NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|6980731]
View 

Protein Classification

succinate--CoA ligase subunit alpha (domain architecture ID 11481473)

ADP-forming/GDP-forming succinate--CoA ligase subunit alpha is the coenzyme A and phosphate binding subunit of the succinyl-CoA synthetase that couples the hydrolysis of succinyl-CoA to the synthesis of ATP/GTP, as part of the citric acid cycle (TCA)

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
PRK05678 PRK05678
succinyl-CoA synthetase subunit alpha; Validated
1-286 0e+00

succinyl-CoA synthetase subunit alpha; Validated


:

Pssm-ID: 180194 [Multi-domain]  Cd Length: 291  Bit Score: 541.69  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6980731     1 SILIDKNTKVICQGFTGSQGTFHSEQAIAYGTKMVGGVTPGKGGTTHLGLPVFNTVREAVAATGATASVIYVPAPFCKDS 80
Cdd:PRK05678   2 SILINKDTKVIVQGITGKQGTFHTEQMLAYGTNIVGGVTPGKGGTTVLGLPVFNTVAEAVEATGANASVIYVPPPFAADA 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6980731    81 ILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEAGVRMIGPNCPGVITPGECKIGIQPGHIHKPGKVGIVSRSGTLTYEA 160
Cdd:PRK05678  82 ILEAIDAGIDLIVCITEGIPVLDMLEVKAYLERKKTRLIGPNCPGIITPGECKIGIMPGHIHKKGRVGVVSRSGTLTYEA 161
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6980731   161 VKQTTDYGFGQSTCVGIGGDPIPGSNFIDILEMFEKDPQTEAIVMIGEIGGSAEEEAAAYIKEHVTKPVVGYIAGVTAPK 240
Cdd:PRK05678 162 VAQLTDLGFGQSTCVGIGGDPINGTNFIDVLEAFEEDPETEAIVMIGEIGGSAEEEAAEYIKANVTKPVVGYIAGVTAPP 241
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*.
gi 6980731   241 GKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGEALKTV 286
Cdd:PRK05678 242 GKRMGHAGAIISGGKGTAEEKKEALEAAGVKVARTPSEIGELLKEV 287
 
Name Accession Description Interval E-value
PRK05678 PRK05678
succinyl-CoA synthetase subunit alpha; Validated
1-286 0e+00

succinyl-CoA synthetase subunit alpha; Validated


Pssm-ID: 180194 [Multi-domain]  Cd Length: 291  Bit Score: 541.69  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6980731     1 SILIDKNTKVICQGFTGSQGTFHSEQAIAYGTKMVGGVTPGKGGTTHLGLPVFNTVREAVAATGATASVIYVPAPFCKDS 80
Cdd:PRK05678   2 SILINKDTKVIVQGITGKQGTFHTEQMLAYGTNIVGGVTPGKGGTTVLGLPVFNTVAEAVEATGANASVIYVPPPFAADA 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6980731    81 ILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEAGVRMIGPNCPGVITPGECKIGIQPGHIHKPGKVGIVSRSGTLTYEA 160
Cdd:PRK05678  82 ILEAIDAGIDLIVCITEGIPVLDMLEVKAYLERKKTRLIGPNCPGIITPGECKIGIMPGHIHKKGRVGVVSRSGTLTYEA 161
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6980731   161 VKQTTDYGFGQSTCVGIGGDPIPGSNFIDILEMFEKDPQTEAIVMIGEIGGSAEEEAAAYIKEHVTKPVVGYIAGVTAPK 240
Cdd:PRK05678 162 VAQLTDLGFGQSTCVGIGGDPINGTNFIDVLEAFEEDPETEAIVMIGEIGGSAEEEAAEYIKANVTKPVVGYIAGVTAPP 241
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*.
gi 6980731   241 GKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGEALKTV 286
Cdd:PRK05678 242 GKRMGHAGAIISGGKGTAEEKKEALEAAGVKVARTPSEIGELLKEV 287
sucCoAalpha TIGR01019
succinyl-CoA synthetase, alpha subunit; This model describes succinyl-CoA synthetase alpha ...
2-286 7.53e-180

succinyl-CoA synthetase, alpha subunit; This model describes succinyl-CoA synthetase alpha subunits but does not discriminate between GTP-specific and ATP-specific reactions. The model is designated as subfamily rather than equivalog for that reason. ATP citrate lyases appear to form an outgroup. [Energy metabolism, TCA cycle]


Pssm-ID: 130091 [Multi-domain]  Cd Length: 286  Bit Score: 496.55  E-value: 7.53e-180
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6980731      2 ILIDKNTKVICQGFTGSQGTFHSEQAIAYGTKMVGGVTPGKGGTTHLGLPVFNTVREAVAATGATASVIYVPAPFCKDSI 81
Cdd:TIGR01019   1 ILLDKDTKVIVQGITGSQGSFHTEQMLAYGTNIVGGVTPGKGGTTVLGLPVFDSVKEAVEETGANASVIFVPAPFAADAI 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6980731     82 LEAIDAGIKLIITITEGIPTLDMLTVKVKLDEAGVRMIGPNCPGVITPGECKIGIQPGHIHKPGKVGIVSRSGTLTYEAV 161
Cdd:TIGR01019  81 FEAIDAGIELIVCITEGIPVHDMLKVKRYMEESGTRLIGPNCPGIITPGECKIGIMPGHIHKPGNVGIVSRSGTLTYEAV 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6980731    162 KQTTDYGFGQSTCVGIGGDPIPGSNFIDILEMFEKDPQTEAIVMIGEIGGSAEEEAAAYIKEHVTKPVVGYIAGVTAPKG 241
Cdd:TIGR01019 161 HQLTKAGFGQSTCVGIGGDPVNGTSFIDVLEAFEKDPETEAIVMIGEIGGSAEEEAADFIKQNMSKPVVGFIAGATAPPG 240
                         250       260       270       280
                  ....*....|....*....|....*....|....*....|....*
gi 6980731    242 KRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGEALKTV 286
Cdd:TIGR01019 241 KRMGHAGAIISGGKGTAESKIEALEAAGVTVVKSPSDIGELLAEI 285
SucD COG0074
Succinyl-CoA synthetase, alpha subunit [Energy production and conversion];
1-286 2.74e-177

Succinyl-CoA synthetase, alpha subunit [Energy production and conversion];


Pssm-ID: 223152 [Multi-domain]  Cd Length: 293  Bit Score: 490.18  E-value: 2.74e-177
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6980731    1 SILIDKNTKVICQGFTGSQGTFHSEQAIAYGTKMVGGVTPGKGGTTHLGLPVFNTVREAVAATGATASVIYVPAPFCKDS 80
Cdd:COG0074   2 SILLNKDTKVIVQGITGKQGTFHTEQMLAYGTKIVGGVTPGKGGQTILGLPVFNTVEEAVKETGANASVIFVPPPFAADA 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6980731   81 ILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEAGVRMIGPNCPGVITPGECKIGIQPGHIHKPGKVGIVSRSGTLTYEA 160
Cdd:COG0074  82 ILEAIDAGIKLVVIITEGIPVLDMLELKRYAREKGTRLIGPNCPGIITPGECKIGIMPGNIYKPGNIGIVSRSGTLTYEA 161
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6980731  161 VKQTTDYGFGQSTCVGIGGDPIPGSNFIDILEMFEKDPQTEAIVMIGEIGGSAEEEAAAYIKEHVT-KPVVGYIAGVTAP 239
Cdd:COG0074 162 VSQLTEAGLGQSTAIGIGGDPIPGTSFIDALEMFEADPETEAIVMIGEIGGPAEEEAAEYIKANATrKPVVAYIAGRTAP 241
                       250       260       270       280
                ....*....|....*....|....*....|....*....|....*..
gi 6980731  240 KGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGEALKTV 286
Cdd:COG0074 242 EGKRMGHAGAIVSGGKGTAESKIAALEAAGVKVAETPAELGELLLEV 288
CoA_binding pfam02629
CoA binding domain; This domain has a Rossmann fold and is found in a number of proteins ...
5-98 9.16e-34

CoA binding domain; This domain has a Rossmann fold and is found in a number of proteins including succinyl CoA synthetases, malate and ATP-citrate ligases.


Pssm-ID: 308320 [Multi-domain]  Cd Length: 96  Bit Score: 118.45  E-value: 9.16e-34
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6980731      5 DKNTKVICQGFT--GSQGTFHSEQAIAYGTKMVGGVTPGKGGTTHLGLPVFNTVREAVAATGATASVIYVPAPFCKDSIL 82
Cdd:pfam02629   1 DKDTKVIVIGAGglGIAGLYHFIQMLGYGIKMVFGVNPGKGGTEILGIPVYNSVDELEEKTGVDVAVITVPAPFAQEAID 80
                          90
                  ....*....|....*.
gi 6980731     83 EAIDAGIKLIITITEG 98
Cdd:pfam02629  81 ELVDAGIKGIVNITPG 96
CoA_binding smart00881
CoA binding domain; This domain has a Rossmann fold and is found in a number of proteins ...
3-99 2.68e-33

CoA binding domain; This domain has a Rossmann fold and is found in a number of proteins including succinyl CoA synthetases, malate and ATP-citrate ligases.


Pssm-ID: 214881 [Multi-domain]  Cd Length: 100  Bit Score: 117.23  E-value: 2.68e-33
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6980731       3 LIDKNTKVICQGFTGSQGTFHSEQAIA---YGTKMVGGVTPGKGGTTHLGLPVFNTVREAVAATGATASVIYVPAPFCKD 79
Cdd:smart00881   1 LLNPNTSVAVVGASGNLGSFGLAVMRNlleYGTKFVGGVYPGKVGPKVDGVPVYDSVAEAPEETGVDVAVIFVPAEAAPD 80
                           90       100
                   ....*....|....*....|
gi 6980731      80 SILEAIDAGIKLIITITEGI 99
Cdd:smart00881  81 AIDEAIEAGIKGIVVITEGI 100
 
Name Accession Description Interval E-value
PRK05678 PRK05678
succinyl-CoA synthetase subunit alpha; Validated
1-286 0e+00

succinyl-CoA synthetase subunit alpha; Validated


Pssm-ID: 180194 [Multi-domain]  Cd Length: 291  Bit Score: 541.69  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6980731     1 SILIDKNTKVICQGFTGSQGTFHSEQAIAYGTKMVGGVTPGKGGTTHLGLPVFNTVREAVAATGATASVIYVPAPFCKDS 80
Cdd:PRK05678   2 SILINKDTKVIVQGITGKQGTFHTEQMLAYGTNIVGGVTPGKGGTTVLGLPVFNTVAEAVEATGANASVIYVPPPFAADA 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6980731    81 ILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEAGVRMIGPNCPGVITPGECKIGIQPGHIHKPGKVGIVSRSGTLTYEA 160
Cdd:PRK05678  82 ILEAIDAGIDLIVCITEGIPVLDMLEVKAYLERKKTRLIGPNCPGIITPGECKIGIMPGHIHKKGRVGVVSRSGTLTYEA 161
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6980731   161 VKQTTDYGFGQSTCVGIGGDPIPGSNFIDILEMFEKDPQTEAIVMIGEIGGSAEEEAAAYIKEHVTKPVVGYIAGVTAPK 240
Cdd:PRK05678 162 VAQLTDLGFGQSTCVGIGGDPINGTNFIDVLEAFEEDPETEAIVMIGEIGGSAEEEAAEYIKANVTKPVVGYIAGVTAPP 241
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*.
gi 6980731   241 GKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGEALKTV 286
Cdd:PRK05678 242 GKRMGHAGAIISGGKGTAEEKKEALEAAGVKVARTPSEIGELLKEV 287
sucCoAalpha TIGR01019
succinyl-CoA synthetase, alpha subunit; This model describes succinyl-CoA synthetase alpha ...
2-286 7.53e-180

succinyl-CoA synthetase, alpha subunit; This model describes succinyl-CoA synthetase alpha subunits but does not discriminate between GTP-specific and ATP-specific reactions. The model is designated as subfamily rather than equivalog for that reason. ATP citrate lyases appear to form an outgroup. [Energy metabolism, TCA cycle]


Pssm-ID: 130091 [Multi-domain]  Cd Length: 286  Bit Score: 496.55  E-value: 7.53e-180
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6980731      2 ILIDKNTKVICQGFTGSQGTFHSEQAIAYGTKMVGGVTPGKGGTTHLGLPVFNTVREAVAATGATASVIYVPAPFCKDSI 81
Cdd:TIGR01019   1 ILLDKDTKVIVQGITGSQGSFHTEQMLAYGTNIVGGVTPGKGGTTVLGLPVFDSVKEAVEETGANASVIFVPAPFAADAI 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6980731     82 LEAIDAGIKLIITITEGIPTLDMLTVKVKLDEAGVRMIGPNCPGVITPGECKIGIQPGHIHKPGKVGIVSRSGTLTYEAV 161
Cdd:TIGR01019  81 FEAIDAGIELIVCITEGIPVHDMLKVKRYMEESGTRLIGPNCPGIITPGECKIGIMPGHIHKPGNVGIVSRSGTLTYEAV 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6980731    162 KQTTDYGFGQSTCVGIGGDPIPGSNFIDILEMFEKDPQTEAIVMIGEIGGSAEEEAAAYIKEHVTKPVVGYIAGVTAPKG 241
Cdd:TIGR01019 161 HQLTKAGFGQSTCVGIGGDPVNGTSFIDVLEAFEKDPETEAIVMIGEIGGSAEEEAADFIKQNMSKPVVGFIAGATAPPG 240
                         250       260       270       280
                  ....*....|....*....|....*....|....*....|....*
gi 6980731    242 KRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGEALKTV 286
Cdd:TIGR01019 241 KRMGHAGAIISGGKGTAESKIEALEAAGVTVVKSPSDIGELLAEI 285
SucD COG0074
Succinyl-CoA synthetase, alpha subunit [Energy production and conversion];
1-286 2.74e-177

Succinyl-CoA synthetase, alpha subunit [Energy production and conversion];


Pssm-ID: 223152 [Multi-domain]  Cd Length: 293  Bit Score: 490.18  E-value: 2.74e-177
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6980731    1 SILIDKNTKVICQGFTGSQGTFHSEQAIAYGTKMVGGVTPGKGGTTHLGLPVFNTVREAVAATGATASVIYVPAPFCKDS 80
Cdd:COG0074   2 SILLNKDTKVIVQGITGKQGTFHTEQMLAYGTKIVGGVTPGKGGQTILGLPVFNTVEEAVKETGANASVIFVPPPFAADA 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6980731   81 ILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEAGVRMIGPNCPGVITPGECKIGIQPGHIHKPGKVGIVSRSGTLTYEA 160
Cdd:COG0074  82 ILEAIDAGIKLVVIITEGIPVLDMLELKRYAREKGTRLIGPNCPGIITPGECKIGIMPGNIYKPGNIGIVSRSGTLTYEA 161
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6980731  161 VKQTTDYGFGQSTCVGIGGDPIPGSNFIDILEMFEKDPQTEAIVMIGEIGGSAEEEAAAYIKEHVT-KPVVGYIAGVTAP 239
Cdd:COG0074 162 VSQLTEAGLGQSTAIGIGGDPIPGTSFIDALEMFEADPETEAIVMIGEIGGPAEEEAAEYIKANATrKPVVAYIAGRTAP 241
                       250       260       270       280
                ....*....|....*....|....*....|....*....|....*..
gi 6980731  240 KGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGEALKTV 286
Cdd:COG0074 242 EGKRMGHAGAIVSGGKGTAESKIAALEAAGVKVAETPAELGELLLEV 288
PTZ00187 PTZ00187
succinyl-CoA synthetase alpha subunit; Provisional
2-286 5.95e-166

succinyl-CoA synthetase alpha subunit; Provisional


Pssm-ID: 240307 [Multi-domain]  Cd Length: 317  Bit Score: 462.65  E-value: 5.95e-166
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6980731     2 ILIDKNTKVICQGFTGSQGTFHSEQAIAYGTKMVGGVTPGKGGTTHL--GLPVFNTVREAVAATGATASVIYVPAPFCKD 79
Cdd:PTZ00187  24 VWVNKNTKVICQGITGKQGTFHTEQAIEYGTKMVGGVNPKKAGTTHLkhGLPVFATVKEAKKATGADASVIYVPPPHAAS 103
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6980731    80 SILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEAGV-RMIGPNCPGVITPGECKIGIQPGHIHKPGKVGIVSRSGTLTY 158
Cdd:PTZ00187 104 AIIEAIEAEIPLVVCITEGIPQHDMVKVKHALLSQNKtRLIGPNCPGIIKPGECKIGIMPGHIHKKGKIGIVSRSGTLTY 183
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6980731   159 EAVKQTTDYGFGQSTCVGIGGDPIPGSNFIDILEMFEKDPQTEAIVMIGEIGGSAEEEAAAYIKEHVT-KPVVGYIAGVT 237
Cdd:PTZ00187 184 EAVAQTTAVGLGQSTCVGIGGDPFNGTNFIDCLKLFLNDPETEGIILIGEIGGTAEEEAAEWIKNNPIkKPVVSFIAGIT 263
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*....
gi 6980731   238 APKGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGEALKTV 286
Cdd:PTZ00187 264 APPGRRMGHAGAIISGGKGTAPGKIEALEAAGVRVVKSPAQLGKTMLEV 312
PLN00125 PLN00125
Succinyl-CoA ligase [GDP-forming] subunit alpha
1-283 2.71e-148

Succinyl-CoA ligase [GDP-forming] subunit alpha


Pssm-ID: 215066 [Multi-domain]  Cd Length: 300  Bit Score: 417.06  E-value: 2.71e-148
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6980731     1 SILIDKNTKVICQGFTGSQGTFHSEQAIAYGTKMVGGVTPGKGGTTHLGLPVFNTVREAVAATGATASVIYVPAPFCKDS 80
Cdd:PLN00125   6 AVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVAEAKAETKANASVIYVPPPFAAAA 85
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6980731    81 ILEAIDAGIKLIITITEGIPTLDMLTVKVKLD-EAGVRMIGPNCPGVITPGECKIGIQPGHIHKPGKVGIVSRSGTLTYE 159
Cdd:PLN00125  86 ILEAMEAELDLVVCITEGIPQHDMVRVKAALNrQSKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYE 165
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6980731   160 AVKQTTDYGFGQSTCVGIGGDPIPGSNFIDILEMFEKDPQTEAIVMIGEIGGSAEEEAAAYIKEHVT-KPVVGYIAGVTA 238
Cdd:PLN00125 166 AVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFVKDPQTEGIILIGEIGGTAEEDAAAFIKESGTeKPVVAFIAGLTA 245
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*
gi 6980731   239 PKGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGEAL 283
Cdd:PLN00125 246 PPGRRMGHAGAIVSGGKGTAQDKIKALREAGVTVVESPAKIGVAM 290
CoA_binding pfam02629
CoA binding domain; This domain has a Rossmann fold and is found in a number of proteins ...
5-98 9.16e-34

CoA binding domain; This domain has a Rossmann fold and is found in a number of proteins including succinyl CoA synthetases, malate and ATP-citrate ligases.


Pssm-ID: 308320 [Multi-domain]  Cd Length: 96  Bit Score: 118.45  E-value: 9.16e-34
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6980731      5 DKNTKVICQGFT--GSQGTFHSEQAIAYGTKMVGGVTPGKGGTTHLGLPVFNTVREAVAATGATASVIYVPAPFCKDSIL 82
Cdd:pfam02629   1 DKDTKVIVIGAGglGIAGLYHFIQMLGYGIKMVFGVNPGKGGTEILGIPVYNSVDELEEKTGVDVAVITVPAPFAQEAID 80
                          90
                  ....*....|....*.
gi 6980731     83 EAIDAGIKLIITITEG 98
Cdd:pfam02629  81 ELVDAGIKGIVNITPG 96
CoA_binding smart00881
CoA binding domain; This domain has a Rossmann fold and is found in a number of proteins ...
3-99 2.68e-33

CoA binding domain; This domain has a Rossmann fold and is found in a number of proteins including succinyl CoA synthetases, malate and ATP-citrate ligases.


Pssm-ID: 214881 [Multi-domain]  Cd Length: 100  Bit Score: 117.23  E-value: 2.68e-33
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6980731       3 LIDKNTKVICQGFTGSQGTFHSEQAIA---YGTKMVGGVTPGKGGTTHLGLPVFNTVREAVAATGATASVIYVPAPFCKD 79
Cdd:smart00881   1 LLNPNTSVAVVGASGNLGSFGLAVMRNlleYGTKFVGGVYPGKVGPKVDGVPVYDSVAEAPEETGVDVAVIFVPAEAAPD 80
                           90       100
                   ....*....|....*....|
gi 6980731      80 SILEAIDAGIKLIITITEGI 99
Cdd:smart00881  81 AIDEAIEAGIKGIVVITEGI 100
Ligase_CoA pfam00549
CoA-ligase; This family includes the CoA ligases Succinyl-CoA synthetase alpha and beta chains, ...
150-270 7.53e-30

CoA-ligase; This family includes the CoA ligases Succinyl-CoA synthetase alpha and beta chains, malate CoA ligase and ATP-citrate lyase. Some members of the family utilize ATP others use GTP.


Pssm-ID: 334139 [Multi-domain]  Cd Length: 128  Bit Score: 109.27  E-value: 7.53e-30
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6980731    150 VSRSGTLTYEAVKQTTDYGFGQSTCVGIGGDPIPGSNFIDILEMFEKDPQTEAIVMIGEIG-GSAEEEAAAYIKEH---- 224
Cdd:pfam00549   1 LVNGGTLAMEAMDLIKLAGGGPHNFIDLGGDAFTPTTRIDALKLEAADPEVKVILLDIVLGyGACEDPAGGLLKAIkear 80
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*..
gi 6980731    225 -VTKPVVGYIAGVTAPKGKRMGHAGAIIAGGKGTADEKFAALEAAGV 270
Cdd:pfam00549  81 aRELPVVARVCGTEADPQGREEQAKALAESGVLIASSNNQALRAAGA 127
PLN02522 PLN02522
ATP citrate (pro-S)-lyase
44-286 5.45e-29

ATP citrate (pro-S)-lyase


Pssm-ID: 178137 [Multi-domain]  Cd Length: 608  Bit Score: 115.69  E-value: 5.45e-29
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6980731    44 GTTHLGLPVFNTVREAVAATgATASVIYVPAPF--CKDSILEAIDAG-IKLIITITEGIPTLDMLTVKVKLDEAGVRMIG 120
Cdd:PLN02522  57 GQEEIAIPVHGSIEAACKAH-PTADVFINFASFrsAAASSMEALKQPtIRVVAIIAEGVPESDTKQLIAYARANNKVVIG 135
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6980731   121 PNCPGVITPGECKIGIQPGHI--------HKPGKVGIVSRSGTLT---YEAVKQTTDygfGQSTCVGIGGDPIPGSNFID 189
Cdd:PLN02522 136 PATVGGIQAGAFKIGDTAGTLdniiqcklYRPGSVGFVSKSGGMSnemYNVIARVTD---GIYEGIAIGGDVFPGSTLSD 212
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6980731   190 ILEMFEKDPQTEAIVMIGEIGGSAEEEAAAYIKE-HVTKPVVGYIAGVTA---PKGKRMGHAGAIIAGGKGTADEKFAAL 265
Cdd:PLN02522 213 HVLRFNNIPQIKMIVVLGELGGRDEYSLVEALKQgKVSKPVVAWVSGTCArlfKSEVQFGHAGAKSGGDMESAQAKNKAL 292
                        250       260
                 ....*....|....*....|.
gi 6980731   266 EAAGVKTVRSLADIGEALKTV 286
Cdd:PLN02522 293 KDAGAIVPTSFEALEAAIKET 313
AcCoA-syn-alpha TIGR02717
acetyl coenzyme A synthetase (ADP forming), alpha domain; Although technically reversible, it ...
69-283 1.12e-13

acetyl coenzyme A synthetase (ADP forming), alpha domain; Although technically reversible, it is believed that this group of ADP-dependent acetyl-CoA synthetases (ACS) act in the direction of acetate and ATP production in the organisms in which it has been characterized. In most species this protein exists as a fused alpha-beta domain polypeptide. In Pyrococcus and related species, however the domains exist as separate polypeptides. This model represents the alpha (N-terminal) domain. In Pyrococcus and related species there appears to have been the development of a paralogous family such that four other proteins are close relatives. In reference, one of these (along with its beta-domain partner) was characterized as ACS-II showing specificity for phenylacetyl-CoA. This model has been constructed to exclude these non-ACS-I paralogs. This may result in new, authentic ACS-I sequences falling below the trusted cutoff.


Pssm-ID: 131764 [Multi-domain]  Cd Length: 447  Bit Score: 70.42  E-value: 1.12e-13
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6980731     69 VIYVPAPFCKDSILEAIDAGIKLIITITEGI----PTLDMLTVKVK--LDEAGVRMIGPNCPGVITPGECKIGIQPGHIH 142
Cdd:TIGR02717  69 VIVVPAKYVPQVVEECGEKGVKGAVVITAGFkevgEEGAELEQELVeiARKYGMRLLGPNCLGIINTHIKLNATFAPTMP 148
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6980731    143 KPGKVGIVSRSGTLTYEAVKQTTDYGFGQSTCVGIGGDPIPGSNfiDILEMFEKDPQTEAIVMIGE--IGGSAEEEAAAY 220
Cdd:TIGR02717 149 KKGGIAFISQSGALLTALLDWAEKNGVGFSYFVSLGNKADIDES--DLLEYLADDPDTKVILLYLEgiKDGRKFLKTARE 226
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 6980731    221 IKEhvTKPVVGYIAGVTaPKGKR--MGHAGAiIAGgkgtADEKF-AALEAAGV---KTVRSLADIGEAL 283
Cdd:TIGR02717 227 ISK--KKPIVVLKSGTS-EAGAKaaSSHTGA-LAG----SDEAYdAAFKQAGViraDSIEELFDLARLL 287
ACCS COG1042
Acyl-CoA synthetase (NDP forming) [Energy production and conversion];
28-285 1.23e-13

Acyl-CoA synthetase (NDP forming) [Energy production and conversion];


Pssm-ID: 223972 [Multi-domain]  Cd Length: 598  Bit Score: 70.46  E-value: 1.23e-13
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6980731   28 IAYGTKMVGGVTPGKGgtTHLGLPVFNTVREAVAAtgATASVIYVPAPFCKDSILEAIDAGIKLIITITEGIPTL----- 102
Cdd:COG1042  34 LEYGQGKIYPVNPKYD--EVLGVKAYTSVADLPDA--PDLAVIVVPAKVVPEIVHELGEKGVKGAIVISAGFREAgeegm 109
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6980731  103 DMLTVKVKLDEA-GVRMIGPNCPGVITPgecKIGI----QPG-HIHKPGKVGIVSRSGTLTYEAVKQTTDYGFGQSTCVG 176
Cdd:COG1042 110 ELEKELVEAARKyGMRIIGPNCLGLINP---IIGLnatfDPVfGLGRGGGGAFVSQSGAVSFAILDWANEDGMGFSIKVS 186
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6980731  177 IG--GDpipgSNFIDILEMFEKDPQTEAIVMIGEIGGSAEEEAAAYIKEHVTKPVVGYIAGVTAPKGKRMGHAGAIIAGg 254
Cdd:COG1042 187 LGnaAD----RDESDLLEYLADDPRTKAIGLYIEGVKDGRKFLNAARAAERKKPIIALKAGRSEAGAKAAASHTGSLAG- 261
                       250       260       270
                ....*....|....*....|....*....|..
gi 6980731  255 kgtADEKF-AALEAAGVKTVRSLADIGEALKT 285
Cdd:COG1042 262 ---SDEAYdAAFKQAGVIRVESIEELFDAAKA 290
Succ_CoA_lig pfam13607
Succinyl-CoA ligase like flavodoxin domain; This domain contains the catalytic domain from ...
144-283 2.30e-11

Succinyl-CoA ligase like flavodoxin domain; This domain contains the catalytic domain from Succinyl-CoA ligase alpha subunit and other related enzymes. A conserved histidine is involved in phosphoryl transfer.


Pssm-ID: 338847 [Multi-domain]  Cd Length: 138  Bit Score: 60.17  E-value: 2.30e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6980731    144 PGKVGIVSRSGTLTYEAVKQTTDYGFGQSTCVGIGgdpipgsN-----FIDILEMFEKDPQTEAIVM-IGEIGG-----S 212
Cdd:pfam13607   1 PGGIALVSQSGALGAALLDWAASRGIGFSKFVSLG-------NeadvdFADLLDYLADDPETRVILLyLEGIRDgrrflR 73
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 6980731    213 AEEEAAAyikehvTKPVVGYIAGVTaPKGKRMG--HAGAiIAGGKGTADekfAALEAAG---VKTVRSLADIGEAL 283
Cdd:pfam13607  74 AARRAAR------GKPVVVLKSGRS-EAGARAAasHTGA-LAGSDAVYD---AAFRQAGvirVDDLEELFDAAEAL 138
PRK06091 PRK06091
membrane protein FdrA; Validated
65-240 1.14e-06

membrane protein FdrA; Validated


Pssm-ID: 180395 [Multi-domain]  Cd Length: 555  Bit Score: 49.27  E-value: 1.14e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6980731    65 ATASVIYVPAPFCKDSILEAIDAGIKLIItITEGIPTLDMLTVKVKLDEAGVRMIGPNCpgvitpGECKIGIQP---GHI 141
Cdd:PRK06091 118 ANLALISVAGEYAAELAEQALDRNLNVMM-FSDNVTLEDEIRLKTRAREKGLLVMGPDC------GTAMIAGTPlafANV 190
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6980731   142 HKPGKVGIVSRSGTLTYEAVKQTTDYGFGQSTCVGIGG----DPIPGSNFIDILEMFEKDPQTEAIVMIGEIGGSAEEEA 217
Cdd:PRK06091 191 MPEGNIGVIGASGTGIQELCSQIALAGEGITHAIGLGGrdlsAEVGGISALTALEMLSADEKSEVIAFVSKPPAEAVRLK 270
                        170       180
                 ....*....|....*....|...
gi 6980731   218 AAYIKEHVTKPVVGYIAGVTAPK 240
Cdd:PRK06091 271 IINAMKATGKPVVALFLGYTPAV 293
CoA_binding_2 pfam13380
CoA binding domain; This domain has a Rossmann fold and is found in a number of proteins ...
35-127 4.74e-04

CoA binding domain; This domain has a Rossmann fold and is found in a number of proteins including succinyl CoA synthetases, malate and ATP-citrate ligases.


Pssm-ID: 338711 [Multi-domain]  Cd Length: 115  Bit Score: 38.67  E-value: 4.74e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6980731     35 VGGVTPGKGgtTHLGLPVFNTVREAVAAtgATASVIYVPAPFCKDSILEAIDAGIKLIItITEGIPTLDMLTvkvKLDEA 114
Cdd:pfam13380  30 VVPVNPKAK--EILGEPVYPSLADPPEP--VDLVDVFRPPEATPEIVEEALALGAKAVW-LQPGIENEEAAA---AARAA 101
                          90
                  ....*....|...
gi 6980731    115 GVRMIGPNCPGVI 127
Cdd:pfam13380 102 GIRVVGPRCLGVE 114
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.17
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH