKELSSLEARLDRLEAEQRASQgvravlealeSGLPGVYGPVAELikvKEK 530
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  648 HAHEMQRAQG---------DLQVAKE------EAERARLAVARVPTPNGTEEEEQRLRDEVVSMRSERTKISQTLADVLQ 712
Cdd:COG1196   531 YETALEAALGnrlqavvveNEEVAKKaieflkENKAGRATFLPLDRIKPLRSLKSDAAPGFLGLASDLIDFDPKYEPAVR 610
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  713 RHrahansLGTELPKDFDETAVDH--HDDWSGYVASSLGDHFD---HIT----SHATAVSDELSLARLAQE-----NSAN 778
Cdd:COG1196   611 FV------LGDTLVVDDLEQARRLarKLRIKYRIVTLDGDLVEpsgSITggsrNKRSSLAQKRELKELEEElaeleAQLE 684
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  779 DLEGELRQTQEHRDHWQDEAEQHRLAREQLEVEHDDLKATVQGHEERLASLALTHQELEvsaEEKEHLRAQLEQAHGRIT 858
Cdd:COG1196   685 KLEEELKSLKNELRSLEDLLEELRRQLEELERQLEELKRELAALEEELEQLQSRLEELE---EELEELEEELEELQERLE 761
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  859 ELEKQIAdhdATQAALKKLWQSLPAIDTRRRAGDSHDLATLKAAFDpsqslgdssAQFSIDALVERVRALLTDDAKLVET 938
Cdd:COG1196   762 ELEEELE---SLEEALAKLKEEIEELEEKRQALQEELEELEEELEE---------AERRLDALERELESLEQRRERLEQE 829
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  939 LMKIESGTASAQQEVETHRSNAERYQNLAEQHSTNLTVTQSKVKDLEERIEVSSQQAVTMLERLNDLTESLESTRAERRK 1018
Cdd:COG1196   830 IEELEEEIEELEEKLDELEEELEELEKELEELKEELEELEAEKEELEDELKELEEEKEELEEELRELESELAELKEEIEK 909
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315 1019 LETAGKG-------LEGQVEAAEEE-------------KNRLAAIVVGLKEE----NRAMKERPDHTAKLASLENTVQDL 1074
Cdd:COG1196   910 LRERLEEleaklerLEVELPELEEEleeeyedtletelEREIERLEEEIEALgpvnLRAIEEYEEVEERYEELKSQREDL 989
                         650       660       670       680
                  ....*....|....*....|....*....|....*....|....*..
gi 634349315 1075 KDQLTDLEEELEDTKKREQKTRGQLLEELNAAQAEVSALRTKLRQAE 1121
Cdd:COG1196   990 EEAKEKLLEVIEELDKEKRERFKETFDKINENFSEIFKELFGGGTAE 1036
PRK02224 PRK02224
DNA double-strand break repair Rad50 ATPase;
593-1121 1.75e-16

DNA double-strand break repair Rad50 ATPase;


Pssm-ID: 179385 [Multi-domain]  Cd Length: 880  Bit Score: 85.86  E-value: 1.75e-16
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  593 EDAQRELERLRQEIDEMTDKmqELEQELNDLEERAVASDrrvTDVEGLLEDmkiKHAHEMQRAQGDLQVAKEEAERARLA 672
Cdd:PRK02224  183 SDQRGSLDQLKAQIEEKEEK--DLHERLNGLESELAELD---EEIERYEEQ---REQARETRDEADEVLEEHEERREELE 254
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  673 VarvptpngTEEEEQRLRDEVVSMRSERTkisqTLADVLQRHRAHANSLGTELPKDFDETAVDHHDDwsgyvaSSLGDHF 752
Cdd:PRK02224  255 T--------LEAEIEDLRETIAETERERE----ELAEEVRDLRERLEELEEERDDLLAEAGLDDADA------EAVEARR 316
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  753 DHITSHATAVSDELSLARLAQENSANDLEGELrqtqEHRDHWQDEAEQHRLAREQLEVEHDDLKATVQGHEERLASLalt 832
Cdd:PRK02224  317 EELEDRDEELRDRLEECRVAAQAHNEEAESLR----EDADDLEERAEELREEAAELESELEEAREAVEDRREEIEEL--- 389
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  833 HQELEVSAEEKEHLRAQLEQAHGRITELEkqiADHDATQAALKKLWQSLPAIDTRRRAGDshdlATLKAAFDPS--QSLG 910
Cdd:PRK02224  390 EEEIEELRERFGDAPVDLGNAEDFLEELR---EERDELREREAELEATLRTARERVEEAE----ALLEAGKCPEcgQPVE 462
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  911 DSSAQFSIDALVERVralltddAKLVETLMKIESGTASAQQEVEthrsnaeRYQNLAEqhstnltvTQSKVKDLEERIEV 990
Cdd:PRK02224  463 GSPHVETIEEDRERV-------EELEAELEDLEEEVEEVEERLE-------RAEDLVE--------AEDRIERLEERRED 520
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  991 SSQQAVTMLERLNDLTESLESTRAERRKLETAGKGLEGQVEAAEEEKNRLAAIVVGLKEENRAMKERPDHTAKLASLENT 1070
Cdd:PRK02224  521 LEELIAERRETIEEKRERAEELRERAAELEAEAEEKREAAAEAEEEAEEAREEVAELNSKLAELKERIESLERIRTLLAA 600
                         490       500       510       520       530
                  ....*....|....*....|....*....|....*....|....*....|....*....
gi 634349315 1071 VQDLKDQLTDLEEELEDTKKREQKTRGQLLE------ELNAA--QAEVSALRTKLRQAE 1121
Cdd:PRK02224  601 IADAEDEIERLREKREALAELNDERRERLAEkrerkrELEAEfdEARIEEAREDKERAE 659
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
532-1132 3.59e-16

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274008 [Multi-domain]  Cd Length: 1179  Bit Score: 85.11  E-value: 3.59e-16
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   532 QLRELQeevTQARAAERWARdehtqTRNELDRHLMELS--SIKNSHGSLQRELEQTKQGQGQGEDAQRELERLRQEIDEM 609
Cdd:TIGR02168  201 QLKSLE---RQAEKAERYKE-----LKAELRELELALLvlRLEELREELEELQEELKEAEEELEELTAELQELEEKLEEL 272
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   610 TDKMQELEQELNDLEERAVASDRRVTDVEGLLEDMKIKHAH---EMQRAQGDLQVAKEEAERARLAVARVptpngtEEEE 686
Cdd:TIGR02168  273 RLEVSELEEEIEELQKELYALANEISRLEQQKQILRERLANlerQLEELEAQLEELESKLDELAEELAEL------EEKL 346
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   687 QRLRDEVVSMRSERTKISQTLADVLQRhrahanslgtelpkdfdetavdhhddwsgyvassLGDHFDHITSHATAVsDEL 766
Cdd:TIGR02168  347 EELKEELESLEAELEELEAELEELESR----------------------------------LEELEEQLETLRSKV-AQL 391
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   767 SLARLAQENSANDLEGELRQTQEHRDHWQDEAEQHRlaREQLEVEHDDLKATVQGHEERLASLAlthQELEVSAEEKEHL 846
Cdd:TIGR02168  392 ELQIASLNNEIERLEARLERLEDRRERLQQEIEELL--KKLEEAELKELQAELEELEEELEELQ---EELERLEEALEEL 466
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   847 RAQLEQAHGRITELEKQIADHDATQAALKKLWQSLpaidtrrrAGDSHDLATL-KAAFDPSQSLGDSSAQFSID------ 919
Cdd:TIGR02168  467 REELEEAEQALDAAERELAQLQARLDSLERLQENL--------EGFSEGVKALlKNQSGLSGILGVLSELISVDegyeaa 538
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   920 ---ALVERVRALLTDDA----KLVETLMKIESGTAS-------------------------AQQEVETHRSNAERYQNL- 966
Cdd:TIGR02168  539 ieaALGGRLQAVVVENLnaakKAIAFLKQNELGRVTflpldsikgteiqgndreilkniegFLGVAKDLVKFDPKLRKAl 618
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   967 ----------------------------------------------AEQHSTNLTVTQSKVKDLEERIEV------SSQQ 994
Cdd:TIGR02168  619 syllggvlvvddldnalelakklrpgyrivtldgdlvrpggvitggSAKTNSSILERRREIEELEEKIEEleekiaELEK 698
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   995 AVTMLE-RLNDLTESLESTRAERRKLETAGKGLEGQVEAAEEEKNRLAAIVVGLKEE-NRAMKERPDHTAKLASLENTVQ 1072
Cdd:TIGR02168  699 ALAELRkELEELEEELEQLRKELEELSRQISALRKDLARLEAEVEQLEERIAQLSKElTELEAEIEELEERLEEAEEELA 778
                          650       660       670       680       690       700
                   ....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  1073 DLKDQLTDLEEELEDTKKREQKTRgqllEELNAAQAEVSALRTKLRQAERKASKTLKMKA 1132
Cdd:TIGR02168  779 EAEAEIEELEAQIEQLKEELKALR----EALDELRAELTLLNEEAANLRERLESLERRIA 834
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
504-1123 8.77e-16

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 84.00  E-value: 8.77e-16
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  504 RDLETQVAGLQRalneqrdrpiqQVDSAQL-RELQEEVTQARAAERWArdEHTQTRNELDRHLMELSSIKNSHGSLQREL 582
Cdd:COG1196   196 EELEKQLEKLER-----------QAEKAERyQELKAELRELELALLLA--KLKELRKELEELEEELSRLEEELEELQEEL 262
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  583 EQTKQGQ----GQGEDAQRELERLRQEIDEMTDKMQELEQELNDLEERAVASDRRVTDVEGllEDMKIKHAHEMQRAQGD 658
Cdd:COG1196   263 EEAEKEIeelkSELEELREELEELQEELLELKEEIEELEGEISLLRERLEELENELEELEE--RLEELKEKIEALKEELE 340
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  659 LQVAKEEAERARLAVArvptpNGTEEEEQRLRDEVVSMRSERTKISQTLADVLQRHRAHANSLGTELPKDFDEtavdhhd 738
Cdd:COG1196   341 ERETLLEELEQLLAEL-----EEAKEELEEKLSALLEELEELFEALREELAELEAELAEIRNELEELKREIES------- 408
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  739 dwsgyvASSLGDHFDHITSHATAVSDELSLARLAQENSANDLEGELRQTQEHRDHWQDEAEQHRLAREQLEVEHDDLKAT 818
Cdd:COG1196   409 ------LEERLERLSERLEDLKEELKELEAELEELQTELEELNEELEELEEQLEELRDRLKELERELAELQEELQRLEKE 482
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  819 VQGHEERLASLALTHQELEVSAEEKEHLRAQLEQAHGRITELEKQIADHD-ATQAALKKlwqSLPAIDTRRRAGDSHDLA 897
Cdd:COG1196   483 LSSLEARLDRLEAEQRASQGVRAVLEALESGLPGVYGPVAELIKVKEKYEtALEAALGN---RLQAVVVENEEVAKKAIE 559
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  898 TLK------AAFDPSQSLGDSSAQFS--IDALVERVRALLTDDAKLVETLMKIESGTAsaqqeVETHRSNAERYQNL--- 966
Cdd:COG1196   560 FLKenkagrATFLPLDRIKPLRSLKSdaAPGFLGLASDLIDFDPKYEPAVRFVLGDTL-----VVDDLEQARRLARKlri 634
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  967 --------------------AEQHSTNLTVTQSKVKDLEERIEVSSQQAVTMLERLNDLTESLESTRAERRKLETAGKGL 1026
Cdd:COG1196   635 kyrivtldgdlvepsgsitgGSRNKRSSLAQKRELKELEEELAELEAQLEKLEEELKSLKNELRSLEDLLEELRRQLEEL 714
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315 1027 EGQVEAAEEEKNRLaaivvglKEENRAMKERpdhtakLASLENTVQDLKDQLTDLEEELEdtkkreqktrgQLLEELNAA 1106
Cdd:COG1196   715 ERQLEELKRELAAL-------EEELEQLQSR------LEELEEELEELEEELEELQERLE-----------ELEEELESL 770
                         650
                  ....*....|....*..
gi 634349315 1107 QAEVSALRTKLRQAERK 1123
Cdd:COG1196   771 EEALAKLKEEIEELEEK 787
PRK02224 PRK02224
DNA double-strand break repair Rad50 ATPase;
500-1088 8.48e-15

DNA double-strand break repair Rad50 ATPase;


Pssm-ID: 179385 [Multi-domain]  Cd Length: 880  Bit Score: 80.47  E-value: 8.48e-15
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  500 HAAVRDLETQVAGLQRAL---NEQRDRPIQQVDSAQLRelqeevtqaraaerwaRDEHTQTRNELDRHLMELssiknshg 576
Cdd:PRK02224  205 HERLNGLESELAELDEEIeryEEQREQARETRDEADEV----------------LEEHEERREELETLEAEI-------- 260
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  577 slqRELEQTKqgqgqgEDAQRELERLRQEIDEMTDKMQELEQELNDLEERA---VASDRRVTDVEGLLEDMKIKHAHEMQ 653
Cdd:PRK02224  261 ---EDLRETI------AETEREREELAEEVRDLRERLEELEEERDDLLAEAgldDADAEAVEARREELEDRDEELRDRLE 331
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  654 RAQGDLQVAKEEAERARLAVARVPTPN-GTEEEEQRLRDEVVSMRSERTKISQTLADVLQRHRAHANSLGtELPKDFDEt 732
Cdd:PRK02224  332 ECRVAAQAHNEEAESLREDADDLEERAeELREEAAELESELEEAREAVEDRREEIEELEEEIEELRERFG-DAPVDLGN- 409
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  733 AVDHHDDwsgyvassLGDHFDHITSHATAVSDELSLARLAQENSANDLEG----ELRQTQEHRDHwQDEAEQHRLAREQL 808
Cdd:PRK02224  410 AEDFLEE--------LREERDELREREAELEATLRTARERVEEAEALLEAgkcpECGQPVEGSPH-VETIEEDRERVEEL 480
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  809 EVEHDDLKATVQGHEERLA---SLALTHQELEVSAEEKEHLRAQLEQAHGRITELEKQIADHDATQAALKKlwqslPAID 885
Cdd:PRK02224  481 EAELEDLEEEVEEVEERLEraeDLVEAEDRIERLEERREDLEELIAERRETIEEKRERAEELRERAAELEA-----EAEE 555
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  886 TRRRAGDSHDLAtlkaafdpsqslgdSSAQFSIDALvERVRALLTDDAKLVETLMKIESGTASAQQEVETHRSNAERYQN 965
Cdd:PRK02224  556 KREAAAEAEEEA--------------EEAREEVAEL-NSKLAELKERIESLERIRTLLAAIADAEDEIERLREKREALAE 620
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  966 LAEQHSTNLTVTQSKVKDLEE-----RIEVSSQQAVTMLERLNDLTESLESTRAERRKLETAGKGLEGQVEAAEEEKNRL 1040
Cdd:PRK02224  621 LNDERRERLAEKRERKRELEAefdeaRIEEAREDKERAEEYLEQVEEKLDELREERDDLQAEIGAVENELEELEELRERR 700
                         570       580       590       600
                  ....*....|....*....|....*....|....*....|....*...
gi 634349315 1041 AAivvglkeenramkerpdhtaklasLENTVQDLKDqLTDLEEELEDT 1088
Cdd:PRK02224  701 EA------------------------LENRVEALEA-LYDEAEELESM 723
SMC_prok_A TIGR02169
chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of ...
576-1123 3.62e-13

chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274009 [Multi-domain]  Cd Length: 1164  Bit Score: 75.10  E-value: 3.62e-13
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   576 GSLQRELEQTKQGQGQGEDAQRELERLRQEIDEMTDKMQELEQELNDL--------EERAVASDRRVTDVEG---LLEDM 644
Cdd:TIGR02169  230 KEKEALERQKEAIERQLASLEEELEKLTEEISELEKRLEEIEQLLEELnkkikdlgEEEQLRVKEKIGELEAeiaSLERS 309
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   645 KIKHAHEMQRAQGDLQVAKEEAERarlavarvptpngTEEEEQRLRDEVVSMRSERTKISQTLADVLQRHRAHANSLGtE 724
Cdd:TIGR02169  310 IAEKERELEDAEERLAKLEAEIDK-------------LLAEIEELEREIEEERKRRDKLTEEYAELKEELEDLRAELE-E 375
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   725 LPKDFDETaVDHHDDWSGYVaSSLGDHFDHITSHATAVSDELSLARLAQENSANDL---EGELRQTQEHRDHWQDEAEQH 801
Cdd:TIGR02169  376 VDKEFAET-RDELKDYREKL-EKLKREINELKRELDRLQEELQRLSEELADLNAAIagiEAKINELEEEKEDKALEIKKQ 453
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   802 RLAREQL-------EVEHDDLKATVQGHEERLASLALTHQELEVSAEE-----------KEHLRAQLEQAHGRITEL--- 860
Cdd:TIGR02169  454 EWKLEQLaadlskyEQELYDLKEEYDRVEKELSKLQRELAEAEAQARAseervrggravEEVLKASIQGVHGTVAQLgsv 533
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   861 --EKQIA----------------DHDATQA---------------ALKKLWQSL-------------------------- 881
Cdd:TIGR02169  534 geRYATAievaagnrlnnvvvedDAVAKEAiellkrrkagratflPLNKMRDERrdlsilsedgvigfavdlvefdpkye 613
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   882 PA-------------IDTRRRAGDSHDLATLKAA-FDPSQSL--------GDSSAQFSIDALVERVRALLTDDAKLVETL 939
Cdd:TIGR02169  614 PAfkyvfgdtlvvedIEAARRLMGKYRMVTLEGElFEKSGAMtggsraprGGILFSRSEPAELQRLRERLEGLKRELSSL 693
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   940 M----KIESGTASAQQEV-ETHRSNAE---RYQNLAEQHSTN-----------------LTVTQSKVKDLEERIEVSSQQ 994
Cdd:TIGR02169  694 QselrRIENRLDELSQELsDASRKIGEiekEIEQLEQEEEKLkerleeleedlssleqeIENVKSELKELEARIEELEED 773
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   995 AVTMLERLNDLTESL-----ESTRAERRKLETAGKGLEGQVEAAEEEKNRLAAIVVGLKEE-NRAMKERPDHTAKLASLE 1068
Cdd:TIGR02169  774 LHKLEEALNDLEARLshsriPEIQAELSKLEEEVSRIEARLREIEQKLNRLTLEKEYLEKEiQELQEQRIDLKEQIKSIE 853
                          650       660       670       680       690
                   ....*....|....*....|....*....|....*....|....*....|....*
gi 634349315  1069 NTVQDLKDQLTDLEEELEDTKKREQktrgQLLEELNAAQAEVSALRTKLRQAERK 1123
Cdd:TIGR02169  854 KEIENLNGKKEELEEELEELEAALR----DLESRLGDLKKERDELEAQLRELERK 904
mukB PRK04863
chromosome partition protein MukB;
499-1117 4.45e-13

chromosome partition protein MukB;


Pssm-ID: 235316 [Multi-domain]  Cd Length: 1486  Bit Score: 74.99  E-value: 4.45e-13
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  499 SHAAVRDLETQVAGLQRALNEQRDRPI-QQVDSAQLRELQEEVTQAraaerwardehtQTRNELDRHLMELSSIKNSHGS 577
Cdd:PRK04863  467 VAQAAHSQFEQAYQLVRKIAGEVSRSEaWDVARELLRRLREQRHLA------------EQLQQLRMRLSELEQRLRQQQR 534
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  578 LQRELEQTKQGQGQGEDAQRELERLRQEidemtdkmqeLEQELNDLEERAVASDRRVTDVEGLLEDMKIKHAHEMQRAQG 657
Cdd:PRK04863  535 AERLLAEFCKRLGKNLDDEDELEQLQEE----------LEARLESLSESVSEARERRMALRQQLEQLQARIQRLAARAPA 604
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  658 DLQvAKEEAERARLAV-ARVPTPNGTEEEEQRLRDEVVSMRSERTKISQTLADVLQRHRAHANSLGTELPK------DFD 730
Cdd:PRK04863  605 WLA-AQDALARLREQSgEEFEDSQDVTEYMQQLLERERELTVERDELAARKQALDEEIERLSQPGGSEDPRlnalaeRFG 683
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  731 ETAV-DHHDDWS----GYVASSLGDhfdhiTSHATAVSDeLSLAR---LAQENSANDL---EGELRQ-------TQEH-R 791
Cdd:PRK04863  684 GVLLsEIYDDVSledaPYFSALYGP-----ARHAIVVPD-LSDAAeqlAGLEDCPEDLyliEGDPDSfddsvfsVEELeK 757
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  792 DHWQDEAEQH-------------RLAREQ----LEVEHDDLkatvqghEERLASLALTHQELE-----VSAEEKEHL--- 846
Cdd:PRK04863  758 AVVVKIADRQwrysrfpevplfgRAAREKrieqLRAEREEL-------AERYATLSFDVQKLQrlhqaFSRFIGSHLava 830
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  847 -----RAQLEQAHGRITELEKQIADHDATQAALKKLWQslpaidtrrragdshdlaTLKAAFDPSQSLGDSSAQFSIDAL 921
Cdd:PRK04863  831 feadpEAELRQLNRRRVELERALADHESQEQQQRSQLE------------------QAKEGLSALNRLLPRLNLLADETL 892
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  922 VERVRAL------LTDDAKLVE----TLMKIESGTASAQQEVETHRSNAERYQNLAEQHSTnltvTQSKVKDLEERIEV- 990
Cdd:PRK04863  893 ADRVEEIreqldeAEEAKRFVQqhgnALAQLEPIVSVLQSDPEQFEQLKQDYQQAQQTQRD----AKQQAFALTEVVQRr 968
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  991 ---SSQQAVTMLERLNDLTESLestraeRRKLetagkglegqvEAAEEEKNRlaaivvgLKEENRAMKER-PDHTAKLAS 1066
Cdd:PRK04863  969 ahfSYEDAAEMLAKNSDLNEKL------RQRL-----------EQAEQERTR-------AREQLRQAQAQlAQYNQVLAS 1024
                         650       660       670       680       690
                  ....*....|....*....|....*....|....*....|....*....|....*....
gi 634349315 1067 LENTVQDLKDQLTDLEEELEDT--------KKREQKTRGQLLEELNAAQAEVSALRTKL 1117
Cdd:PRK04863 1025 LKSSYDAKRQMLQELKQELQDLgvpadsgaEERARARRDELHARLSANRSRRNQLEKQL 1083
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
488-865 2.67e-12

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274008 [Multi-domain]  Cd Length: 1179  Bit Score: 72.40  E-value: 2.67e-12
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   488 NGQFVVAGADTSHAAVR--------DLETQVAGLQRALNEQRdrpiQQVDSA--QLRELQEEVTQARAAERWARDEHTQT 557
Cdd:TIGR02168  656 RPGGVITGGSAKTNSSIlerrreieELEEKIEELEEKIAELE----KALAELrkELEELEEELEQLRKELEELSRQISAL 731
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   558 RNELDRHLMELssiknshgslQRELEQTKQGQGQGEDAQRELERLRQEIDEMTDKMQELEQELNDLE-------ERAVAS 630
Cdd:TIGR02168  732 RKDLARLEAEV----------EQLEERIAQLSKELTELEAEIEELEERLEEAEEELAEAEAEIEELEaqieqlkEELKAL 801
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   631 DRRVTDVEGLLEDMKIkHAHEMQRAQGDLQVAKEEAERArlAVARVPTPNGTEEEEQRLRDEVVSMRSERTKISQTLADV 710
Cdd:TIGR02168  802 REALDELRAELTLLNE-EAANLRERLESLERRIAATERR--LEDLEEQIEELSEDIESLAAEIEELEELIEELESELEAL 878
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   711 LQRHRAHANSLgtelpkdfdetavdhhddwsgyvasslgdhfdhitshatavsDELSLARLAQENSANDLEGELRQTQEH 790
Cdd:TIGR02168  879 LNERASLEEAL------------------------------------------ALLRSELEELSEELRELESKRSELRRE 916
                          330       340       350       360       370       380       390
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 634349315   791 RDHWQDEAEQHRLAREQLEVEHDDLKatvqgheERLASLALThqELEVSAEEKEHLRAQLEQAHGRITELEKQIA 865
Cdd:TIGR02168  917 LEELREKLAQLELRLEGLEVRIDNLQ-------ERLSEEYSL--TLEEAEALENKIEDDEEEARRRLKRLENKIK 982
SMC_prok_A TIGR02169
chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of ...
496-1123 3.01e-12

chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274009 [Multi-domain]  Cd Length: 1164  Bit Score: 72.41  E-value: 3.01e-12
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   496 ADTSHAAVRDLETQVAGLQRALNEQRDRPIQQVDsaQLRELQEEVTQARAAERWARDEHTQTRNELDRHLMELSSIknsh 575
Cdd:TIGR02169  380 FAETRDELKDYREKLEKLKREINELKRELDRLQE--ELQRLSEELADLNAAIAGIEAKINELEEEKEDKALEIKKQ---- 453
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   576 gslQRELEQTKQgqgQGEDAQRELERLRQEIDEMTDKMQELEQELNDLEERAVASDRRVTD---VEGLLEDmKIKHAH-- 650
Cdd:TIGR02169  454 ---EWKLEQLAA---DLSKYEQELYDLKEEYDRVEKELSKLQRELAEAEAQARASEERVRGgraVEEVLKA-SIQGVHgt 526
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   651 --EMQRAQGDLQVAKEEAERARLAVARVPTPNGTEEEEQRLRDEVVS---------MRSERTKISQ-----------TLA 708
Cdd:TIGR02169  527 vaQLGSVGERYATAIEVAAGNRLNNVVVEDDAVAKEAIELLKRRKAGratflplnkMRDERRDLSIlsedgvigfavDLV 606
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   709 DVLQRHR-AHANSLGTELPKDFDETAVDHHD------------DWSGyvaSSLGDHFDHITSHATAVSDELSLARLAQEn 775
Cdd:TIGR02169  607 EFDPKYEpAFKYVFGDTLVVEDIEAARRLMGkyrmvtlegelfEKSG---AMTGGSRAPRGGILFSRSEPAELQRLRER- 682
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   776 sANDLEGELRQTQEHRDHWQDEAEQHRLAREQLEVEHDDLKAtvqgheerlaslalthqELEVSAEEKEHLRAQLEQAHG 855
Cdd:TIGR02169  683 -LEGLKRELSSLQSELRRIENRLDELSQELSDASRKIGEIEK-----------------EIEQLEQEEEKLKERLEELEE 744
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   856 RITELEKQIADHDATQAALKKlwqslpAIDTRRRagdshDLATLKAAF-DPSQSLGDSSaqfsIDALVERVRALLTDDAK 934
Cdd:TIGR02169  745 DLSSLEQEIENVKSELKELEA------RIEELEE-----DLHKLEEALnDLEARLSHSR----IPEIQAELSKLEEEVSR 809
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   935 LVETLMKIESGTASAQQEVETHRSNAERYQNLAEQHSTNLTVTQSKVKDLEERIEVSSQQAVTMLERLNDLTESLESTRA 1014
Cdd:TIGR02169  810 IEARLREIEQKLNRLTLEKEYLEKEIQELQEQRIDLKEQIKSIEKEIENLNGKKEELEEELEELEAALRDLESRLGDLKK 889
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  1015 ERRKLETAGKG-------LEGQVEAAEEEKNRLAAIVVGLKEEN-------RAMKERPDHTAKLASLENTVQDLKDQLTD 1080
Cdd:TIGR02169  890 ERDELEAQLRElerkieeLEAQIEKKRKRLSELKAKLEALEEELseiedpkGEDEEIPEEELSLEDVQAELQRVEEEIRA 969
                          650       660       670       680       690
                   ....*....|....*....|....*....|....*....|....*....|
gi 634349315  1081 LE-------EELEDTKKReqktRGQLLEELNAAQAEVSALRTKLRQAERK 1123
Cdd:TIGR02169  970 LEpvnmlaiQEYEEVLKR----LDELKEKRAKLEEERKAILERIEEYEKK 1015
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
593-1030 3.24e-11

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 68.97  E-value: 3.24e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  593 EDAQRELERLRQEIDEMTDKMQELEQELNDLE------ERAVASDRRVTDVEGLLEDMKIKHA-HEMQRAQGDLQVAKEE 665
Cdd:COG1196   175 EEAERKLERTEENLERLEDLLEELEKQLEKLErqaekaERYQELKAELRELELALLLAKLKELrKELEELEEELSRLEEE 254
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  666 AERArlavarvptpngtEEEEQRLRDEVVSMRSERTKIsqtladvlqrhRAHANSLGTELpkdfdetavdhhddwsgyva 745
Cdd:COG1196   255 LEEL-------------QEELEEAEKEIEELKSELEEL-----------REELEELQEEL-------------------- 290
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  746 sslgdhfdhitshatavsdelslarLAQENSANDLEGELRQTQEHRDHWQDEAEQHRLAREQLEVEHDDLKATVQGHEER 825
Cdd:COG1196   291 -------------------------LELKEEIEELEGEISLLRERLEELENELEELEERLEELKEKIEALKEELEERETL 345
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  826 LASLALTHQELEVSAEEKEHLRAQLEQAH-GRITELEKQIADHDATQAALkklwqslpaidtrrragdSHDLATLKAAFD 904
Cdd:COG1196   346 LEELEQLLAELEEAKEELEEKLSALLEELeELFEALREELAELEAELAEI------------------RNELEELKREIE 407
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  905 psqslgdsSAQFSIDALVERVRALLTDDAKLVETLMKIESGTASAQQEVETHRSNAERYQNLAEQHSTNLTVTQSKVKDL 984
Cdd:COG1196   408 --------SLEERLERLSERLEDLKEELKELEAELEELQTELEELNEELEELEEQLEELRDRLKELERELAELQEELQRL 479
                         410       420       430       440
                  ....*....|....*....|....*....|....*....|....*.
gi 634349315  985 EERIevssQQAVTMLERLNDLTESLESTRAERRKLETAGKGLEGQV 1030
Cdd:COG1196   480 EKEL----SSLEARLDRLEAEQRASQGVRAVLEALESGLPGVYGPV 521
PRK03918 PRK03918
DNA double-strand break repair ATPase Rad50;
571-1118 3.29e-11

DNA double-strand break repair ATPase Rad50;


Pssm-ID: 235175 [Multi-domain]  Cd Length: 880  Bit Score: 68.55  E-value: 3.29e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  571 IKNSHGSLQRELEQTKQGQGQGEDAQRELERLRQEIDEMTDKMQELEQELNDLE----------ERAVASDRRVTDVEGL 640
Cdd:PRK03918  174 IKRRIERLEKFIKRTENIEELIKEKEKELEEVLREINEISSELPELREELEKLEkevkeleelkEEIEELEKELESLEGS 253
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  641 LEDMKIKhaheMQRAQGDLQVAKEEAERARLAVARVPTPNGTEEEEQRLRDEVVSMRSERTKISQTLADV------LQRH 714
Cdd:PRK03918  254 KRKLEEK----IRELEERIEELKKEIEELEEKVKELKELKEKAEEYIKLSEFYEEYLDELREIEKRLSRLeeeingIEER 329
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  715 RAHANSLGT---ELPKDFDETAVDhhddwsgyVASSLGDHfdHITSHATAVSDEL-SLARLAQENSANDLEGELRQTQEH 790
Cdd:PRK03918  330 IKELEEKEErleELKKKLKELEKR--------LEELEERH--ELYEEAKAKKEELeRLKKRLTGLTPEKLEKELEELEKA 399
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  791 RDHWQDEAEQHRLAREQLEVEHDDLKATVQ----------------GHEERLASLALTHQELEVSAEEKEHLRAQLEQAH 854
Cdd:PRK03918  400 KEEIEEEISKITARIGELKKEIKELKKAIEelkkakgkcpvcgrelTEEHRKELLEEYTAELKRIEKELKEIEEKERKLR 479
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  855 GRITELEKQIADhdatQAALKKLWQSLPAIDTRRRAGDSHDLATLKAAFDP-----SQSLGDSSAQFSIDALVERVRALL 929
Cdd:PRK03918  480 KELRELEKVLKK----ESELIKLKELAEQLKELEEKLKKYNLEELEKKAEEyeklkEKLIKLKGEIKSLKKELEKLEELK 555
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  930 TDDAKLVETLMKIESGTASAQQEV-----ETHRSNAERYQNLAEQHSTNLTVTQSKvKDLEERievssqqavtmLERLND 1004
Cdd:PRK03918  556 KKLAELEKKLDELEEELAELLKELeelgfESVEELEERLKELEPFYNEYLELKDAE-KELERE-----------EKELKK 623
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315 1005 LTESLESTRAERRKLETAGKGLEGQVEAA-----EEEKNRLAAIVVGLKEENRAMKERpdhtakLASLENTVQDLKDQLT 1079
Cdd:PRK03918  624 LEEELDKAFEELAETEKRLEELRKELEELekkysEEEYEELREEYLELSRELAGLRAE------LEELEKRREEIKKTLE 697
                         570       580       590
                  ....*....|....*....|....*....|....*....
gi 634349315 1080 DLEEELEDTKKREQKtrgqlLEELNAAQAEVSALRTKLR 1118
Cdd:PRK03918  698 KLKEELEEREKAKKE-----LEKLEKALERVEELREKVK 731
DUF3584 pfam12128
Protein of unknown function (DUF3584); This protein is found in bacteria and eukaryotes. ...
500-1139 4.12e-11

Protein of unknown function (DUF3584); This protein is found in bacteria and eukaryotes. Proteins in this family are typically between 943 to 1234 amino acids in length. This family contains a P-loop motif suggesting it is a nucleotide binding protein. It may be involved in replication.


Pssm-ID: 403375 [Multi-domain]  Cd Length: 1186  Bit Score: 68.63  E-value: 4.12e-11
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   500 HAAVRDLETQVAGLQRALNEQRDRPIQQVDS--AQLRELQEEVTQARAA--ERWARDEHtqtrneldrhlmELSSIKNSH 575
Cdd:pfam12128  263 HVELKADELRIATEQEERQELKNELKSQLRTleDELAEKIDELNGRLSAadAALAAKRS------------ELEALDDQK 330
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   576 GSLQRE-LEQTKQGQGQGEDAQRELERLRQEIDEMTDKMQELEQELNDLeeRAVASDRRVTDVEGLLEDM-KIKHAHEMQ 653
Cdd:pfam12128  331 GAFQDDdIETLAADQEQLPSIQSELEEVEERLDALTGNHQDVTQKYERL--KQKISEELNRDLSGNKERLaKIREAKDRQ 408
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   654 RA--QGDLQV---------------AKEEAERARLAVA----RVPTPNGTEEEEQRLRDEVVSMRSERTKISQTLADVLQ 712
Cdd:pfam12128  409 LAaiEEVLQAlesqlrhqleqqkleFNEEQYLLESRLGelklQLNQATATPELLENIEQNDERLERAQEAQEQANASVEA 488
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   713 RHRAHanslgTELPKDFDEtAVDHHDDWSGYVASSLGDHfdhitshatavsDELSLARLAQENSandLEGELR-QTQEHR 791
Cdd:pfam12128  489 AQSEL-----RQLRKRRDE-ADEALRRANRRLEQLKQAL------------QQLELQLSPQAGS---LLHFLRnEAPDWE 547
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   792 DHWQDEAEQHRLAREQLEVEHDDlkatVQGHEERLASLALTHQELEV--SAEEKEHLRAQLEQAHGRITELEKQIADHDA 869
Cdd:pfam12128  548 QSIGKLISTELLHRTDLDPELVE----SSSQELNLYGVTLDLQRIDApdYAALEEALRERLDQAEKALQAARDKQKAAEE 623
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   870 TQAALKKLWQSLPAIDTRRRAGDSHDLATLKAAFDPSQSLGDSSAQfsidALVERVRALLTDDAKLVETLMKIESGTASA 949
Cdd:pfam12128  624 QLVQLNKELEKLKREETEAARALKQARLTLGRLQDEKQSLKDKLQK----ALKARKQQAETQLQTLDAQLKQLLKKQQAA 699
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   950 QQEvethrsnaeryqnLAEQHSTNLTVTQSKVKDLEERIEVSsqqavtmLERLNDLTESLESTRAER-------RKLETA 1022
Cdd:pfam12128  700 LEE-------------QKEQLRELRTEKQEKWQVVVGDLDAQ-------LALLSAAIAALRTQAKAQlkaleeqYKRDLA 759
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  1023 GKGLEGQVEAA-----EEEKNRLAAIVVGLKEEN--------RAMKERPDHTAKLASLENTVQDLKDQLTDLEEELEDTK 1089
Cdd:pfam12128  760 SLGVDPETLKKlkreiETLERKIEQIAVRRQEVReyrdfmqeTWLLQRPRLATQKSEIESSAEELRQQLTRLQADTKLRR 839
                          650       660       670       680       690
                   ....*....|....*....|....*....|....*....|....*....|
gi 634349315  1090 KREQKTRGQlleeLNAAQAEVSALRTKLRQAERKASkTLKMKAPAAYVAG 1139
Cdd:pfam12128  840 AKLEQERKA----SEKQLVRLSENLRKLRCEMSKLA-ELAEDANANQADG 884
SbcC COG0419
DNA repair exonuclease SbcCD ATPase subunit [Replication, recombination and repair];
515-1132 3.35e-10

DNA repair exonuclease SbcCD ATPase subunit [Replication, recombination and repair];


Pssm-ID: 223496 [Multi-domain]  Cd Length: 908  Bit Score: 65.55  E-value: 3.35e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  515 RALNEQRDRPIQQVDSAQLRELQEEVTQARAAERWARDEHTQTRNELDRHLMELSSIKNSHGSLQRELEQTKQGQGQGED 594
Cdd:COG0419   216 KKLEEIQEEQEEEELEQEIEALEERLAELEEEKERLEELKARLLEIESLELEALKIREEELRELERLLEELEEKIERLEE 295
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  595 AQRELERLRQEIDEMTDKMQELEQELNDLEEravasdrRVTDVEGLLEDMKikhahEMQRAQGDLQVAKEEAERARlava 674
Cdd:COG0419   296 LEREIEELEEELEGLRALLEELEELLEKLKS-------LEERLEKLEEKLE-----KLESELEELAEEKNELAKLL---- 359
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  675 rvptpngtEEEEQRLRDEVVSMRSERTKISQTLADvLQRHRAHANSLGTELPKDFDETAVdhhddwsgyvasslgdhfdh 754
Cdd:COG0419   360 --------EERLKELEERLEELEKELEKALERLKQ-LEEAIQELKEELAELSAALEEIQE-------------------- 410
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  755 itshatavsdELSLARLAQENSANDLEgELRQTQEHRDHWQDEAEQHRLAREQLEVEHDDLKATVQGHEERLASLALTHQ 834
Cdd:COG0419   411 ----------ELEELEKELEELERELE-ELEEEIKKLEEQINQLESKELMIAELAGAGEKCPVCGQELPEEHEKELLELY 479
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  835 ELEVSA-EEKEHLRAQLEQAHGRITELEKQIadhdatqAALKKLWQSLPAIDTRRRAGDSHDLATLKAAFDPSQSLGDSS 913
Cdd:COG0419   480 ELELEElEEELSREKEEAELREEIEELEKEL-------RELEEELIELLELEEALKEELEEKLEKLENLLEELEELKEKL 552
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  914 AQFSIDALVERVRALLTDDAKLVETLMKIEsgtaSAQQEVETHRSNAERYQNLAEQHSTNLTVTQSKVKDLEERIEVSSQ 993
Cdd:COG0419   553 QLQQLKEELRQLEDRLQELKELLEELRLLR----TRKEELEELRERLKELKKKLKELEERLSQLEELLQSLELSEAENEL 628
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  994 QAVtmLERLNDLTESLESTRAERRKLETAGKGLEGQVEAAEEEKNRLAAIVVGLKEENRAMKERPDHTAKLASLENTVQD 1073
Cdd:COG0419   629 EEA--EEELESELEKLNLQAELEELLQAALEELEEKVEELEAEIRRELQRIENEEQLEEKLEELEQLEEELEQLREELEE 706
                         570       580       590       600       610       620
                  ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 634349315 1074 LKDQLTDLEEELEDTKKR--EQKTRGQLLEELNAAQAEVSALRTKLRQAERKASKTLKMKA 1132
Cdd:COG0419   707 LLKKLGEIEQLIEELESRkaELEELKKELEKLEKALELLEELREKLGKAGLRADILRNLLA 767
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
913-1129 8.10e-10

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 64.35  E-value: 8.10e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  913 SAQFSIDALVERVRALLTDDAKLVETLMKIEsgtasaqQEVETHRSNAERYQNLAEQHSTNLTVTQSKVKDLEERIEVSS 992
Cdd:COG1196   236 ELRKELEELEEELSRLEEELEELQEELEEAE-------KEIEELKSELEELREELEELQEELLELKEEIEELEGEISLLR 308
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  993 QQAVTMLERLNDLTESLESTRAERRKLETAGKGLEGQVEAAEEEKNRLAAIVVGLKEENRAMKERPD-----HTAKLASL 1067
Cdd:COG1196   309 ERLEELENELEELEERLEELKEKIEALKEELEERETLLEELEQLLAELEEAKEELEEKLSALLEELEelfeaLREELAEL 388
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 634349315 1068 ENTVQDLKDQLTDLEEELEDTKKREQKTRGQ---LLEELNAAQAEVSALRTKLRQAERKASKTLK 1129
Cdd:COG1196   389 EAELAEIRNELEELKREIESLEERLERLSERledLKEELKELEAELEELQTELEELNEELEELEE 453
CCDC158 pfam15921
Coiled-coil domain-containing protein 158; CCDC158 is a family of proteins found in eukaryotes. ...
509-1135 5.03e-09

Coiled-coil domain-containing protein 158; CCDC158 is a family of proteins found in eukaryotes. The function is not known.


Pssm-ID: 318193 [Multi-domain]  Cd Length: 1112  Bit Score: 61.67  E-value: 5.03e-09
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   509 QVAGLQRALNEQRDRPIQQ--------VD-SAQLRELQEEVTQARAAERWARDEHTQTRNELDRHLMELSSIKnshgSLQ 579
Cdd:pfam15921   86 QVKDLQRRLNESNELHEKQkfylrqsvIDlQTKLQEMQMERDAMADIRRRESQSQEDLRNQLQNTVHELEAAK----CLK 161
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   580 RELEqtkqgqgqgEDAQRELERLRQEIDEMTDKMQELEQELNDLEEravASDRRVTDveglLEDMKIKHAHEMQRA---- 655
Cdd:pfam15921  162 EDML---------EDSNTQIEQLRKMMLSHEGVLQEIRSILVDFEE---ASGKKIYE----HDSMSTMHFRSLGSAiski 225
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   656 --QGDLQVAKEEAE----RARLAVARVPTPNGTEEEEQRLRDEVVSMRSERTKISQTLADVLQRHRAHANSLGTELpKDF 729
Cdd:pfam15921  226 lrELDTEISYLKGRifpvEDQLEALKSESQNKIELLLQQHQDRIEQLISEHEVEITGLTEKASSARSQANSIQSQL-EII 304
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   730 DETAVDHHddwSGYVAsslgdHFDHITSHATAVSDELSLARLAQENSANDLEGELRQTQEhrdhwqdEAEQHRLAREQLE 809
Cdd:pfam15921  305 QEQARNQN---SMYMR-----QLSDLESTVSQLRSELREAKRMYEDKIEELEKQLVLANS-------ELTEARTERDQFS 369
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   810 VEHDDLKATVQgheERLASLALTHQELEVSAEEKEHLRAQLEQAHGRITELEKQIADHDATQAALKKLwqsLPAIDTRRR 889
Cdd:pfam15921  370 QESGNLDDQLQ---KLLADLHKREKELSLEKEQNKRLWDRDTGNSITIDHLRRELDDRNMEVQRLEAL---LKAMKSECQ 443
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   890 AGDSHDLATLKAAfdpSQSLGDSSaqfSIDALVERVRALLTddaKLVETLmkiesgTASAQQEVETHRSNAERYQNLAEQ 969
Cdd:pfam15921  444 GQMERQMAAIQGK---NESLEKVS---SLTAQLESTKEMLR---KVVEEL------TAKKMTLESSERTVSDLTASLQEK 508
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   970 HSTnLTVTQSKVKDLEERIEVSSQQavtmLERLNDLTESLESTRAE--RRKLETAGKG-----LEGQVE----------- 1031
Cdd:pfam15921  509 ERA-IEATNAEITKLRSRVDLKLQE----LQHLKNEGDHLRNVQTEceALKLQMAEKDkvieiLRQQIEnmtqlvgqhgr 583
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  1032 ---AAEEEKNRLAAIVVGLK---EENRAMKERPDhtAKLASLENTVQDLKDQLTDL----EEELEDTKKREQKtRGQLLE 1101
Cdd:pfam15921  584 tagAMQVEKAQLEKEINDRRlelQEFKILKDKKD--AKIRELEARVSDLELEKVKLvnagSERLRAVKDIKQE-RDQLLN 660
                          650       660       670       680
                   ....*....|....*....|....*....|....*....|....*
gi 634349315  1102 ELNAAQAEVSAL-----------RTKLRQAERKASKtLKMKAPAA 1135
Cdd:pfam15921  661 EVKTSRNELNSLsedyevlkrnfRNKSEEMETTTNK-LKMQLKSA 704
sbcc TIGR00618
exonuclease SbcC; All proteins in this family for which functions are known are part of an ...
497-1104 3.75e-08

exonuclease SbcC; All proteins in this family for which functions are known are part of an exonuclease complex with sbcD homologs. This complex is involved in the initiation of recombination to regulate the levels of palindromic sequences in DNA. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). [DNA metabolism, DNA replication, recombination, and repair]


Pssm-ID: 129705 [Multi-domain]  Cd Length: 1042  Bit Score: 58.83  E-value: 3.75e-08
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   497 DTSHAAVRDLETQVAGLQRALNEQRdrpIQQVDSAQLRELQEEVTQARAAERWARDEHTQTRNELDRH------------ 564
Cdd:TIGR00618  215 DTYHERKQVLEKELKHLREALQQTQ---QSHAYLTQKREAQEEQLKKQQLLKQLRARIEELRAQEAVLeetqerinrark 291
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   565 ----------------------------LMELSSIKNSHGSLQRELEQTKQGQGQGEDAQRELERLRQEIDEMTDKMQEL 616
Cdd:TIGR00618  292 aaplaahikavtqieqqaqrihtelqskMRSRAKLLMKRAAHVKQQSSIEEQRRLLQTLHSQEIHIRDAHEVATSIREIS 371
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   617 EQELNDLEE-RAVASDRRV-TDVEGLL---------EDMKIKHAHEMQRA-QGDLQVAK--EEAERARLAVARVPTPNGT 682
Cdd:TIGR00618  372 CQQHTLTQHiHTLQQQKTTlTQKLQSLckeldilqrEQATIDTRTSAFRDlQGQLAHAKkqQELQQRYAELCAAAITCTA 451
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   683 EEEEQRLRDEVVSMRS--ERTKISQTLADVLQRH------RAHANSLGTELPKDFDETAVDHHddwsgyVASSLGDHFDH 754
Cdd:TIGR00618  452 QCEKLEKIHLQESAQSlkEREQQLQTKEQIHLQEtrkkavVLARLLELQEEPCPLCGSCIHPN------PARQDIDNPGP 525
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   755 ITSHATAVSDELSLARLAQENSANDLEGELRQTQEHRDHWQdEAEQHRLAREQLEVEHDDLKATVQGHEERLASLALTHQ 834
Cdd:TIGR00618  526 LTRRMQRGEQTYAQLETSEEDVYHQLTSERKQRASLKEQMQ-EIQQSFSILTQCDNRSKEDIPNLQNITVRLQDLTEKLS 604
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   835 ELEVSAEEKEH---LRAQLEQAHGRITELEKQIADHDA-TQAALKKLWQSLPAIDTRRRAGDSHDLATLK-----AAFDP 905
Cdd:TIGR00618  605 EAEDMLACEQHallRKLQPEQDLQDVRLHLQQCSQELAlKLTALHALQLTLTQERVREHALSIRVLPKELlasrqLALQK 684
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   906 SQSLGDSSAQF--SIDALVERVRALLTDDAKLVETLMKIESGTASAQQEVEthrsnaerYQNLAEQHSTNLTVTQ--SKV 981
Cdd:TIGR00618  685 MQSEKEQLTYWkeMLAQCQTLLRELETHIEEYDREFNEIENASSSLGSDLA--------AREDALNQSLKELMHQarTVL 756
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   982 KDLEERIEVSSQQAVTMLERLNDLTEsLESTRAERRKLETAGKGLEGQVEAAEEEKNRLAAIVVGLKEENRAMKERPDHT 1061
Cdd:TIGR00618  757 KARTEAHFNNNEEVTAALQTGAELSH-LAAEIQFFNRLREEDTHLLKTLEAEIGQEIPSDEDILNLQCETLVQEEEQFLS 835
                          650       660       670       680
                   ....*....|....*....|....*....|....*....|....*
gi 634349315  1062 aKLASLENTVQDLKDQLTDLEEELE--DTKKREQKTRGQLLEELN 1104
Cdd:TIGR00618  836 -RLEEKSATLGEITHQLLKYEECSKqlAQLTQEQAKIIQLSDKLN 879
CCDC158 pfam15921
Coiled-coil domain-containing protein 158; CCDC158 is a family of proteins found in eukaryotes. ...
532-1109 9.11e-08

Coiled-coil domain-containing protein 158; CCDC158 is a family of proteins found in eukaryotes. The function is not known.


Pssm-ID: 318193 [Multi-domain]  Cd Length: 1112  Bit Score: 57.44  E-value: 9.11e-08
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   532 QLRELQEEVTQARAAERWARDEHTQTRNELDRHLMelssIKNSHGSLQR-ELEQTKQGQGQGEDaqrELERLRQEIDEmT 610
Cdd:pfam15921  318 QLSDLESTVSQLRSELREAKRMYEDKIEELEKQLV----LANSELTEARtERDQFSQESGNLDD---QLQKLLADLHK-R 389
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   611 DKMQELEQELND-LEERAVASD------RRVTD--------VEGLLEDMKIKHAHEMQRAQGDLQVAKEEAERARLAVAR 675
Cdd:pfam15921  390 EKELSLEKEQNKrLWDRDTGNSitidhlRRELDdrnmevqrLEALLKAMKSECQGQMERQMAAIQGKNESLEKVSSLTAQ 469
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   676 VPTpngTEEEEQRLRDEVVSMR-----SERTkISQTLADVLQRHRA--HANSLGTELPK--DFDETAVDHhddwsgyvAS 746
Cdd:pfam15921  470 LES---TKEMLRKVVEELTAKKmtlesSERT-VSDLTASLQEKERAieATNAEITKLRSrvDLKLQELQH--------LK 537
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   747 SLGDHFDHITSHATAVSdelslARLAQENSANDLegeLRQTQEHRDHWqdeAEQHRLAREQLEVEHDDLkatvqghEERL 826
Cdd:pfam15921  538 NEGDHLRNVQTECEALK-----LQMAEKDKVIEI---LRQQIENMTQL---VGQHGRTAGAMQVEKAQL-------EKEI 599
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   827 ASLALTHQELEVSAEEKEhlraqleqahGRITELEKQIADHDATQAALkklwqsLPAIDTRRRAgdshdLATLKAAFDps 906
Cdd:pfam15921  600 NDRRLELQEFKILKDKKD----------AKIRELEARVSDLELEKVKL------VNAGSERLRA-----VKDIKQERD-- 656
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   907 QSLGD-SSAQFSIDALVERV----RALLTDDAKLVETLMKIESGTASAQQEVETHRSNAERYQNlAEQHSTNLTVtqskv 981
Cdd:pfam15921  657 QLLNEvKTSRNELNSLSEDYevlkRNFRNKSEEMETTTNKLKMQLKSAQSELEQTRNTLKSMEG-SDGHAMKVAM----- 730
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   982 kDLEERIEVSSQQAVTMLERLNDLTESLESTRAERRKLETAGKGLEGQVEAAEEEKNRLAAIVVGLKEENRAMKErpdht 1061
Cdd:pfam15921  731 -GMQKQITAKRGQIDALQSKIQFLEEAMTNANKEKHFLKEEKNKLSQELSTVATEKNKMAGELEVLRSQERRLKE----- 804
                          570       580       590       600
                   ....*....|....*....|....*....|....*....|....*...
gi 634349315  1062 aKLASLENTVQDLKDQLTDLEEELEdtKKREQKTRGQLLEELNAAQAE 1109
Cdd:pfam15921  805 -KVANMEVALDKASLQFAECQDIIQ--RQEQESVRLKLQHTLDVKELQ 849
PRK02224 PRK02224
DNA double-strand break repair Rad50 ATPase;
778-1221 1.39e-07

DNA double-strand break repair Rad50 ATPase;


Pssm-ID: 179385 [Multi-domain]  Cd Length: 880  Bit Score: 56.97  E-value: 1.39e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  778 NDLEGELRQTQEHRDHWQDEAEQhrlAREQLevehDDLKATVQGHEERLASLALTHQELEVSAE-------EKEHLRAQL 850
Cdd:PRK02224  209 NGLESELAELDEEIERYEEQREQ---ARETR----DEADEVLEEHEERREELETLEAEIEDLREtiaeterEREELAEEV 281
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  851 EQAHGRITELEKQIADHDATqAALKKLwqSLPAIDTRRRAGDSHDLATLKAAFDPSQSLGDSSAQfsIDALVERVRALLT 930
Cdd:PRK02224  282 RDLRERLEELEEERDDLLAE-AGLDDA--DAEAVEARREELEDRDEELRDRLEECRVAAQAHNEE--AESLREDADDLEE 356
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  931 DDAKLVETLMKIESGTASAQQEVETHRSNAERYQNLAEQHSTNLTVTQSKVKDLEERIEVSSQQAVTMLERLNDLTESLE 1010
Cdd:PRK02224  357 RAEELREEAAELESELEEAREAVEDRREEIEELEEEIEELRERFGDAPVDLGNAEDFLEELREERDELREREAELEATLR 436
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315 1011 STR---AERRKLETAGKGLE-GQ----------VEAAEEEKNRLAAIVVGLKEENRAMKERPDHTAKLASLENTVQDLKD 1076
Cdd:PRK02224  437 TARervEEAEALLEAGKCPEcGQpvegsphvetIEEDRERVEELEAELEDLEEEVEEVEERLERAEDLVEAEDRIERLEE 516
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315 1077 QLTDLEEELEDTKKREQKTRGQLlEELNAAQAEvsaLRTKLRQAERKASKtlkmkAPAAYVAGLGRGASGFTTRSDIGPA 1156
Cdd:PRK02224  517 RREDLEELIAERRETIEEKRERA-EELRERAAE---LEAEAEEKREAAAE-----AEEEAEEAREEVAELNSKLAELKER 587
                         410       420       430       440       450       460
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 634349315 1157 REQVTD-EAAEDKNAGRGEEIdGDLPDRYQDpenetglfagmVYEADDEEADRIYEavdaqmdeRR 1221
Cdd:PRK02224  588 IESLERiRTLLAAIADAEDEI-ERLREKREA-----------LAELNDERRERLAE--------KR 633
Myosin_tail_1 pfam01576
Myosin tail; The myosin molecule is a multi-subunit complex made up of two heavy chains and ...
505-1105 1.62e-07

Myosin tail; The myosin molecule is a multi-subunit complex made up of two heavy chains and four light chains it is a fundamental contractile protein found in all eukaryote cell types. This family consists of the coiled-coil myosin heavy chain tail region. The coiled-coil is composed of the tail from two molecules of myosin. These can then assemble into the macromolecular thick filament. The coiled-coil region provides the structural backbone the thick filament.


Pssm-ID: 396244 [Multi-domain]  Cd Length: 1081  Bit Score: 56.72  E-value: 1.62e-07
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   505 DLETQVAGLQRALNEQRdrpiqqvdsAQLRELQEEVTQARAAerwaRDEHTQTRNELDRHLMELssiKNSHGSLQRELEQ 584
Cdd:pfam01576  219 DLQEQIAELQAQIEELR---------AQLAKKEEELQAALAR----LEEEGAQKNNALKKLREL---QAQIAELQEDLES 282
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   585 TKQGQGQGEDAQR----ELERLRQEIDEMTDK---MQEL----EQELNDLEeRAVASDRRVTDVEglLEDMKIKHAHEMQ 653
Cdd:pfam01576  283 ERAARAKAEKQRRdlgeELEALKTELEDTLDStaaQQELrskrEQEVTELK-KALEEETRSHEAQ--LQEMRQKHTQALE 359
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   654 RAQGDLQVAKeeaeRARLAVarvptpngtEEEEQRLRDEVVSMRSERTKISQTLADVLQRhRAHANSLGTELPKDFDETA 733
Cdd:pfam01576  360 ELSEQLEQAK----RNKANL---------EKAKQALESENNELQAELKTLQQAKQDSEHK-RKKLEGQLQELQARLSESE 425
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   734 vdhhddwsgYVASSLGDHFDHITSHATAVSDELSLA-----RLAQENSAndLEGELRQTQEhrdhwqdeaeqhrlareql 808
Cdd:pfam01576  426 ---------RQRAELAEKLSKLQSELESVSGLLSEAegksiKLSKDVSS--LESQLQDTQE------------------- 475
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   809 evehddlkatvQGHEERLASLALTHQeLEVSAEEKEHLRAQLEQAHGRITELEKQIADHDATQAALKKLWQSlpaidtrr 888
Cdd:pfam01576  476 -----------LLQEETRQKLNLSSR-LRQLEDERNSLQEQLEEEEEAKRNVERQLSTLQAQLSEMKKKLEE-------- 535
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   889 ragdshDLATLKAAFDpsqslGDSSAQFSIDALVERvralLTDDAKLVEtlmKIESGTASAQQEVE-------THR---S 958
Cdd:pfam01576  536 ------DAGAVEALEE-----AKKRLQRELEALTQR----LEEKAAAYD---KLEKTKNRLQQELDdllvdldHQRqlvS 597
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   959 NAERYQNLAEQHSTNLTVTQSKVKDLEERIEVSSQQAVTmleRLNDLTESLESTRAERRKLETAGKGLEGQVEAAEEEKN 1038
Cdd:pfam01576  598 NLEKKQKKFDQMLAEEKAISARYAEERDRAEAEAREKET---RALSLSRALEEALEAKEELERQNKQLRAEMEDLVSSKD 674
                          570       580       590       600       610       620       630
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 634349315  1039 RLAAIVVGLKEENRAMkerpdhtaklaslENTVQDLKDQLTDLEEEL---EDTKKR----EQKTRGQLLEELNA 1105
Cdd:pfam01576  675 DVGKNVHELERSKRAL-------------EQQVEEMKTQLEELEDELqatEDAKLRlevnMQALKAQFERDLQA 735
mukB PRK04863
chromosome partition protein MukB;
527-877 2.31e-07

chromosome partition protein MukB;


Pssm-ID: 235316 [Multi-domain]  Cd Length: 1486  Bit Score: 56.12  E-value: 2.31e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  527 QVDSAQLRELQEEVTQARAAErWARdehtqTRNELDRHLMELSSIKNSHGSLQRELEqtkqgqgqgeDAQRELERLRQEI 606
Cdd:PRK04863  253 QSDRDLFKHLITESTNYVAAD-YMR-----HANERRVHLEEALELRRELYTSRRQLA----------AEQYRLVEMAREL 316
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  607 DEMTDKMQELEQELNDleeravASDRRVTDVEGLLEDMKIkhahemQRAQGDLQVAKEEAERARLAVARVptPNGTEEEE 686
Cdd:PRK04863  317 AELNEAESDLEQDYQA------ASDHLNLVQTALRQQEKI------ERYQADLEELEERLEEQNEVVEEA--DEQQEENE 382
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  687 QRLR---DEVVSMRSERTKISQTLaDVLQRhRA-----------------HANSLGTELPKDFDETAVDHHDDWSGYV-- 744
Cdd:PRK04863  383 ARAEaaeEEVDELKSQLADYQQAL-DVQQT-RAiqyqqavqalerakqlcGLPDLTADNAEDWLEEFQAKEQEATEELls 460
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  745 -ASSLGDHFDHITSHATAVSDELSLA----RLAQENSANDLEGELRQ-----------TQEHRDHWQDEAEQHRLAR--- 805
Cdd:PRK04863  461 lEQKLSVAQAAHSQFEQAYQLVRKIAgevsRSEAWDVARELLRRLREqrhlaeqlqqlRMRLSELEQRLRQQQRAERlla 540
                         330       340       350       360       370       380       390
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 634349315  806 ------EQLEVEHDDLKATVQGHEERLASLAlthQELEVSAEEKEHLRAQLEQAHGRITELEKQIADHDATQAALKKL 877
Cdd:PRK04863  541 efckrlGKNLDDEDELEQLQEELEARLESLS---ESVSEARERRMALRQQLEQLQARIQRLAARAPAWLAAQDALARL 615
SbcC COG0419
DNA repair exonuclease SbcCD ATPase subunit [Replication, recombination and repair];
932-1131 4.47e-07

DNA repair exonuclease SbcCD ATPase subunit [Replication, recombination and repair];


Pssm-ID: 223496 [Multi-domain]  Cd Length: 908  Bit Score: 55.15  E-value: 4.47e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  932 DAKLVETLMKIESGTASAQQEVETHRSNAERYQNLAEQhstnltVTQSKVKDLEERIEvSSQQAVTMLERLNDLTESLES 1011
Cdd:COG0419   191 EGQLSELLEDIEDLLEALEEELKELKKLEEIQEEQEEE------ELEQEIEALEERLA-ELEEEKERLEELKARLLEIES 263
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315 1012 TRAE-RRKLETAGKGLEGQVEAAEEEKNRLAAIVVGLKEENRAMKERPDHTAKLASLENTVQDLKDQLTDLEEELEDTKK 1090
Cdd:COG0419   264 LELEaLKIREEELRELERLLEELEEKIERLEELEREIEELEEELEGLRALLEELEELLEKLKSLEERLEKLEEKLEKLES 343
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|.
gi 634349315 1091 REQKTRGQLLEELNAAQAEVSALRTKLRQAERKASKTLKMK 1131
Cdd:COG0419   344 ELEELAEEKNELAKLLEERLKELEERLEELEKELEKALERL 384
sbcc TIGR00618
exonuclease SbcC; All proteins in this family for which functions are known are part of an ...
565-1131 4.69e-07

exonuclease SbcC; All proteins in this family for which functions are known are part of an exonuclease complex with sbcD homologs. This complex is involved in the initiation of recombination to regulate the levels of palindromic sequences in DNA. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). [DNA metabolism, DNA replication, recombination, and repair]


Pssm-ID: 129705 [Multi-domain]  Cd Length: 1042  Bit Score: 55.36  E-value: 4.69e-07
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   565 LMELSSIKNSHGSLQRELEQTKQGQGQGEDAQRELERLRQEIDEMTDKMQELEQELNDLEERAVASDRRVTDVEGLLEDm 644
Cdd:TIGR00618  169 LMNLFPLDQYTQLALMEFAKKKSLHGKAELLTLRSQLLTLCTPCMPDTYHERKQVLEKELKHLREALQQTQQSHAYLTQ- 247
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   645 KIKHAHEMQRAQGDLQVAKEEAERARLAVARVPTPNgtEEEEQRLRDEVVSMRSER-TKISQTLADVLQRHRAHANSLGT 723
Cdd:TIGR00618  248 KREAQEEQLKKQQLLKQLRARIEELRAQEAVLEETQ--ERINRARKAAPLAAHIKAvTQIEQQAQRIHTELQSKMRSRAK 325
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   724 ELPKdfdetavdhhddwsgyvasslgdhfdhitshatavsdelSLARLAQENSANDLEGELRQTQEHRDHWQDEAEQHRL 803
Cdd:TIGR00618  326 LLMK---------------------------------------RAAHVKQQSSIEEQRRLLQTLHSQEIHIRDAHEVATS 366
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   804 AREQLEVEHDDlkatvqghEERLASLAlthQELEVSAEEKEHLRAQLEQahgrITELEKQIADHDATQAALKKlwqslpa 883
Cdd:TIGR00618  367 IREISCQQHTL--------TQHIHTLQ---QQKTTLTQKLQSLCKELDI----LQREQATIDTRTSAFRDLQG------- 424
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   884 idtrrragdshDLATLKAAFDPSQSLGDSSAQFSIDALVE---RVRALLTDDAKLVETLMKIESGTASAQQEVETHRSNA 960
Cdd:TIGR00618  425 -----------QLAHAKKQQELQQRYAELCAAAITCTAQCeklEKIHLQESAQSLKEREQQLQTKEQIHLQETRKKAVVL 493
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   961 ERYQNLAEQHstnltvtqskvKDLEERiEVSSQQAVTMLERLNDLTESLESTRAERRKLETAGKGLEGQVeaaEEEKNRL 1040
Cdd:TIGR00618  494 ARLLELQEEP-----------CPLCGS-CIHPNPARQDIDNPGPLTRRMQRGEQTYAQLETSEEDVYHQL---TSERKQR 558
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  1041 AAivvgLKEEnraMKERPDHTAKLASLENTVQDLKDQLTDLEEELEDTKKREQKTRGQLLEELNA--AQAEVSALRTKLR 1118
Cdd:TIGR00618  559 AS----LKEQ---MQEIQQSFSILTQCDNRSKEDIPNLQNITVRLQDLTEKLSEAEDMLACEQHAllRKLQPEQDLQDVR 631
                          570
                   ....*....|...
gi 634349315  1119 QAERKASKTLKMK 1131
Cdd:TIGR00618  632 LHLQQCSQELALK 644
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
957-1135 4.70e-07

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 55.11  E-value: 4.70e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  957 RSNAERYQNL-AEQHSTNLTVTQSKVKDLEERIEvssqqavTMLERLNDLTESLESTRAERRKLETAGKGLEGQVEAAEE 1035
Cdd:COG1196   209 AEKAERYQELkAELRELELALLLAKLKELRKELE-------ELEEELSRLEEELEELQEELEEAEKEIEELKSELEELRE 281
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315 1036 EKNRLAAIVVGLKEEnramkerpdhtakLASLENTVQDLKDQLTDLEEELEDTKKREQktrgQLLEELNAAQAEVSALRT 1115
Cdd:COG1196   282 ELEELQEELLELKEE-------------IEELEGEISLLRERLEELENELEELEERLE----ELKEKIEALKEELEERET 344
                         170       180
                  ....*....|....*....|
gi 634349315 1116 KLRQAERKASKTLKMKAPAA 1135
Cdd:COG1196   345 LLEELEQLLAELEEAKEELE 364
SbcC COG0419
DNA repair exonuclease SbcCD ATPase subunit [Replication, recombination and repair];
836-1126 5.39e-07

DNA repair exonuclease SbcCD ATPase subunit [Replication, recombination and repair];


Pssm-ID: 223496 [Multi-domain]  Cd Length: 908  Bit Score: 54.77  E-value: 5.39e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  836 LEVSAEEKEHLRAQLEQAhGRITELEKQIAD-HDATQAALKKLWQSLPAIDTRRRagdsHDLATLKAAFDPSQSLGDSSA 914
Cdd:COG0419   149 LKSKPKERKEILDELFGL-EKYEKLSELLKEvIKEAKAKIEELEGQLSELLEDIE----DLLEALEEELKELKKLEEIQE 223
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  915 QFSIDALVERVRALLTDDAKLVETLMKIESGTASAQQEVETHRSNAERYQNLAEQHSTNLTVTQSKVKDLEERIEvSSQQ 994
Cdd:COG0419   224 EQEEEELEQEIEALEERLAELEEEKERLEELKARLLEIESLELEALKIREEELRELERLLEELEEKIERLEELER-EIEE 302
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  995 AVTMLERLNDLTESLESTRAERRKLETAGKGLEGQVEAAEEEKNRLAAivvgLKEENRAMKERPDHTA--KLASLENTVQ 1072
Cdd:COG0419   303 LEEELEGLRALLEELEELLEKLKSLEERLEKLEEKLEKLESELEELAE----EKNELAKLLEERLKELeeRLEELEKELE 378
                         250       260       270       280       290
                  ....*....|....*....|....*....|....*....|....*....|....*..
gi 634349315 1073 DLKDQLTDLEEELEDTKKREQKTRGQLL---EELNAAQAEVSALRTKLRQAERKASK 1126
Cdd:COG0419   379 KALERLKQLEEAIQELKEELAELSAALEeiqEELEELEKELEELERELEELEEEIKK 435
rad50 TIGR00606
rad50; All proteins in this family for which functions are known are involvedin recombination, ...
537-1126 3.10e-06

rad50; All proteins in this family for which functions are known are involvedin recombination, recombinational repair, and/or non-homologous end joining.They are components of an exonuclease complex with MRE11 homologs. This family is distantly related to the SbcC family of bacterial proteins.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).


Pssm-ID: 129694 [Multi-domain]  Cd Length: 1311  Bit Score: 52.74  E-value: 3.10e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   537 QEEVTQARAAERWARDEHTQTRNELDRHLMELSSIKNSHGSLQRELEQTKQGQGQGEDAQRELERLRQEIDEMTDKMQEL 616
Cdd:TIGR00606  188 LETLRQVRQTQGQKVQEHQMELKYLKQYKEKACEIRDQITSKEAQLESSREIVKSYENELDPLKNRLKEIEHNLSKIMKL 267
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   617 EQELNDLEERAVASDRRVTDVEGLLEDMKIKHAHEMQRAQGDLQVAKEEAERARlavARVPTPNGTEEEEQRLRDEVVSM 696
Cdd:TIGR00606  268 DNEIKALKSRKKQMEKDNSELELKMEKVFQGTDEQLNDLYHNHQRTVREKEREL---VDCQRELEKLNKERRLLNQEKTE 344
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   697 RSERTKISQTLADVLQRHRAHANSLGTELPKDFDETAVDHH-------DDWSGYVASSLGDHFDHITSHATAVSDELSLA 769
Cdd:TIGR00606  345 LLVEQGRLQLQADRHQEHIRARDSLIQSLATRLELDGFERGpfserqiKNFHTLVIERQEDEAKTAAQLCADLQSKERLK 424
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   770 RLAQENSANDLEGELRQTQEHRDHWQDEAEQHRLAR---EQLEVEHDDLKATVQGHEERLASLALTHQELEVSAEEKEHL 846
Cdd:TIGR00606  425 QEQADEIRDEKKGLGRTIELKKEILEKKQEELKFVIkelQQLEGSSDRILELDQELRKAERELSKAEKNSLTETLKKEVK 504
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   847 RAQLEQAhgritELEKQIADHDATQAALKKLWQSLPAIDTRRRAGDSHDLATLKAAFDPSQSLGDSSAQFSIDALVERVR 926
Cdd:TIGR00606  505 SLQNEKA-----DLDRKLRKLDQEMEQLNHHTTTRTQMEMLTKDKMDKDEQIRKIKSRHSDELTSLLGYFPNKKQLEDWL 579
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   927 ALLTDDAKLV-ETLMKIESGTASAQQEVETHRSNAERYQNLAEQHSTNL------TVTQSKVKDLEERIEVSSQQAVTM- 998
Cdd:TIGR00606  580 HSKSKEINQTrDRLAKLNKELASLEQNKNHINNELESKEEQLSSYEDKLfdvcgsQDEESDLERLKEEIEKSSKQRAMLa 659
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   999 ---------LERLND------------------LTESLESTRAERRKLETAGKGLEGQVEAAEEEKNRLAAIVVGLKEE- 1050
Cdd:TIGR00606  660 gatavysqfITQLTDenqsccpvcqrvfqteaeLQEFISDLQSKLRLAPDKLKSTESELKKKEKRRDEMLGLAPGRQSIi 739
                          570       580       590       600       610       620       630
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 634349315  1051 NRAMKERPDHTAKLASLENTVQDLKDQLTDLEEELEdTKKREQKTRGQLLEELNAAQAEVSALRTKLRQAERKASK 1126
Cdd:TIGR00606  740 DLKEKEIPELRNKLQKVNRDIQRLKNDIEEQETLLG-TIMPEEESAKVCLTDVTIMERFQMELKDVERKIAQQAAK 814
SCP-1 pfam05483
Synaptonemal complex protein 1 (SCP-1); Synaptonemal complex protein 1 (SCP-1) is the major ...
496-819 3.30e-06

Synaptonemal complex protein 1 (SCP-1); Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex. Synaptonemal complexes are structures that are formed between homologous chromosomes during meiotic prophase.


Pssm-ID: 114219 [Multi-domain]  Cd Length: 787  Bit Score: 52.42  E-value: 3.30e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   496 ADTSHA-AVRDLETQVAGLQRALNEQRDRPIQQVDsaQLRELQEEVtQARAAErwardehtqtrneldrhLMELSSIKNS 574
Cdd:pfam05483  343 AKAAHSfVVTEFEATTCSLEELLRTEQQRLEKNED--QLKIITMEL-QKKSSE-----------------LEEMTKFKNN 402
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   575 HgslQRELEQTKQGQGQGEDAQRELERLRQEIDEMTDKMQEL-------EQELNDLEERAVASD-------RRVTDVEGL 640
Cdd:pfam05483  403 K---EVELEELKKILAEDEKLLDEKKQFEKIAEELKGKEQELifllqarEKEIHDLEIQLTAIKtseehylKEVEDLKTE 479
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   641 LEDMKIKHAH------------------------EMQRAQGDLQVAKEEAERARLAVARVptpngtEEEEQRLRDEVVSM 696
Cdd:pfam05483  480 LEKEKLKNIEltahcdklllenkeltqeasdmtlELKKHQEDIINCKKQEERMLKQIENL------EEKEMNLRDELESV 553
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   697 RSERTKISQTLADVLQRHRAHANSLGTELPKDFDETAVDHH---------DDWSGYVaSSLGDHFDHITSHATAVSDELS 767
Cdd:pfam05483  554 REEFIQKGDEVKCKLDKSEENARSIEYEVLKKEKQMKILENkcnnlkkqiENKNKNI-EELHQENKALKKKGSAENKQLN 632
                          330       340       350       360       370
                   ....*....|....*....|....*....|....*....|....*....|....*.
gi 634349315   768 larlAQENSANDLEGELRQTQ----EHRDHWQDEAEQHRLAREQLEVEHDDLKATV 819
Cdd:pfam05483  633 ----AYEIKVNKLELELASAKqkfeEIIDNYQKEIEDKKISEEKLLEEVEKAKAIA 684
YhaN COG4717
Uncharacterized protein YhaN, contains AAA domain [Function unknown];
501-1090 3.43e-06

Uncharacterized protein YhaN, contains AAA domain [Function unknown];


Pssm-ID: 227061 [Multi-domain]  Cd Length: 984  Bit Score: 52.15  E-value: 3.43e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  501 AAVRDLETQVAGLQRALNEQRDRPIQQvDSAQLRELQEEVTQARAAERWARDEHTQTRN---ELDRHLMELSSIKNSHGS 577
Cdd:COG4717   298 AELKDLASQLIPAKEAVLQALVRLHQQ-LSEIKASAFELTETLAGIEADLRDKEEAAGNgfeAERVHDLRSLECMLRYQS 376
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  578 LQRELEQTKQGQGQgedaqrELERLRQEIDEMTDKmqELEQELNDLEERAVASdrrvtdvEGLLEdmkiKHAHEMQRaqg 657
Cdd:COG4717   377 SQRELKQTEAAYCK------RLDEKRLFEDEAEEE--ARQRLADDEEEVRAGD-------EAREE----KIAANSQV--- 434
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  658 dlqVAKEEAERARLAVarvptpNGTEEEEQRLRDEVVSMRSERTKISQTLADVLQRHRAHANSLGTELPKDFDETAVDHH 737
Cdd:COG4717   435 ---IDKEEVCNLYDRR------DTAWQKQRFLREKQTAFERQKTEHTKIIALRLAGMLLVALSRLLTSLIFQIIFAVAQI 505
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  738 DDWSGYVASSLGDHFDhitSHATAVSDELSLARLAQENSANDLEGELRQTQEHRDHWQ---DEAEQHRLAREQLE----- 809
Cdd:COG4717   506 VFLSAEIKSSSRAVRE---EKAAVTDIPEELARLLITDELPELAVDLLVQSRIRQHWQqlrKALDQLEAAYEALEgrfaa 582
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  810 --VEHDDLKATVqghEERLASLALTHQElevsaeEKEHLRAQLeQAHGRITELEKQIADHDATQAALKKlwqslpaidtR 887
Cdd:COG4717   583 aeAAMAEWQSEW---EEALDELGLSREL------SPEQQLDIL-STMKDLKKLMQKKAELTHQVARLRE----------E 642
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  888 RRAGDSHdlatlKAAFDPSQSLGDSSAQFSIDALVERV-RALLTDDAKLVETLMKIESGTASAQQEVETHRSNAERYQNL 966
Cdd:COG4717   643 QAAFEER-----VEGLLAVLEAQFIDLSTLFCVQRLRVaAELQKEEARLALEGNIERTKELNDELRAELELHRKEILDLF 717
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  967 AeqhstnltvtQSKVKDLEERIEVS--SQQAVTMLERLNDLTESLESTRAERRKLETAgkglEGQVEAAEEEKNRLAAIV 1044
Cdd:COG4717   718 D----------CGTADTEDAFREAAreEQQLTQRESRLESLEAQLEGVAAEAYELSAS----LDQRELKEEELALLEEAI 783
                         570       580       590       600
                  ....*....|....*....|....*....|....*....|....*....
gi 634349315 1045 VGLKEENRAMK-ERPDHTAKLASLE--NTVQDLKDQLTDLEEELEDTKK 1090
Cdd:COG4717   784 DALDEEVEELHaQVAALSRQIAQLEggGTVAELRQRRESLKEDLEEKAR 832
PRK09039 PRK09039
peptidoglycan -binding protein;
978-1109 7.01e-06

peptidoglycan -binding protein;


Pssm-ID: 181619 [Multi-domain]  Cd Length: 343  Bit Score: 50.35  E-value: 7.01e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  978 QSKVKDLEERIEVSSQQAVTMLERLNDLTESLESTRAERRKLETAGKGLEGQVEAAEEEKNRLAAIVvglkEENRAMKER 1057
Cdd:PRK09039   59 NSQIAELADLLSLERQGNQDLQDSVANLRASLSAAEAERSRLQALLAELAGAGAAAEGRAGELAQEL----DSEKQVSAR 134
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....*
gi 634349315 1058 PDhtAKLASLENTVQDLKDQLTDLEEELEDTKKREQKTRGQ---LLEELNAAQAE 1109
Cdd:PRK09039  135 AL--AQVELLNQQIAALRRQLAALEAALDASEKRDRESQAKiadLGRRLNVALAQ 187
mukB PRK04863
chromosome partition protein MukB;
777-1115 8.29e-06

chromosome partition protein MukB;


Pssm-ID: 235316 [Multi-domain]  Cd Length: 1486  Bit Score: 51.11  E-value: 8.29e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  777 ANDLEGELRQTQEHRDHWQD-----EAEQHRL---ARE--QLEVEHDDLKATVQGHEERLASL--ALTHQE--------- 835
Cdd:PRK04863  278 ANERRVHLEEALELRRELYTsrrqlAAEQYRLvemARElaELNEAESDLEQDYQAASDHLNLVqtALRQQEkieryqadl 357
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  836 -------------LEVSAEEKEHLRAQLEQAHGRITELEKQIADHdatQAALKKLwqslpaidtRRRAGDSHDlatLKAA 902
Cdd:PRK04863  358 eeleerleeqnevVEEADEQQEENEARAEAAEEEVDELKSQLADY---QQALDVQ---------QTRAIQYQQ---AVQA 422
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  903 FDPSQSLGDSSAqFSIDALVERVRALLTDDAKLVETLMKIESGTASAQQEVETHRSNAERYQNLAEQHSTNLT--VTQSK 980
Cdd:PRK04863  423 LERAKQLCGLPD-LTADNAEDWLEEFQAKEQEATEELLSLEQKLSVAQAAHSQFEQAYQLVRKIAGEVSRSEAwdVAREL 501
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  981 VKDLEE-RIEVSSQQAVTMleRLNDLTESLESTRAERRKLETAGKGLeGQVEAAEEEKNRLAAivvglkeenramkerpD 1059
Cdd:PRK04863  502 LRRLREqRHLAEQLQQLRM--RLSELEQRLRQQQRAERLLAEFCKRL-GKNLDDEDELEQLQE----------------E 562
                         330       340       350       360       370
                  ....*....|....*....|....*....|....*....|....*....|....*.
gi 634349315 1060 HTAKLASLENTVQDLKDQLTDLEEELEDTKKREQKTRGQLLEELnAAQAEVSALRT 1115
Cdd:PRK04863  563 LEARLESLSESVSEARERRMALRQQLEQLQARIQRLAARAPAWL-AAQDALARLRE 617
PEP_TPR_lipo TIGR02917
putative PEP-CTERM system TPR-repeat lipoprotein; This protein family occurs in strictly ...
1315-1864 8.99e-06

putative PEP-CTERM system TPR-repeat lipoprotein; This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator.


Pssm-ID: 274350 [Multi-domain]  Cd Length: 899  Bit Score: 50.85  E-value: 8.99e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  1315 TKTSMNALTDFAEIGQAREKMLSIKLEQQAGTDSVSGSTTIDPKGYLTGLQSQVLKTATeiGDIKRARQLLQSLTKTNPK 1394
Cdd:TIGR02917  114 PGKTLLDDEGAAELLALRGLAYLGLGQLELAQKSYEQALAIDPRSLYAKLGLAQLALAE--NRFDEARALIDEVLTADPG 191
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  1395 HAPGWVAAAWLENVAGKSVQARKIIAEGCQHCPKNEDVWIAAS----ELNTNDNAKVILANAVQELPQSVR-------IW 1463
Cdd:TIGR02917  192 NVDALLLKGDLLLSLGNIELALAAYRKAIALRPNNIAVLLALAtiliEAGEFEEAEKHADALLKKAPNSPLahylkalVD 271
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  1464 MRAVELENDPSAKKRVLRKALEYIPAsVKLWKETVKREENPEDARILLARAVEVIPHSQELWLALA----RLETPDRARQ 1539
Cdd:TIGR02917  272 FQKKNYEDARETLQDALKSAPEYLPA-LLLAGASEYQLGNLEQAYQYLNQILKYAPNSHQARRLLAsiqlRLGRVDEAIA 350
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  1540 VLNKARKTIPTSHEIWIAAGRLQEQEGNTSQVDAIIANgVTALK-KNGAILTRE--QWLGEAERCESAGSIVTAQAI--- 1613
Cdd:TIGR02917  351 TLSPALGLDPDDPAALSLLGEAYLALGDFEKAAEYLAK-ATELDpENAAARTQLgiSKLSQGDPSEAIADLETAAQLdpe 429
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  1614 ------LKATLHLDVEEEDR----LERWLE----DAQTMTSKGLIgcaraifaYSLNVFPQK-QALWRKAAELEKAHgtr 1678
Cdd:TIGR02917  430 lgradlLLILSYLRSGQFDKalaaAKKLEKkqpdNASLHNLLGAI--------YLGKGDLAKaREAFEKALSIEPDF--- 498
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  1679 etllallnkavesVPQAEVLWLMAAKEswlgGDVPGARAILGRAFEANPESEGIWLAAAKLEAENGQIEAARELMRRAVE 1758
Cdd:TIGR02917  499 -------------FPAAANLARIDIQE----GNPDDAIQRFEKVLTIDPKNLRAILALAGLYLRTGNEEEAVAWLEKAAE 561
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  1759 RVGTE-RIWIKSAVFERQHATADSALSTAKAGLAKYDRSAKLYLIHAQLLLAQEppATNAAREVLATAAKKCPTSVPIWL 1837
Cdd:TIGR02917  562 LNPQEiEPALALAQYYLGKGQLKKALAILNEAADAAPDSPEAWLMLGRAQLAAG--DLNKAVSSFKKLLALQPDSALALL 639
                          570       580
                   ....*....|....*....|....*..
gi 634349315  1838 LASRLEENIGLRIKARALLEKARNLNP 1864
Cdd:TIGR02917  640 LLADAYAVMKNYAKAITSLKRALELKP 666
Myosin_tail_1 pfam01576
Myosin tail; The myosin molecule is a multi-subunit complex made up of two heavy chains and ...
773-1129 1.79e-05

Myosin tail; The myosin molecule is a multi-subunit complex made up of two heavy chains and four light chains it is a fundamental contractile protein found in all eukaryote cell types. This family consists of the coiled-coil myosin heavy chain tail region. The coiled-coil is composed of the tail from two molecules of myosin. These can then assemble into the macromolecular thick filament. The coiled-coil region provides the structural backbone the thick filament.


Pssm-ID: 396244 [Multi-domain]  Cd Length: 1081  Bit Score: 50.17  E-value: 1.79e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   773 QENSANDLEGELRQTQEHRDHWQDEAEQHRLAREQLEVEHDDLKATVQGHEERLasLALTHQELEVSAEEKehlraQLEQ 852
Cdd:pfam01576   87 EEERSQQLQNEKKKMQQHIQDLEEQLEEEEAARQKLQLEKVTTEAKIKKLEEDI--LLLEDQNSKLSKERK-----LLEE 159
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   853 ahgRITELEKQIADHDATQAALKKL---------------------WQSLPAIdTRRRAGDSHDLATLKAafDPSQSLGD 911
Cdd:pfam01576  160 ---RISEFTSNLAEEEEKVKSLNKLknkheamisdledrlkkeekgRQELEKA-KRKLDGESTDLQEQIA--ELQAQIEE 233
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   912 SSAQFS-----IDALVERVRALLTDDAKLVETLMKIESGTASAQQEVETHRSnaerYQNLAEQHSTNLTVTQSKVK-DLE 985
Cdd:pfam01576  234 LRAQLAkkeeeLQAALARLEEEGAQKNNALKKLRELQAQIAELQEDLESERA----ARAKAEKQRRDLGEELEALKtELE 309
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   986 ERIEVSS---------QQAVTMLER-LNDLTESLESTRAE-RRKLETAGKGLEGQVEAAEEEKNRLAAIVVGLKEENRAM 1054
Cdd:pfam01576  310 DTLDSTAaqqelrskrEQEVTELKKaLEEETRSHEAQLQEmRQKHTQALEELSEQLEQAKRNKANLEKAKQALESENNEL 389
                          330       340       350       360       370       380       390
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 634349315  1055 KE--RPDHTAKLASlENTVQDLKDQLTDLEEELEDTkkreQKTRGQLLEELNAAQAEVSALRTKLRQAERKASKTLK 1129
Cdd:pfam01576  390 QAelKTLQQAKQDS-EHKRKKLEGQLQELQARLSES----ERQRAELAEKLSKLQSELESVSGLLSEAEGKSIKLSK 461
MukB COG3096
Chromosome condensin MukBEF, ATPase and DNA-binding subunit MukB [Escherichia coli str. K-12 ...
521-1138 1.79e-05

Chromosome condensin MukBEF, ATPase and DNA-binding subunit MukB [Escherichia coli str. K-12 substr. MG1655 [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 225638 [Multi-domain]  Cd Length: 1480  Bit Score: 50.27  E-value: 1.79e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  521 RDRPIQQVDS-------AQLRELQEEVTQARAAERWARDEHTQTRNELDRHLMELssiknshgsLQRELE-QTKQGQGQG 592
Cdd:COG3096   503 REGPDQRHLAeqvqplrMRLSELEQRLRQQQSAERLLADFCKRQGKNLDAEELEA---------LHQELEaLIESLSDSV 573
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  593 EDAQRELERLRQEIDEMTDKMQELEQE----------LNDLEERavaSDRRVTDVEGLLEDMkiKHAHEMQRAQgdlQVA 662
Cdd:COG3096   574 SNAREQRMALRQEQEQLQSRIQSLMQRapvwlaaqnaLEQLSEQ---SGEEFTDSQDVTEYM--QQLLEREREA---TVE 645
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  663 KEEAERARLAV----ARVPTPNGTeeEEQRLRdevvsmrsertKISQTLADVLqrhrahanslgteLPKDFDETAVDHHD 738
Cdd:COG3096   646 RDELGARKNALdeeiERLSQPGGS--EDQRLN-----------ALAERFGGVL-------------LSEIYDDVTIEDAP 699
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  739 DWSGYVASSlgdhfdhitSHATAVSDeLSLAR--LAQEN---------------------SANDLEG----ELRQTQEHR 791
Cdd:COG3096   700 YFSALYGPS---------RHAIVVPD-LSQVKehLEGLTdcpedlyliegdpqsfddsvfSVDELEKavvvKIADRQWRY 769
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  792 DHWQDEAEQHRLAREQ----LEVEHDDLKatvqgheERLASLALTHQELEVSAEE-----KEHL--------RAQLEQAH 854
Cdd:COG3096   770 SRFPEIPLFGRAAREQrlesLHAERDVLS-------ERHATLSFDVQKTQRLHQAfsrfiGSHLavafeadpEAEIRQLN 842
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  855 GRITELEKQIADHDATQAALKKLWQSlpaidtrrragDSHDLATLKAAFDPSQSLGDSSAQFSIDALVERVrALLTDDAK 934
Cdd:COG3096   843 SRRNELERALSNHENDNQQQRIQFDQ-----------AKEGVTALNRLIPQLNLLADESLADRVEEIRERL-DEAQEAAR 910
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  935 LVE----TLMKIESGTASAQQEVETHRSNAERYQnLAEQHSTNLTVTQSKVKD-LEERIEVSSQQAVTMLERLNDLTESL 1009
Cdd:COG3096   911 FIQqhgnTLSKLEPIASVLQSDPEQFEQLKEDYA-QAQQMQRQARQQAFALTEvVQRRAHFSYSDSAEMLSENSDLNEKL 989
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315 1010 estraeRRKLETAgkglEGQVEAAEEEKNRLAAivvGLKEENRAMKE-RPDHTAKLASLENTVQDLKD------------ 1076
Cdd:COG3096   990 ------RQRLEQA----EAERTRAREQLRQHQA---QLSQYNQVLASlKSSYDTKKELLNELQQELQDigvradsgaeer 1056
                         650       660       670       680       690       700
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 634349315 1077 ---QLTDLEEELEDTKKReqktRGQLLEELNAAQAEVSALRTKLRQAER--KASKTLKMKAPAAYVA 1138
Cdd:COG3096  1057 ariRRDELHAQLSTNRSR----RNQLEKQLTFCEAEMDNLTRKLRKLERdyFEMREQVVTAKAGWCA 1119
PRK02224 PRK02224
DNA double-strand break repair Rad50 ATPase;
493-877 2.30e-05

DNA double-strand break repair Rad50 ATPase;


Pssm-ID: 179385 [Multi-domain]  Cd Length: 880  Bit Score: 49.65  E-value: 2.30e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  493 VAGADTSHAAVRDLETQVAGLQRALNEQRDRPIQQVDSAQ--------LRE----LQEEVTQARAAERWARDEHTQTRNE 560
Cdd:PRK02224  299 LAEAGLDDADAEAVEARREELEDRDEELRDRLEECRVAAQahneeaesLREdaddLEERAEELREEAAELESELEEAREA 378
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  561 LDRHLMELSSIKNSHGSLQRELEQTKQgqgQGEDAQRELERLRQEIDEMTDKMQELEQELNDLEERaVASDRRVTD---- 636
Cdd:PRK02224  379 VEDRREEIEELEEEIEELRERFGDAPV---DLGNAEDFLEELREERDELREREAELEATLRTARER-VEEAEALLEagkc 454
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  637 ------------VEGLLEDMKIKHAHEMQRAQGDLQVAKEEAERARlAVARVPTPNGTEEEEQRlRDEVVSMRSERTKIS 704
Cdd:PRK02224  455 pecgqpvegsphVETIEEDRERVEELEAELEDLEEEVEEVEERLER-AEDLVEAEDRIERLEER-REDLEELIAERRETI 532
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  705 QTLADVLQRHRAHANSLGTElPKDFDETAVDHHDDwSGYVASSLGDhfdhITSHATAVSDEL-SLARLAQENSA-NDLEG 782
Cdd:PRK02224  533 EEKRERAEELRERAAELEAE-AEEKREAAAEAEEE-AEEAREEVAE----LNSKLAELKERIeSLERIRTLLAAiADAED 606
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  783 ELRQTQEHRDHWQDEAEQHR--LA-----REQLEVEHDD--LKATVQGHEERLASLALTHQELEVSAEEKEHLRAQLEQA 853
Cdd:PRK02224  607 EIERLREKREALAELNDERRerLAekrerKRELEAEFDEarIEEAREDKERAEEYLEQVEEKLDELREERDDLQAEIGAV 686
                         410       420
                  ....*....|....*....|....
gi 634349315  854 HGRITELEKQIADHDATQAALKKL 877
Cdd:PRK02224  687 ENELEELEELRERREALENRVEAL 710
COG4372 COG4372
Uncharacterized conserved protein, contains DUF3084 domain [Function unknown];
531-718 2.55e-05

Uncharacterized conserved protein, contains DUF3084 domain [Function unknown];


Pssm-ID: 226809 [Multi-domain]  Cd Length: 499  Bit Score: 49.25  E-value: 2.55e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  531 AQLRELQEEVTQARAAERWARDEHTQTRNELDRHLMELSSIKNSHGSLQRELEQTKQGQGQgedAQRELERLRQEIDEMT 610
Cdd:COG4372    81 PQLRALRTELGTAQGEKRAAETEREAARSELQKARQEREAVRQELAAARQNLAKAQQELAR---LTKQAQDLQTRLKTLA 157
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  611 DKMQELEQELNDLEERAVASDRRVTDVEGLLEDMKIKHAHEMQRAQG----DLQVAKEEAERARLAVARVPTPNGTEEEE 686
Cdd:COG4372   158 EQRRQLEAQAQSLQASQKQLQASATQLKSQVLDLKLRSAQIEQEAQNlatrANAAQARTEELARRAAAAQQTAQAIQQRD 237
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|.
gi 634349315  687 QRL---------RDEVVSMRSERTKISQTLADVLQRHRAHA 718
Cdd:COG4372   238 AQIsqkaqqiaaRAEQIRERERQLQRLETAQARLEQEVAQL 278
COG1579 COG1579
Predicted nucleic acid-binding protein, contains Zn-ribbon domain [General function ...
525-722 4.97e-05

Predicted nucleic acid-binding protein, contains Zn-ribbon domain [General function prediction only];


Pssm-ID: 224495 [Multi-domain]  Cd Length: 239  Bit Score: 46.98  E-value: 4.97e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  525 IQQVDsAQLRELQEEVTQARAAERWARDEHTQTRNELDRHLMELSSIKNSHGSLQRELEQTKQGQGQGEDAQ------RE 598
Cdd:COG1579    12 IQKLD-LEKDRLEPRIKEIRKALKKAKAELEALNKALEALEIELEDLENQVSQLESEIQEIRERIKRAEEKLsavkdeRE 90
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  599 LERLRQEIDEMTDKMQELEQELNDLEEravasdrRVTDVEGLLEDMKIKHahemQRAQGDLQVAKEEAerarlavarvpt 678
Cdd:COG1579    91 LRALNIEIQIAKERINSLEDELAELME-------EIEKLEKEIEDLKERL----ERLEKNLAEAEARL------------ 147
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|....*...
gi 634349315  679 pngtEEEEQRLRDEVVSMRSERTKISQTL-ADVL---QRHRAHANSLG 722
Cdd:COG1579   148 ----EEEVAEIREEGQELSSKREELKEKLdPELLseyERIRKNKKGVG 191
PTZ00121 PTZ00121
MAEBL; Provisional
581-1219 5.61e-05

MAEBL; Provisional


Pssm-ID: 173412 [Multi-domain]  Cd Length: 2084  Bit Score: 48.60  E-value: 5.61e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  581 ELEQTKQGQGQGEDAQRELERLRQEidemtdKMQELEQELNDLEERAVASDRRVTDVEGLLEDMKIKHAHEMQRAQGDLQ 660
Cdd:PTZ00121 1113 EARKAEEAKKKAEDARKAEEARKAE------DARKAEEARKAEDAKRVEIARKAEDARKAEEARKAEDAKKAEAARKAEE 1186
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  661 VAKEE----AERARLAVARVPTPNGTEEEEQRLRDEVVSMRSERtKISQTLADVLQRHRAHANSLGTELPKdFDETAVDH 736
Cdd:PTZ00121 1187 VRKAEelrkAEDARKAEAARKAEEERKAEEARKAEDAKKAEAVK-KAEEAKKDAEEAKKAEEERNNEEIRK-FEEARMAH 1264
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  737 HDDWSGYVASSLGDHFDHI-TSHATAVSDEL----------SLARLAQE-NSANDLEGELRQTQEHRDHWQDEAEQHRLA 804
Cdd:PTZ00121 1265 FARRQAAIKAEEARKADELkKAEEKKKADEAkkaeekkkadEAKKKAEEaKKADEAKKKAEEAKKKADAAKKKAEEAKKA 1344
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  805 REQLEVEHDDLKATVQGHEERLASLALTHQE-------LEVSAEEK---EHLRAQLEQAHGRITELEKQIADHDATQAAL 874
Cdd:PTZ00121 1345 AEAAKAEAEAAADEAEAAEEKAEAAEKKKEEakkkadaAKKKAEEKkkaDEAKKKAEEDKKKADELKKAAAAKKKADEAK 1424
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  875 KKLWQSLPAIDTRRRAGDSHDLATLKAAFDPSQSLGDSSAQFSIDALVERVRALLTDDAKLVETLMKIESGTASAQQ--E 952
Cdd:PTZ00121 1425 KKAEEKKKADEAKKKAEEAKKADEAKKKAEEAKKAEEAKKKAEEAKKADEAKKKAEEAKKADEAKKKAEEAKKKADEakK 1504
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  953 VETHRSNAERYQNLAEQHSTNLTVTQSKVKDLEERIEVSSQQAVTMLERLNDLTESLESTRAE--RRKLETAGKGLEGQV 1030
Cdd:PTZ00121 1505 AAEAKKKADEAKKAEEAKKADEAKKAEEAKKADEAKKAEEKKKADELKKAEELKKAEEKKKAEeaKKAEEDKNMALRKAE 1584
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315 1031 EAAEEEKNRLAAiVVGLKEENRAMKerpdhtaklASLENTVQDLKDQLTDLEEELEDTKKREQKTRGQLLEELNAAQAEV 1110
Cdd:PTZ00121 1585 EAKKAEEARIEE-VMKLYEEEKKMK---------AEEAKKAEEAKIKAEELKKAEEEKKKVEQLKKKEAEEKKKAEELKK 1654
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315 1111 SALRTKLRQAE-RKASKTLKMKAPAAYVAglgrgasgfttRSDIGPAREQVTDEAAEDKNAGRGEEIDGDLPDRYQDPEN 1189
Cdd:PTZ00121 1655 AEEENKIKAAEeAKKAEEDKKKAEEAKKA-----------EEDEKKAAEALKKEAEEAKKAEELKKKEAEEKKKAEELKK 1723
                         650       660       670
                  ....*....|....*....|....*....|
gi 634349315 1190 ETGLFAGMVYEADDEEADRIYEAVDAQMDE 1219
Cdd:PTZ00121 1724 AEEENKIKAEEAKKEAEEDKKKAEEAKKDE 1753
MAD pfam05557
Mitotic checkpoint protein; This family consists of several eukaryotic mitotic checkpoint ...
503-707 6.27e-05

Mitotic checkpoint protein; This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins. The mitotic spindle checkpoint monitors proper attachment of the bipolar spindle to the kinetochores of aligned sister chromatids and causes a cell cycle arrest in prometaphase when failures occur. Multiple components of the mitotic spindle checkpoint have been identified in yeast and higher eukaryotes. In S.cerevisiae, the existence of a Mad1-dependent complex containing Mad2, Mad3, Bub3 and Cdc20 has been demonstrated.


Pssm-ID: 368498 [Multi-domain]  Cd Length: 660  Bit Score: 47.81  E-value: 6.27e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   503 VRDLETQVAGLQRALNEQ--RDRPIQQVDSAQLRELQEE---VTQARAAERWARDEHTQTRNELDRHLMELSSIKNSHGS 577
Cdd:pfam05557   57 IRLLEKREAEAEEALREQaeLNRLKKKYLEALNKKLNEKesqLADAREVISCLKNELSELRRQIQRAELELQSTNSELEE 136
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   578 LQRELEQTKQGQGQGEDAQRELERLRQEIDEMTDKMQELEQEL----NDLEERAVASDR--RVTDVEGLLEDMK--IKHA 649
Cdd:pfam05557  137 LQERLDLLKAKASEAEQLRQNLEKQQSSLAEAEQRIKELEFEIqsqeQDSEIVKNSKSElaRIPELEKELERLRehNKHL 216
                          170       180       190       200       210       220
                   ....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   650 HEMQRAQGDLqvaKEEAE--RARLavarvptpngteEEEQRLRDEVVSMRSERTKISQTL 707
Cdd:pfam05557  217 NENIENKLLL---KEEVEdlKRKL------------EREEKYREEAATLELEKEKLEQEL 261
mukB PRK04863
chromosome partition protein MukB;
506-1036 6.47e-05

chromosome partition protein MukB;


Pssm-ID: 235316 [Multi-domain]  Cd Length: 1486  Bit Score: 48.41  E-value: 6.47e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  506 LETQVAGLQRALNEQRD----------RPIQQVDSA--------QLRELQEEVTQARAAERWARDEHTQTRNELDRHLME 567
Cdd:PRK04863  518 LRMRLSELEQRLRQQQRaerllaefckRLGKNLDDEdeleqlqeELEARLESLSESVSEARERRMALRQQLEQLQARIQR 597
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  568 LSSIK----NSHGSLQRELEQTKQGQGQGEDA----QRELERLR---QEIDEMTDKMQELEQELNDLEERAVASDRRVT- 635
Cdd:PRK04863  598 LAARApawlAAQDALARLREQSGEEFEDSQDVteymQQLLEREReltVERDELAARKQALDEEIERLSQPGGSEDPRLNa 677
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  636 ---DVEGLL-----EDMKIKHAHEMQRAQGDLQ----VAKEEAERARLAvARVPTPNG---TEEEEQRLRDEVVSMRSER 700
Cdd:PRK04863  678 laeRFGGVLlseiyDDVSLEDAPYFSALYGPARhaivVPDLSDAAEQLA-GLEDCPEDlylIEGDPDSFDDSVFSVEELE 756
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  701 TKISQTLADVLQRH----------RAHANSLGTELPKDFDETAvdhhddwsgyvasslgdhfdhiTSHATAVSDELSLAR 770
Cdd:PRK04863  757 KAVVVKIADRQWRYsrfpevplfgRAAREKRIEQLRAEREELA----------------------ERYATLSFDVQKLQR 814
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  771 LAQENS-----------ANDLEGELRQTQEHRDHWQDEAEQHRLAREQLEVEHDDLKATVQGHEERLASLALThqELEVS 839
Cdd:PRK04863  815 LHQAFSrfigshlavafEADPEAELRQLNRRRVELERALADHESQEQQQRSQLEQAKEGLSALNRLLPRLNLL--ADETL 892
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  840 AEEKEHLRAQLEQAHgritELEKQIADHDATQAALKKLWQSLPAidtrrragDSHDLATLKAAFDPSQSLGDSSAQ--FS 917
Cdd:PRK04863  893 ADRVEEIREQLDEAE----EAKRFVQQHGNALAQLEPIVSVLQS--------DPEQFEQLKQDYQQAQQTQRDAKQqaFA 960
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  918 IDALVERVRAL--------LTDDAKLVETL----MKIESGTASAQQEVETHRSNAERYQNLAEQHSTNLTVTQSKVKDLE 985
Cdd:PRK04863  961 LTEVVQRRAHFsyedaaemLAKNSDLNEKLrqrlEQAEQERTRAREQLRQAQAQLAQYNQVLASLKSSYDAKRQMLQELK 1040
                         570       580       590       600       610       620
                  ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 634349315  986 ERIEVSSQQAVTMLE-----RLNDLTESLESTRAERRKLET-------AGKGLEGQVEAAEEE 1036
Cdd:PRK04863 1041 QELQDLGVPADSGAEeraraRRDELHARLSANRSRRNQLEKqltfceaEMDNLTKKLRKLERD 1103
CCDC158 pfam15921
Coiled-coil domain-containing protein 158; CCDC158 is a family of proteins found in eukaryotes. ...
506-714 9.24e-05

Coiled-coil domain-containing protein 158; CCDC158 is a family of proteins found in eukaryotes. The function is not known.


Pssm-ID: 318193 [Multi-domain]  Cd Length: 1112  Bit Score: 47.81  E-value: 9.24e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   506 LETQVAGLQrALNEQRDRP---IQQVDSAQ--LRELQEEVTQAR----AAERWARD-----------------EHTQTRN 559
Cdd:pfam15921  446 MERQMAAIQ-GKNESLEKVsslTAQLESTKemLRKVVEELTAKKmtleSSERTVSDltaslqekeraieatnaEITKLRS 524
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   560 ELDRHLMELSSIKNSHGSLQRELEQTKQGQGQGEDAQRELERLRQEIDEMTD----------KMQ----ELEQELND--- 622
Cdd:pfam15921  525 RVDLKLQELQHLKNEGDHLRNVQTECEALKLQMAEKDKVIEILRQQIENMTQlvgqhgrtagAMQvekaQLEKEINDrrl 604
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315   623 -LEERAVASDRRvtdveglleDMKIKhahEMQRAQGDLqvakeEAERARLAVA---RVPTPNGTEEEEQRLRDEVVSMRS 698
Cdd:pfam15921  605 eLQEFKILKDKK---------DAKIR---ELEARVSDL-----ELEKVKLVNAgseRLRAVKDIKQERDQLLNEVKTSRN 667
                          250
                   ....*....|....*.
gi 634349315   699 ERTKISQTLaDVLQRH 714
Cdd:pfam15921  668 ELNSLSEDY-EVLKRN 682
PRK04778 PRK04778
septation ring formation regulator EzrA; Provisional
778-1129 9.76e-05

septation ring formation regulator EzrA; Provisional


Pssm-ID: 179877 [Multi-domain]  Cd Length: 569  Bit Score: 47.14  E-value: 9.76e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  778 NDLEGELRQTQEHRDHWQDEAEQHRLAREQLEVEHDDLKATVQGH-----------EERLASLALTHQELEVSAEEKEHL 846
Cdd:PRK04778  115 DLIEEDIEQILEELQELLESEEKNREEVEQLKDLYRELRKSLLANrfsfgpaldelEKQLENLEEEFSQFVELTESGDYV 194
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 634349315  847 RA--QLEQAHGRITELEKQIADhdatqaalkklwqsLPAIdtrrragdshdLATLKAAFdPSQslgdssaqfsIDALVER 924
Cdd:PRK04778  195 EAreI