NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|699027518]
View 

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
p450 pfam00067
Cytochrome P450. Cytochrome P450s are haem-thiolate proteins involved in the oxidative ...
10-475 4.78e-168

Cytochrome P450. Cytochrome P450s are haem-thiolate proteins involved in the oxidative degradation of various compounds. They are particularly well known for their role in the degradation of environmental toxins and mutagens. They can be divided into 4 classes, according to the method by which electrons from NAD(P)H are delivered to the catalytic site. Sequence conservation is relatively low within the family - there are only 3 absolutely conserved residues - but their general topography and structural fold are highly conserved. The conserved core is composed of a coil termed the 'meander', a four-helix bundle, helices J and K, and two sets of beta-sheets. These constitute the haem-binding loop (with an absolutely conserved cysteine that serves as the 5th ligand for the haem iron), the proton-transfer groove and the absolutely conserved EXXR motif in helix K. While prokaryotic P450s are soluble proteins, most eukaryotic P450s are associated with microsomal membranes. their general enzymatic function is to catalyze regiospecific and stereospecific oxidation of non-activated hydrocarbons at physiological temperatures.


:

Pssm-ID: 365848  Cd Length: 458  Bit Score: 481.77  E-value: 4.78e-168
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518   10 PKSLLSLPLVGSLPFLPRHGHMHNNFFKLQKKYGPIYSVRMGTKTTVIVGHHQLAKEVLIKKGKDFSGRPQMATLDILSN 89
Cdd:pfam00067   1 PPGPPPLPLFGNLLQLGRGGNLHSVFTKLQKKYGPIFRLYLGPKPTVVLSGPEAVKEVLIKKGEEFSGRPDEPWFATSRG 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518   90 --NRKGIAFADsGAHWQLHRRLAMATFALFkdGDQKLEKIICQEISTLCDMLATHNGQS--IDISFPVFVAVTNVISLIC 165
Cdd:pfam00067  81 pfLGKGILFAN-GPRWRQLRRFLTPTFRSF--GKLKFEPRVQEEARDLVEKLRKTAGQPgvIDITFLLFRAALNVICSIL 157
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518  166 FNTSYK-NGDPELNVIQNYNEGIIDNLSKDS--LVDLVPWLKIFPNKTLEKLKSHVKIRNDLLNKILENYKEKFRSDSIT 242
Cdd:pfam00067 158 FGERFGsLEDPKFLELVKAVQELFSLLSSPSpqLLDLFPILKYFPGKHGRKLKRARKKLKDLLDKLIEERRETLDSAGSP 237
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518  243 NM-LDTLMQAKMNSDngnagpdqdsELLSDNHILTTIGDIFGAGVETTTSVVKWTLAFLLHNPQVKKKLYEEIDQNVGFS 321
Cdd:pfam00067 238 RDfLDALLLAKEKDG----------EKLTDEELRATVLDLFFAGTDTTSSTLSWALYELAKNPEVQEKLREEIDEVIGDK 307
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518  322 RTPTISDRNRLLLLEATIREVLRLRPVAPMLIPHKANVDSSIGEFAVDKGTEVIINLWALHHNEKEWHQPDQFMPERFLN 401
Cdd:pfam00067 308 RSPTYDDLQNMPYLDAVIKETLRLHPVVPLLLPREVTKDTVIPGYLIPKGTLVIVNLYALHRDPKVFPNPEEFDPERFLD 387
                         410       420       430       440       450       460       470
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 699027518  402 PAGtqLISPSVSYLPFGAGPRSCIGEILARQELFLIMAWLLQRFDLEVPDDGQLPSLEgIPKVVFLIDSFKVKI 475
Cdd:pfam00067 388 ENG--NFRKSFAFLPFGAGPRNCLGERLARMEMKLFLATLLQNFEVELPPGVDPPDID-ETPLLLPPKPYKLKF 458
 
Name Accession Description Interval E-value
p450 pfam00067
Cytochrome P450. Cytochrome P450s are haem-thiolate proteins involved in the oxidative ...
10-475 4.78e-168

Cytochrome P450. Cytochrome P450s are haem-thiolate proteins involved in the oxidative degradation of various compounds. They are particularly well known for their role in the degradation of environmental toxins and mutagens. They can be divided into 4 classes, according to the method by which electrons from NAD(P)H are delivered to the catalytic site. Sequence conservation is relatively low within the family - there are only 3 absolutely conserved residues - but their general topography and structural fold are highly conserved. The conserved core is composed of a coil termed the 'meander', a four-helix bundle, helices J and K, and two sets of beta-sheets. These constitute the haem-binding loop (with an absolutely conserved cysteine that serves as the 5th ligand for the haem iron), the proton-transfer groove and the absolutely conserved EXXR motif in helix K. While prokaryotic P450s are soluble proteins, most eukaryotic P450s are associated with microsomal membranes. their general enzymatic function is to catalyze regiospecific and stereospecific oxidation of non-activated hydrocarbons at physiological temperatures.


Pssm-ID: 365848  Cd Length: 458  Bit Score: 481.77  E-value: 4.78e-168
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518   10 PKSLLSLPLVGSLPFLPRHGHMHNNFFKLQKKYGPIYSVRMGTKTTVIVGHHQLAKEVLIKKGKDFSGRPQMATLDILSN 89
Cdd:pfam00067   1 PPGPPPLPLFGNLLQLGRGGNLHSVFTKLQKKYGPIFRLYLGPKPTVVLSGPEAVKEVLIKKGEEFSGRPDEPWFATSRG 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518   90 --NRKGIAFADsGAHWQLHRRLAMATFALFkdGDQKLEKIICQEISTLCDMLATHNGQS--IDISFPVFVAVTNVISLIC 165
Cdd:pfam00067  81 pfLGKGILFAN-GPRWRQLRRFLTPTFRSF--GKLKFEPRVQEEARDLVEKLRKTAGQPgvIDITFLLFRAALNVICSIL 157
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518  166 FNTSYK-NGDPELNVIQNYNEGIIDNLSKDS--LVDLVPWLKIFPNKTLEKLKSHVKIRNDLLNKILENYKEKFRSDSIT 242
Cdd:pfam00067 158 FGERFGsLEDPKFLELVKAVQELFSLLSSPSpqLLDLFPILKYFPGKHGRKLKRARKKLKDLLDKLIEERRETLDSAGSP 237
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518  243 NM-LDTLMQAKMNSDngnagpdqdsELLSDNHILTTIGDIFGAGVETTTSVVKWTLAFLLHNPQVKKKLYEEIDQNVGFS 321
Cdd:pfam00067 238 RDfLDALLLAKEKDG----------EKLTDEELRATVLDLFFAGTDTTSSTLSWALYELAKNPEVQEKLREEIDEVIGDK 307
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518  322 RTPTISDRNRLLLLEATIREVLRLRPVAPMLIPHKANVDSSIGEFAVDKGTEVIINLWALHHNEKEWHQPDQFMPERFLN 401
Cdd:pfam00067 308 RSPTYDDLQNMPYLDAVIKETLRLHPVVPLLLPREVTKDTVIPGYLIPKGTLVIVNLYALHRDPKVFPNPEEFDPERFLD 387
                         410       420       430       440       450       460       470
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 699027518  402 PAGtqLISPSVSYLPFGAGPRSCIGEILARQELFLIMAWLLQRFDLEVPDDGQLPSLEgIPKVVFLIDSFKVKI 475
Cdd:pfam00067 388 ENG--NFRKSFAFLPFGAGPRNCLGERLARMEMKLFLATLLQNFEVELPPGVDPPDID-ETPLLLPPKPYKLKF 458
PLN02183 PLN02183
ferulate 5-hydroxylase
9-457 2.56e-54

ferulate 5-hydroxylase


Pssm-ID: 165828  Cd Length: 516  Bit Score: 190.06  E-value: 2.56e-54
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518   9 YPKSLLSLPLVGSLPFLPRHghMHNNFFKLQKKYGPIYSVRMGTKTTVIVGHHQLAKEVLIKKGKDFSGRPQMATLDILS 88
Cdd:PLN02183  37 YPPGPKGLPIIGNMLMMDQL--THRGLANLAKQYGGLFHMRMGYLHMVAVSSPEVARQVLQVQDSVFSNRPANIAISYLT 114
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518  89 NNRKGIAFADSGAHWQLHRRLAMatFALFKDGDQKLEKIICQEISTLCDMLATHNGQSIDISFPVFVAVTNVISLICFNT 168
Cdd:PLN02183 115 YDRADMAFAHYGPFWRQMRKLCV--MKLFSRKRAESWASVRDEVDSMVRSVSSNIGKPVNIGELIFTLTRNITYRAAFGS 192
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518 169 SYKNGDPE-LNVIQNYNEgiidNLSKDSLVDLVPWLKIFPNKTLEKlkSHVKIRNDL---LNKILENYKEK--------F 236
Cdd:PLN02183 193 SSNEGQDEfIKILQEFSK----LFGAFNVADFIPWLGWIDPQGLNK--RLVKARKSLdgfIDDIIDDHIQKrknqnadnD 266
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518 237 RSDSITNMLDTLMQAKMNSDNGNAGPD-QDSELLSDNHILTTIGDIFGAGVETTTSVVKWTLAFLLHNPQVKKKLYEEID 315
Cdd:PLN02183 267 SEEAETDMVDDLLAFYSEEAKVNESDDlQNSIKLTRDNIKAIIMDVMFGGTETVASAIEWAMAELMKSPEDLKRVQQELA 346
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518 316 QNVGFSRTPTISDRNRLLLLEATIREVLRLRPVAPMLIpHKANVDSSIGEFAVDKGTEVIINLWALHHNEKEWHQPDQFM 395
Cdd:PLN02183 347 DVVGLNRRVEESDLEKLTYLKCTLKETLRLHPPIPLLL-HETAEDAEVAGYFIPKRSRVMINAWAIGRDKNSWEDPDTFK 425
                        410       420       430       440       450       460
                 ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 699027518 396 PERFLNPAGTQLISPSVSYLPFGAGPRSCIGEILARQELFLIMAWLLQRFDLEVPdDGQLPS 457
Cdd:PLN02183 426 PSRFLKPGVPDFKGSHFEFIPFGSGRRSCPGMQLGLYALDLAVAHLLHCFTWELP-DGMKPS 486
CypX COG2124
Cytochrome P450 [Secondary metabolites biosynthesis, transport and catabolism, Defense ...
10-456 3.61e-44

Cytochrome P450 [Secondary metabolites biosynthesis, transport and catabolism, Defense mechanisms];


Pssm-ID: 225035 [Multi-domain]  Cd Length: 411  Bit Score: 160.29  E-value: 3.61e-44
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518  10 PKSLLSLPLVGSLPFLPRH--GHMHNNFFKLQKKYGPIYSVRMGTKT--TVIVGHHQLAKEVLIKKGKDFSGRPQMATLD 85
Cdd:COG2124    1 PPPPPAPKLLGSPFALPRLleFAPRFFLERAEDPYGDYFTLRLPGPGdgFWVVSRPADVREVLRDPRFFSSALGAGLRPR 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518  86 ILSN-NRKGIAFADSGAHWQLHRRLAMATFAlfKDGDQKLEKIICQEISTLcdmLATHNGQSIDISFPVFVAVT-NVISL 163
Cdd:COG2124   81 LLRPvLGDGSLLTLDGPEHTRLRKLLAPAFT--PRALRGYRPLIREIADRL---LDDLWQGGADLVLDFAAELTlRVIAE 155
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518 164 ICfntsyknGDPElnviqnynegiidnlskDSLVDLVPW-----LKIFPNKTLEKLKSHVKIRNDLLNKILENYKEKFRS 238
Cdd:COG2124  156 LL-------GVPL-----------------EDRPQLLRWsdallLRLDPDLGPEEPWRRARAARRELDAYLRALIAERRA 211
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518 239 DSITNMLDTLMQAKmnsdngnagpDQDSELLSDNHILTTIGDIFGAGVETTTSVVKWTLAFLLHNPQVKKKLYEEIDqnv 318
Cdd:COG2124  212 APRDDLLSLLLSAE----------DDGGGRLSDDEIRDELITLLVAGHETTANALAWALYALLRHPDQLAKLRAEPD--- 278
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518 319 gfsrtptisdrnrLLLLEATIREVLRLRPVAPMlIPHKANVDSSIGEFAVDKGTEVIINLWALHHNEKEWHQPDQFMPER 398
Cdd:COG2124  279 -------------RPLLEAVVEETLRLYPPVPL-ARRVATEDVELGGYRIPAGTVVLLSIGAANRDPEVFPDPDEFDPER 344
                        410       420       430       440       450
                 ....*....|....*....|....*....|....*....|....*....|....*...
gi 699027518 399 FLNPagtqlispsvsYLPFGAGPRSCIGEILARQELFLIMAWLLQRFDLEVPDDGQLP 456
Cdd:COG2124  345 FNNA-----------HLPFGGGPHRCLGAALARLELKVALAELLRRFPLLLLAEPPPL 391
P450_cycloAA_1 TIGR04538
cytochrome P450, cyclodipeptide synthase-associated; Members of this subfamily are cytochrome ...
263-452 1.38e-12

cytochrome P450, cyclodipeptide synthase-associated; Members of this subfamily are cytochrome P450 enzymes that occur next to tRNA-dependent cyclodipeptide synthases. This group does NOT include CYP121 (Rv2275) from Mycobacterium tuberculosis, adjacent to the cyclodityrosine synthetase Rv2276.


Pssm-ID: 275331  Cd Length: 395  Bit Score: 68.98  E-value: 1.38e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518  263 DQDSELlSDNHILTTIGDIFGAGVETTTSVVKWTLAFLLHNPQvkkkLYEEIdqnvgfsrtptISDRNrllLLEATIREV 342
Cdd:TIGR04538 205 DEGNAM-SDTEILALILNILLAATEPADKTLAYMIYHLLNNPE----QLNDV-----------LDDRK---LLRRAIAET 265
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518  343 LRLRPvaPM-LIPHKANVDSSIGEFAVDKGTEVIINLWALHHNEKEWHQPDQFMPERFLNPAGTQlISPSVSYLPFGAGP 421
Cdd:TIGR04538 266 LRLHS--PVqLIPRQLSQDVTISGKEIKKGDTVFCMIGAANRDPEAFEDPDEFNIHRKDLVNKSA-FTGAARHLAFGSGV 342
                         170       180       190
                  ....*....|....*....|....*....|..
gi 699027518  422 RSCIGEILARQELFLIMAWLLQRF-DLEVPDD 452
Cdd:TIGR04538 343 HNCVGAAFAKRQLEIVANILLDLLkNIRLEED 374
 
Name Accession Description Interval E-value
p450 pfam00067
Cytochrome P450. Cytochrome P450s are haem-thiolate proteins involved in the oxidative ...
10-475 4.78e-168

Cytochrome P450. Cytochrome P450s are haem-thiolate proteins involved in the oxidative degradation of various compounds. They are particularly well known for their role in the degradation of environmental toxins and mutagens. They can be divided into 4 classes, according to the method by which electrons from NAD(P)H are delivered to the catalytic site. Sequence conservation is relatively low within the family - there are only 3 absolutely conserved residues - but their general topography and structural fold are highly conserved. The conserved core is composed of a coil termed the 'meander', a four-helix bundle, helices J and K, and two sets of beta-sheets. These constitute the haem-binding loop (with an absolutely conserved cysteine that serves as the 5th ligand for the haem iron), the proton-transfer groove and the absolutely conserved EXXR motif in helix K. While prokaryotic P450s are soluble proteins, most eukaryotic P450s are associated with microsomal membranes. their general enzymatic function is to catalyze regiospecific and stereospecific oxidation of non-activated hydrocarbons at physiological temperatures.


Pssm-ID: 365848  Cd Length: 458  Bit Score: 481.77  E-value: 4.78e-168
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518   10 PKSLLSLPLVGSLPFLPRHGHMHNNFFKLQKKYGPIYSVRMGTKTTVIVGHHQLAKEVLIKKGKDFSGRPQMATLDILSN 89
Cdd:pfam00067   1 PPGPPPLPLFGNLLQLGRGGNLHSVFTKLQKKYGPIFRLYLGPKPTVVLSGPEAVKEVLIKKGEEFSGRPDEPWFATSRG 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518   90 --NRKGIAFADsGAHWQLHRRLAMATFALFkdGDQKLEKIICQEISTLCDMLATHNGQS--IDISFPVFVAVTNVISLIC 165
Cdd:pfam00067  81 pfLGKGILFAN-GPRWRQLRRFLTPTFRSF--GKLKFEPRVQEEARDLVEKLRKTAGQPgvIDITFLLFRAALNVICSIL 157
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518  166 FNTSYK-NGDPELNVIQNYNEGIIDNLSKDS--LVDLVPWLKIFPNKTLEKLKSHVKIRNDLLNKILENYKEKFRSDSIT 242
Cdd:pfam00067 158 FGERFGsLEDPKFLELVKAVQELFSLLSSPSpqLLDLFPILKYFPGKHGRKLKRARKKLKDLLDKLIEERRETLDSAGSP 237
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518  243 NM-LDTLMQAKMNSDngnagpdqdsELLSDNHILTTIGDIFGAGVETTTSVVKWTLAFLLHNPQVKKKLYEEIDQNVGFS 321
Cdd:pfam00067 238 RDfLDALLLAKEKDG----------EKLTDEELRATVLDLFFAGTDTTSSTLSWALYELAKNPEVQEKLREEIDEVIGDK 307
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518  322 RTPTISDRNRLLLLEATIREVLRLRPVAPMLIPHKANVDSSIGEFAVDKGTEVIINLWALHHNEKEWHQPDQFMPERFLN 401
Cdd:pfam00067 308 RSPTYDDLQNMPYLDAVIKETLRLHPVVPLLLPREVTKDTVIPGYLIPKGTLVIVNLYALHRDPKVFPNPEEFDPERFLD 387
                         410       420       430       440       450       460       470
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 699027518  402 PAGtqLISPSVSYLPFGAGPRSCIGEILARQELFLIMAWLLQRFDLEVPDDGQLPSLEgIPKVVFLIDSFKVKI 475
Cdd:pfam00067 388 ENG--NFRKSFAFLPFGAGPRNCLGERLARMEMKLFLATLLQNFEVELPPGVDPPDID-ETPLLLPPKPYKLKF 458
PLN02183 PLN02183
ferulate 5-hydroxylase
9-457 2.56e-54

ferulate 5-hydroxylase


Pssm-ID: 165828  Cd Length: 516  Bit Score: 190.06  E-value: 2.56e-54
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518   9 YPKSLLSLPLVGSLPFLPRHghMHNNFFKLQKKYGPIYSVRMGTKTTVIVGHHQLAKEVLIKKGKDFSGRPQMATLDILS 88
Cdd:PLN02183  37 YPPGPKGLPIIGNMLMMDQL--THRGLANLAKQYGGLFHMRMGYLHMVAVSSPEVARQVLQVQDSVFSNRPANIAISYLT 114
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518  89 NNRKGIAFADSGAHWQLHRRLAMatFALFKDGDQKLEKIICQEISTLCDMLATHNGQSIDISFPVFVAVTNVISLICFNT 168
Cdd:PLN02183 115 YDRADMAFAHYGPFWRQMRKLCV--MKLFSRKRAESWASVRDEVDSMVRSVSSNIGKPVNIGELIFTLTRNITYRAAFGS 192
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518 169 SYKNGDPE-LNVIQNYNEgiidNLSKDSLVDLVPWLKIFPNKTLEKlkSHVKIRNDL---LNKILENYKEK--------F 236
Cdd:PLN02183 193 SSNEGQDEfIKILQEFSK----LFGAFNVADFIPWLGWIDPQGLNK--RLVKARKSLdgfIDDIIDDHIQKrknqnadnD 266
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518 237 RSDSITNMLDTLMQAKMNSDNGNAGPD-QDSELLSDNHILTTIGDIFGAGVETTTSVVKWTLAFLLHNPQVKKKLYEEID 315
Cdd:PLN02183 267 SEEAETDMVDDLLAFYSEEAKVNESDDlQNSIKLTRDNIKAIIMDVMFGGTETVASAIEWAMAELMKSPEDLKRVQQELA 346
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518 316 QNVGFSRTPTISDRNRLLLLEATIREVLRLRPVAPMLIpHKANVDSSIGEFAVDKGTEVIINLWALHHNEKEWHQPDQFM 395
Cdd:PLN02183 347 DVVGLNRRVEESDLEKLTYLKCTLKETLRLHPPIPLLL-HETAEDAEVAGYFIPKRSRVMINAWAIGRDKNSWEDPDTFK 425
                        410       420       430       440       450       460
                 ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 699027518 396 PERFLNPAGTQLISPSVSYLPFGAGPRSCIGEILARQELFLIMAWLLQRFDLEVPdDGQLPS 457
Cdd:PLN02183 426 PSRFLKPGVPDFKGSHFEFIPFGSGRRSCPGMQLGLYALDLAVAHLLHCFTWELP-DGMKPS 486
PLN02394 PLN02394
trans-cinnamate 4-monooxygenase
32-454 2.43e-53

trans-cinnamate 4-monooxygenase


Pssm-ID: 215221  Cd Length: 503  Bit Score: 187.25  E-value: 2.43e-53
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518  32 HNNFFKLQKKYGPIYSVRMGTKTTVIVGHHQLAKEVLIKKGKDFSGRPQMATLDILSNNRKGIAFADSGAHWQLHRRLAM 111
Cdd:PLN02394  53 HRNLAEMAKKYGDVFLLRMGQRNLVVVSSPELAKEVLHTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGDHWRKMRRIMT 132
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518 112 ATFALFKDGDQKLEKIICQEISTLCDMLATHNGQS--IDISFPVFVAVTNVISLICFNTSYKNGDPELNV---------- 179
Cdd:PLN02394 133 VPFFTNKVVQQYRYGWEEEADLVVEDVRANPEAATegVVIRRRLQLMMYNIMYRMMFDRRFESEDDPLFLklkalngers 212
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518 180 --IQN--YNEGiidnlskdslvDLVPWLKIFpnktlekLKSHVKIRNDLLNKILENYKEKF-------------RSDSIT 242
Cdd:PLN02394 213 rlAQSfeYNYG-----------DFIPILRPF-------LRGYLKICQDVKERRLALFKDYFvderkklmsakgmDKEGLK 274
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518 243 NMLDTLMQAKMNSDngnagpdqdselLSDNHILTTIGDIFGAGVETTTSVVKWTLAFLLHNPQVKKKLYEEIDQNVGFSR 322
Cdd:PLN02394 275 CAIDHILEAQKKGE------------INEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRDELDTVLGPGN 342
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518 323 TPTISDRNRLLLLEATIREVLRLRPVAPMLIPHKANVDSSIGEFAVDKGTEVIINLWALHHNEKEWHQPDQFMPERFL-N 401
Cdd:PLN02394 343 QVTEPDTHKLPYLQAVVKETLRLHMAIPLLVPHMNLEDAKLGGYDIPAESKILVNAWWLANNPELWKNPEEFRPERFLeE 422
                        410       420       430       440       450
                 ....*....|....*....|....*....|....*....|....*....|...
gi 699027518 402 PAGTQLISPSVSYLPFGAGPRSCIGEILARQELFLIMAWLLQRFDLeVPDDGQ 454
Cdd:PLN02394 423 EAKVEANGNDFRFLPFGVGRRSCPGIILALPILGIVLGRLVQNFEL-LPPPGQ 474
PLN02687 PLN02687
flavonoid 3'-monooxygenase
17-456 1.89e-51

flavonoid 3'-monooxygenase


Pssm-ID: 215371  Cd Length: 517  Bit Score: 182.32  E-value: 1.89e-51
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518  17 PLVGSLPFLprHGHMHNNFFKLQKKYGPIYSVRMGTKTTVIVGHHQLAKEVLIKKGKDFSGRPQMATLDILSNNRKGIAF 96
Cdd:PLN02687  43 PVLGNLPQL--GPKPHHTMAALAKTYGPLFRLRFGFVDVVVAASASVAAQFLRTHDANFSNRPPNSGAEHMAYNYQDLVF 120
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518  97 ADSGAHWQLHRRLAMATFALFKDGDQkLEKIICQEISTLCDMLATHNGQ-SIDISFPVFVAVTNVIS--LICFNTSYKNG 173
Cdd:PLN02687 121 APYGPRWRALRKICAVHLFSAKALDD-FRHVREEEVALLVRELARQHGTaPVNLGQLVNVCTTNALGraMVGRRVFAGDG 199
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518 174 DPELN-----VIQNYNEGIIDNLSkdslvDLVP---WLKifPNKTLEKLKSHVKIRNDLLNKILENYK--EKFRSDSITN 243
Cdd:PLN02687 200 DEKARefkemVVELMQLAGVFNVG-----DFVPalrWLD--LQGVVGKMKRLHRRFDAMMNGIIEEHKaaGQTGSEEHKD 272
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518 244 MLDTLMqAKMNSDNGnagpDQDSELLSDNHILTTIGDIFGAGVETTTSVVKWTLAFLLHNPQVKKKLYEEIDQNVGFSRT 323
Cdd:PLN02687 273 LLSTLL-ALKREQQA----DGEGGRITDTEIKALLLNLFTAGTDTTSSTVEWAIAELIRHPDILKKAQEELDAVVGRDRL 347
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518 324 PTISDRNRLLLLEATIREVLRLRPVAPMLIPHKANVDSSIGEFAVDKGTEVIINLWALHHNEKEWHQPDQFMPERFLnPA 403
Cdd:PLN02687 348 VSESDLPQLTYLQAVIKETFRLHPSTPLSLPRMAAEECEINGYHIPKGATLLVNVWAIARDPEQWPDPLEFRPDRFL-PG 426
                        410       420       430       440       450
                 ....*....|....*....|....*....|....*....|....*....|....*..
gi 699027518 404 GTQ----LISPSVSYLPFGAGPRSCIGEILARQELFLIMAWLLQRFDLEVPdDGQLP 456
Cdd:PLN02687 427 GEHagvdVKGSDFELIPFGAGRRICAGLSWGLRMVTLLTATLVHAFDWELA-DGQTP 482
PLN00110 PLN00110
flavonoid 3',5'-hydroxylase (F3'5'H); Provisional
3-455 2.83e-46

flavonoid 3',5'-hydroxylase (F3'5'H); Provisional


Pssm-ID: 177725  Cd Length: 504  Bit Score: 168.11  E-value: 2.83e-46
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518   3 KKTGAKYPKSLLSLPLVGSLPFLprhGHM-HNNFFKLQKKYGPIYSVRMGTKTTVIVGHHQLAKEVLIKKGKDFSGRPQM 81
Cdd:PLN00110  26 PKPSRKLPPGPRGWPLLGALPLL---GNMpHVALAKMAKRYGPVMFLKMGTNSMVVASTPEAARAFLKTLDINFSNRPPN 102
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518  82 ATLDILSNNRKGIAFADSGAHWQLHRRLA---MATFALFKDGDQKLEKIICQEISTLCDmlATHNGQSIDISFPVFVAVT 158
Cdd:PLN00110 103 AGATHLAYGAQDMVFADYGPRWKLLRKLSnlhMLGGKALEDWSQVRTVELGHMLRAMLE--LSQRGEPVVVPEMLTFSMA 180
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518 159 NVISLICFNTS-YKNGDPELNviqNYNEGIIDNLSKDSLV---DLVP---WLKIfpnKTLEKLKSHVKIRND-LLNKILE 230
Cdd:PLN00110 181 NMIGQVILSRRvFETKGSESN---EFKDMVVELMTTAGYFnigDFIPsiaWMDI---QGIERGMKHLHKKFDkLLTRMIE 254
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518 231 NY-----KEKFRSDsitnMLDTLMQAKMNSDngnagpdqdSELLSDNHILTTIGDIFGAGVETTTSVVKWTLAFLLHNPQ 305
Cdd:PLN00110 255 EHtasahERKGNPD----FLDVVMANQENST---------GEKLTLTNIKALLLNLFTAGTDTSSSVIEWSLAEMLKNPS 321
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518 306 VKKKLYEEIDQNVGFSRTPTISDRNRLLLLEATIREVLRLRPVAPMLIPHKANVDSSIGEFAVDKGTEVIINLWALHHNE 385
Cdd:PLN00110 322 ILKRAHEEMDQVIGRNRRLVESDLPKLPYLQAICKESFRKHPSTPLNLPRVSTQACEVNGYYIPKNTRLSVNIWAIGRDP 401
                        410       420       430       440       450       460       470
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 699027518 386 KEWHQPDQFMPERFLNPAGTQlISP---SVSYLPFGAGPRSCIGEILARQELFLIMAWLLQRFDLEVPDDGQL 455
Cdd:PLN00110 402 DVWENPEEFRPERFLSEKNAK-IDPrgnDFELIPFGAGRRICAGTRMGIVLVEYILGTLVHSFDWKLPDGVEL 473
PTZ00404 PTZ00404
cytochrome P450; Provisional
16-455 2.75e-45

cytochrome P450; Provisional


Pssm-ID: 173595  Cd Length: 482  Bit Score: 164.90  E-value: 2.75e-45
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518  16 LPLVGSLPFLPRHGHMhnNFFKLQKKYGPIYSVRMGTKTTVIVGHHQLAKEVLIKKGKDFSGRPQMATLDILSNNRkGIA 95
Cdd:PTZ00404  37 IPILGNLHQLGNLPHR--DLTKMSKKYGGIFRIWFADLYTVVLSDPILIREMFVDNFDNFSDRPKIPSIKHGTFYH-GIV 113
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518  96 fADSGAHWQLHRRLAMAtfALFKDGDQKLEKIICQEISTLCDMLATHNGQS----IDISFPVFVAVTNVISL----ICFN 167
Cdd:PTZ00404 114 -TSSGEYWKRNREIVGK--AMRKTNLKHIYDLLDDQVDVLIESMKKIESSGetfePRYYLTKFTMSAMFKYIfnedISFD 190
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518 168 TSYKNGDpELNVIQNYNEgIIDNLSKDSLVDLVPWLKIFPNKTLEKLKSHVKIRNDLLNKILENYKEKFRSDSITNMLDT 247
Cdd:PTZ00404 191 EDIHNGK-LAELMGPMEQ-VFKDLGSGSLFDVIEITQPLYYQYLEHTDKNFKKIKKFIKEKYHEHLKTIDPEVPRDLLDL 268
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518 248 LMQakmnsdngNAGPDQDSELLSdnhILTTIGDIFGAGVETTTSVVKWTLAFLLHNPQVKKKLYEEIDQNVGFSRTPTIS 327
Cdd:PTZ00404 269 LIK--------EYGTNTDDDILS---ILATILDFFLAGVDTSATSLEWMVLMLCNYPEIQEKAYNEIKSTVNGRNKVLLS 337
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518 328 DRNRLLLLEATIREVLRLRPVAPMLIPHKANVDSSIG-EFAVDKGTEVIINLWALHHNEKEWHQPDQFMPERFLNPagtq 406
Cdd:PTZ00404 338 DRQSTPYTVAIIKETLRYKPVSPFGLPRSTSNDIIIGgGHFIPKDAQILINYYSLGRNEKYFENPEQFDPSRFLNP---- 413
                        410       420       430       440
                 ....*....|....*....|....*....|....*....|....*....
gi 699027518 407 liSPSVSYLPFGAGPRSCIGEILARQELFLIMAWLLQRFDLEVPDDGQL 455
Cdd:PTZ00404 414 --DSNDAFMPFSIGPRNCVGQQFAQDELYLAFSNIILNFKLKSIDGKKI 460
CypX COG2124
Cytochrome P450 [Secondary metabolites biosynthesis, transport and catabolism, Defense ...
10-456 3.61e-44

Cytochrome P450 [Secondary metabolites biosynthesis, transport and catabolism, Defense mechanisms];


Pssm-ID: 225035 [Multi-domain]  Cd Length: 411  Bit Score: 160.29  E-value: 3.61e-44
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518  10 PKSLLSLPLVGSLPFLPRH--GHMHNNFFKLQKKYGPIYSVRMGTKT--TVIVGHHQLAKEVLIKKGKDFSGRPQMATLD 85
Cdd:COG2124    1 PPPPPAPKLLGSPFALPRLleFAPRFFLERAEDPYGDYFTLRLPGPGdgFWVVSRPADVREVLRDPRFFSSALGAGLRPR 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518  86 ILSN-NRKGIAFADSGAHWQLHRRLAMATFAlfKDGDQKLEKIICQEISTLcdmLATHNGQSIDISFPVFVAVT-NVISL 163
Cdd:COG2124   81 LLRPvLGDGSLLTLDGPEHTRLRKLLAPAFT--PRALRGYRPLIREIADRL---LDDLWQGGADLVLDFAAELTlRVIAE 155
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518 164 ICfntsyknGDPElnviqnynegiidnlskDSLVDLVPW-----LKIFPNKTLEKLKSHVKIRNDLLNKILENYKEKFRS 238
Cdd:COG2124  156 LL-------GVPL-----------------EDRPQLLRWsdallLRLDPDLGPEEPWRRARAARRELDAYLRALIAERRA 211
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518 239 DSITNMLDTLMQAKmnsdngnagpDQDSELLSDNHILTTIGDIFGAGVETTTSVVKWTLAFLLHNPQVKKKLYEEIDqnv 318
Cdd:COG2124  212 APRDDLLSLLLSAE----------DDGGGRLSDDEIRDELITLLVAGHETTANALAWALYALLRHPDQLAKLRAEPD--- 278
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518 319 gfsrtptisdrnrLLLLEATIREVLRLRPVAPMlIPHKANVDSSIGEFAVDKGTEVIINLWALHHNEKEWHQPDQFMPER 398
Cdd:COG2124  279 -------------RPLLEAVVEETLRLYPPVPL-ARRVATEDVELGGYRIPAGTVVLLSIGAANRDPEVFPDPDEFDPER 344
                        410       420       430       440       450
                 ....*....|....*....|....*....|....*....|....*....|....*...
gi 699027518 399 FLNPagtqlispsvsYLPFGAGPRSCIGEILARQELFLIMAWLLQRFDLEVPDDGQLP 456
Cdd:COG2124  345 FNNA-----------HLPFGGGPHRCLGAALARLELKVALAELLRRFPLLLLAEPPPL 391
PLN03112 PLN03112
cytochrome P450 family protein; Provisional
16-452 1.32e-42

cytochrome P450 family protein; Provisional


Pssm-ID: 215583  Cd Length: 514  Bit Score: 158.45  E-value: 1.32e-42
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518  16 LPLVGSLpfLPRHGHMHNNFFKLQKKYGPIYSVRMGTKTTVIVGHHQLAKEVLIKKGKDFSGRPQMATLDILSNNRKGIA 95
Cdd:PLN03112  40 WPIVGNL--LQLGPLPHRDLASLCKKYGPLVYLRLGSVDAITTDDPELIREILLRQDDVFASRPRTLAAVHLAYGCGDVA 117
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518  96 FADSGAHWQLHRRLAMATFALFKdgdqKLEKII---CQEISTLCDML--ATHNGQSIDISfPVFVAVT-NVISLICFNTS 169
Cdd:PLN03112 118 LAPLGPHWKRMRRICMEHLLTTK----RLESFAkhrAEEARHLIQDVweAAQTGKPVNLR-EVLGAFSmNNVTRMLLGKQ 192
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518 170 Y----KNGDPELNVIQNYNEGIIDNLSKDSLVDLVPWLKIFPNKTLEKLKSHVKIR-NDLLNKILENYK----EKFRSDS 240
Cdd:PLN03112 193 YfgaeSAGPKEAMEFMHITHELFRLLGVIYLGDYLPAWRWLDPYGCEKKMREVEKRvDEFHDKIIDEHRrarsGKLPGGK 272
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518 241 ITNMLDTLMQakMNSDNGnagpdqdSELLSDNHILTTIGDIFGAGVETTTSVVKWTLAFLLHNPQVKKKLYEEIDQNVGF 320
Cdd:PLN03112 273 DMDFVDVLLS--LPGENG-------KEHMDDVEIKALMQDMIAAATDTSAVTNEWAMAEVIKNPRVLRKIQEELDSVVGR 343
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518 321 SRTPTISDRNRLLLLEATIREVLRLRPVAPMLIPHKANVDSSIGEFAVDKGTEVIINLWALHHNEKEWHQPDQFMPERFL 400
Cdd:PLN03112 344 NRMVQESDLVHLNYLRCVVRETFRMHPAGPFLIPHESLRATTINGYYIPAKTRVFINTHGLGRNTKIWDDVEEFRPERHW 423
                        410       420       430       440       450
                 ....*....|....*....|....*....|....*....|....*....|....*
gi 699027518 401 NPAGTQL-IS--PSVSYLPFGAGPRSCIGEILARQELFLIMAWLLQRFDLEVPDD 452
Cdd:PLN03112 424 PAEGSRVeIShgPDFKILPFSAGKRKCPGAPLGVTMVLMALARLFHCFDWSPPDG 478
PLN02655 PLN02655
ent-kaurene oxidase
16-451 2.91e-41

ent-kaurene oxidase


Pssm-ID: 215354  Cd Length: 466  Bit Score: 153.74  E-value: 2.91e-41
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518  16 LPLVGSLPFLpRHGHMHNNFFKLQKKYGPIYSVRMGTKTTVIVGHHQLAKEVLIKKGKDFSGRPQMATLDILSNNRKGIA 95
Cdd:PLN02655   7 LPVIGNLLQL-KEKKPHRTFTKWSEIYGPIYTIRTGASSVVVLNSTEVAKEAMVTKFSSISTRKLSKALTVLTRDKSMVA 85
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518  96 FADSGAHWQLHRRLAMAtfALFKDGDQKL-----EKIICQEISTLCDMLATHNGQSIDisfpvfvavtnvislicFNTSY 170
Cdd:PLN02655  86 TSDYGDFHKMVKRYVMN--NLLGANAQKRfrdtrDMLIENMLSGLHALVKDDPHSPVN-----------------FRDVF 146
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518 171 KNGDPELNVIQNYNEGI----IDNLSK--------DSLV-------------DLVPWLKIFPNKTLEKLKSHVKIRND-L 224
Cdd:PLN02655 147 ENELFGLSLIQALGEDVesvyVEELGTeiskeeifDVLVhdmmmcaievdwrDFFPYLSWIPNKSFETRVQTTEFRRTaV 226
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518 225 LNKILENYKEKF-RSDSITNMLDTLMQAKMNsdngnagpdqdselLSDNHILTTIGDIFGAGVETTTSVVKWTLAFLLHN 303
Cdd:PLN02655 227 MKALIKQQKKRIaRGEERDCYLDFLLSEATH--------------LTDEQLMMLVWEPIIEAADTTLVTTEWAMYELAKN 292
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518 304 PQVKKKLYEEIdQNVGFSRTPTISDRNRLLLLEATIREVLRLRPVAPMLIPHKANVDSSIGEFAVDKGTEVIINLWALHH 383
Cdd:PLN02655 293 PDKQERLYREI-REVCGDERVTEEDLPNLPYLNAVFHETLRKYSPVPLLPPRFVHEDTTLGGYDIPAGTQIAINIYGCNM 371
                        410       420       430       440       450       460
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 699027518 384 NEKEWHQPDQFMPERFLNPAGTqlISPSVSYLPFGAGPRSCIGEILARQELFLIMAWLLQRFDLEVPD 451
Cdd:PLN02655 372 DKKRWENPEEWDPERFLGEKYE--SADMYKTMAFGAGKRVCAGSLQAMLIACMAIARLVQEFEWRLRE 437
PLN02966 PLN02966
cytochrome P450 83A1
8-451 4.16e-40

cytochrome P450 83A1


Pssm-ID: 178550  Cd Length: 502  Bit Score: 151.05  E-value: 4.16e-40
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518   8 KYPKSLLSLPLVGSLPFLPRHgHMHNNFFKLQKKYGPIYSVRMGTKTTVIVGHHQLAKEVLIKKGKDFSGRPQMATLDIL 87
Cdd:PLN02966  29 KLPPGPSPLPVIGNLLQLQKL-NPQRFFAGWAKKYGPILSYRIGSRTMVVISSAELAKELLKTQDVNFADRPPHRGHEFI 107
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518  88 SNNRKGIAFADSGAHWQLHRRLAM------ATFALFKDGDQKLEKIICQEISTLCDmlathNGQSIDISFPVFVAVTNVI 161
Cdd:PLN02966 108 SYGRRDMALNHYTPYYREIRKMGMnhlfspTRVATFKHVREEEARRMMDKINKAAD-----KSEVVDISELMLTFTNSVV 182
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518 162 SLICFNTSYKNGDPELNVIQNYNEGIIDNLSKDSLVDLVPW---------LKIFPNKTLEKLKSHVKirnDLLNKILENY 232
Cdd:PLN02966 183 CRQAFGKKYNEDGEEMKRFIKILYGTQSVLGKIFFSDFFPYcgflddlsgLTAYMKECFERQDTYIQ---EVVNETLDPK 259
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518 233 KEKFRSDSitnMLDTLMQAKMNSDNGnagpdqdSELLSDNhILTTIGDIFGAGVETTTSVVKWTLAFLLHNPQVKKKLYE 312
Cdd:PLN02966 260 RVKPETES---MIDLLMEIYKEQPFA-------SEFTVDN-VKAVILDIVVAGTDTAAAAVVWGMTYLMKYPQVLKKAQA 328
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518 313 EI-----DQNVGFSrtpTISDRNRLLLLEATIREVLRLRPVAPMLIPHKANVDSSIGEFAVDKGTEVIINLWALHHNEKE 387
Cdd:PLN02966 329 EVreymkEKGSTFV---TEDDVKNLPYFRALVKETLRIEPVIPLLIPRACIQDTKIAGYDIPAGTTVNVNAWAVSRDEKE 405
                        410       420       430       440       450       460
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 699027518 388 WH-QPDQFMPERFLNPAgTQLISPSVSYLPFGAGPRSCIGEILARQELFLIMAWLLQRFDLEVPD 451
Cdd:PLN02966 406 WGpNPDEFRPERFLEKE-VDFKGTDYEFIPFGSGRRMCPGMRLGAAMLEVPYANLLLNFNFKLPN 469
PLN02738 PLN02738
carotene beta-ring hydroxylase
2-449 7.92e-40

carotene beta-ring hydroxylase


Pssm-ID: 215393 [Multi-domain]  Cd Length: 633  Bit Score: 152.37  E-value: 7.92e-40
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518   2 AKKTGAKYPKSLLSLPLVGSLPF-LPrhghmhnnFFKLQKKYGPIYSVRMGTKTTVIVGHHQLAKEVLIKKGKDFSGRPQ 80
Cdd:PLN02738 131 AGEGYPKIPEAKGSISAVRGEAFfIP--------LYELFLTYGGIFRLTFGPKSFLIVSDPSIAKHILRDNSKAYSKGIL 202
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518  81 MATLDILSNnrKGIAFADsGAHWQ---------LHRRLAMATFALFKDGDQKLekiiCQEISTlcdmlATHNGQSIDISf 151
Cdd:PLN02738 203 AEILEFVMG--KGLIPAD-GEIWRvrrraivpaLHQKYVAAMISLFGQASDRL----CQKLDA-----AASDGEDVEME- 269
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518 152 PVFVAVT-NVISLICFNTSYKNgdpelnviQNYNEGIIDNL------SKDSLVDLVP------WLKIFPNKtlEKLKSHV 218
Cdd:PLN02738 270 SLFSRLTlDIIGKAVFNYDFDS--------LSNDTGIVEAVytvlreAEDRSVSPIPvweipiWKDISPRQ--RKVAEAL 339
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518 219 KIRNDLLNKILE-----------NYKEKFRSDSITNMLDTLMQAkmnsdngnaGPDQDSELLSDNHILTTIgdifgAGVE 287
Cdd:PLN02738 340 KLINDTLDDLIAickrmveeeelQFHEEYMNERDPSILHFLLAS---------GDDVSSKQLRDDLMTMLI-----AGHE 405
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518 288 TTTSVVKWTLAFLLHNPQVKKKLYEEIDQNVGfSRTPTISDRNRLLLLEATIREVLRLRPVAPMLIpHKANVDSSIGEFA 367
Cdd:PLN02738 406 TSAAVLTWTFYLLSKEPSVVAKLQEEVDSVLG-DRFPTIEDMKKLKYTTRVINESLRLYPQPPVLI-RRSLENDMLGGYP 483
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518 368 VDKGTEVIINLWALHHNEKEWHQPDQFMPERF-LNPAGTQLISPSVSYLPFGAGPRSCIGEILARQELFLIMAWLLQRFD 446
Cdd:PLN02738 484 IKRGEDIFISVWNLHRSPKHWDDAEKFNPERWpLDGPNPNETNQNFSYLPFGGGPRKCVGDMFASFENVVATAMLVRRFD 563

                 ...
gi 699027518 447 LEV 449
Cdd:PLN02738 564 FQL 566
PLN03234 PLN03234
cytochrome P450 83B1; Provisional
4-450 1.08e-36

cytochrome P450 83B1; Provisional


Pssm-ID: 178773  Cd Length: 499  Bit Score: 141.75  E-value: 1.08e-36
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518   4 KTGAKYPKSLLSLPLVGSLPFLPRHGHMHNnFFKLQKKYGPIYSVRMGTKTTVIVGHHQLAKEVLIKKGKDFSGRPQMAT 83
Cdd:PLN03234  24 KKSLRLPPGPKGLPIIGNLHQMEKFNPQHF-LFRLSKLYGPIFTMKIGGRRLAVISSAELAKELLKTQDLNFTARPLLKG 102
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518  84 LDILSNNRKGIAFADSGAHWQLHRRLAMATfaLFKDGD-QKLEKIICQEISTLCDMLATHNGQS--IDISfPVFVAVTN- 159
Cdd:PLN03234 103 QQTMSYQGRELGFGQYTAYYREMRKMCMVN--LFSPNRvASFRPVREEECQRMMDKIYKAADQSgtVDLS-ELLLSFTNc 179
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518 160 VISLICFNTSYKNGDPELNVIQNYNEGIIDNLSKDSLVDLVPWLKIFPNKT--LEKLKSHVKIRNDLLNKILENYKEKFR 237
Cdd:PLN03234 180 VVCRQAFGKRYNEYGTEMKRFIDILYETQALLGTLFFSDLFPYFGFLDNLTglSARLKKAFKELDTYLQELLDETLDPNR 259
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518 238 SDSIT-NMLDTLMQAKmnsdngnagPDQDSEL-LSDNHILTTIGDIFGAGVETTTSVVKWTLAFLLHNPQVKKKLYEEID 315
Cdd:PLN03234 260 PKQETeSFIDLLMQIY---------KDQPFSIkFTHENVKAMILDIVVPGTDTAAAVVVWAMTYLIKYPEAMKKAQDEVR 330
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518 316 QNVGFSRTPTISDRNRLLLLEATIREVLRLRPVAPMLIPHKANVDSSIGEFAVDKGTEVIINLWALHHNEKEW-HQPDQF 394
Cdd:PLN03234 331 NVIGDKGYVSEEDIPNLPYLKAVIKESLRLEPVIPILLHRETIADAKIGGYDIPAKTIIQVNAWAVSRDTAAWgDNPNEF 410
                        410       420       430       440       450
                 ....*....|....*....|....*....|....*....|....*....|....*..
gi 699027518 395 MPERFLNP-AGTQLISPSVSYLPFGAGPRSCIGEILARQELFLIMAWLLQRFDLEVP 450
Cdd:PLN03234 411 IPERFMKEhKGVDFKGQDFELLPFGSGRRMCPAMHLGIAMVEIPFANLLYKFDWSLP 467
PLN00168 PLN00168
Cytochrome P450; Provisional
4-452 1.79e-36

Cytochrome P450; Provisional


Pssm-ID: 215086  Cd Length: 519  Bit Score: 141.24  E-value: 1.79e-36
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518   4 KTGAKYPKSLLSLPLVGSLPFLPRHG-HMHNNFFKLQKKYGPIYSVRMGTKTTVIVGHHQLAKEVLIKKGKDFSGRPQMA 82
Cdd:PLN00168  31 KKGRRLPPGPPAVPLLGSLVWLTNSSaDVEPLLRRLIARYGPVVSLRVGSRLSVFVADRRLAHAALVERGAALADRPAVA 110
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518  83 TLDILSNNRKGIAFADSGAHWQLHRRLAMATFA------LFKDGDQKLEKIicqeistLCDMLATHNG--QSIDISFPVF 154
Cdd:PLN00168 111 SSRLLGESDNTITRSSYGPVWRLLRRNLVAETLhpsrvrLFAPARAWVRRV-------LVDKLRREAEdaAAPRVVETFQ 183
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518 155 VAVTNVISLICFNTsyKNGDPELNVIQNYNEGIIDNLSKDSLV-DLVPWL-KIFPNKTLEKLKSHVKIRNDLLNKILENY 232
Cdd:PLN00168 184 YAMFCLLVLMCFGE--RLDEPAVRAIAAAQRDWLLYVSKKMSVfAFFPAVtKHLFRGRLQKALALRRRQKELFVPLIDAR 261
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518 233 KEKFRSDSITN------------MLDTLMQAKMNSDNGNAgpdqdselLSDNHILTTIGDIFGAGVETTTSVVKWTLAFL 300
Cdd:PLN00168 262 REYKNHLGQGGeppkkettfehsYVDTLLDIRLPEDGDRA--------LTDDEIVNLCSEFLNAGTDTTSTALQWIMAEL 333
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518 301 LHNPQVKKKLYEEIDQNVGfSRTPTIS--DRNRLLLLEATIREVLRLRPVAPMLIPHKANVDSSIGEFAVDKGTEVIINL 378
Cdd:PLN00168 334 VKNPSIQSKLHDEIKAKTG-DDQEEVSeeDVHKMPYLKAVVLEGLRKHPPAHFVLPHKAAEDMEVGGYLIPKGATVNFMV 412
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518 379 WALHHNEKEWHQPDQFMPERFLnPAG-------TQliSPSVSYLPFGAGPRSCIGEILARQELFLIMAWLLQRFDL-EVP 450
Cdd:PLN00168 413 AEMGRDEREWERPMEFVPERFL-AGGdgegvdvTG--SREIRMMPFGVGRRICAGLGIAMLHLEYFVANMVREFEWkEVP 489

                 ..
gi 699027518 451 DD 452
Cdd:PLN00168 490 GD 491
PLN02936 PLN02936
epsilon-ring hydroxylase
18-451 2.77e-32

epsilon-ring hydroxylase


Pssm-ID: 178524  Cd Length: 489  Bit Score: 128.76  E-value: 2.77e-32
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518  18 LVGSLPFLPrhghmhnnFFKLQKKYGPIYSVRMGTKTTVIVGHHQLAKEVLikkgKDFSGRPQMATLDILSNNRKGIAFA 97
Cdd:PLN02936  33 LLGGALFLP--------LFKWMNEYGPVYRLAAGPRNFVVVSDPAIAKHVL----RNYGSKYAKGLVAEVSEFLFGSGFA 100
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518  98 -DSGAHWQLHRRlAMATFALFKDGDQKLEKIICQEISTLCDMLATH--NGQSIDISFPVFVAVTNVISLICFNTSYKNGD 174
Cdd:PLN02936 101 iAEGELWTARRR-AVVPSLHRRYLSVMVDRVFCKCAERLVEKLEPValSGEAVNMEAKFSQLTLDVIGLSVFNYNFDSLT 179
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518 175 PELNVIQNYNEGIIDNLSKDSlvDLVPWLK------IFP------------NKTLEKLKSHVKIRNDLLNKILENykEKF 236
Cdd:PLN02936 180 TDSPVIQAVYTALKEAETRST--DLLPYWKvdflckISPrqikaekavtviRETVEDLVDKCKEIVEAEGEVIEG--EEY 255
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518 237 RSDSITNMLDTLMQAKmnsdngnagpdqdsELLSDNHILTTIGDIFGAGVETTTSVVKWTLAFLLHNPQVKKKLYEEIDQ 316
Cdd:PLN02936 256 VNDSDPSVLRFLLASR--------------EEVSSVQLRDDLLSMLVAGHETTGSVLTWTLYLLSKNPEALRKAQEELDR 321
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518 317 NVGfSRTPTISDRNRLLLLEATIREVLRLRPVAPMLIpHKANVDSSI-GEFAVDKGTEVIINLWALHHNEKEWHQPDQFM 395
Cdd:PLN02936 322 VLQ-GRPPTYEDIKELKYLTRCINESMRLYPHPPVLI-RRAQVEDVLpGGYKVNAGQDIMISVYNIHRSPEVWERAEEFV 399
                        410       420       430       440       450       460
                 ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 699027518 396 PERFlNPAGTQlisPSVS-----YLPFGAGPRSCIGEILARQELFLIMAWLLQRFDLE-VPD 451
Cdd:PLN02936 400 PERF-DLDGPV---PNETntdfrYIPFSGGPRKCVGDQFALLEAIVALAVLLQRLDLElVPD 457
PLN02290 PLN02290
cytokinin trans-hydroxylase
40-452 2.17e-31

cytokinin trans-hydroxylase


Pssm-ID: 215164  Cd Length: 516  Bit Score: 126.47  E-value: 2.17e-31
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518  40 KKYGPIYSVRMGTKTTVIVGHHQLAKEVLIKKG-------------KDFSGRpqmatldilsnnrkGIAFADsGAHWQLH 106
Cdd:PLN02290  91 KQYGKRFIYWNGTEPRLCLTETELIKELLTKYNtvtgkswlqqqgtKHFIGR--------------GLLMAN-GADWYHQ 155
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518 107 RRLAMATFAlfkdGDqKLEKIICQEISTLCDML-----ATHNGQS-IDISFPVFVAVTNVISLICFNTSYKNGDPELNVI 180
Cdd:PLN02290 156 RHIAAPAFM----GD-RLKGYAGHMVECTKQMLqslqkAVESGQTeVEIGEYMTRLTADIISRTEFDSSYEKGKQIFHLL 230
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518 181 QnynegIIDNLSKDSLVDL-VPWLKIFPNKTLEKLKSHVKIRNDLLNKILENYK---EKFRSDSITNMLDTLMQAKMNSD 256
Cdd:PLN02290 231 T-----VLQRLCAQATRHLcFPGSRFFPSKYNREIKSLKGEVERLLMEIIQSRRdcvEIGRSSSYGDDLLGMLLNEMEKK 305
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518 257 NGNaGPDQDSELLSDNhilttIGDIFGAGVETTTSVVKWTLAFLLHNPQVKKKLYEEIDQNVGfSRTPTISDRNRLLLLE 336
Cdd:PLN02290 306 RSN-GFNLNLQLIMDE-----CKTFFFAGHETTALLLTWTLMLLASNPTWQDKVRAEVAEVCG-GETPSVDHLSKLTLLN 378
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518 337 ATIREVLRLRPVAPMLiPHKANVDSSIGEFAVDKGTEVIINLWALHHNEKEWHQ-PDQFMPERFlnpaGTQLISPSVSYL 415
Cdd:PLN02290 379 MVINESLRLYPPATLL-PRMAFEDIKLGDLHIPKGLSIWIPVLAIHHSEELWGKdANEFNPDRF----AGRPFAPGRHFI 453
                        410       420       430
                 ....*....|....*....|....*....|....*..
gi 699027518 416 PFGAGPRSCIGEILARQELFLIMAWLLQRFDLEVPDD 452
Cdd:PLN02290 454 PFAAGPRNCIGQAFAMMEAKIILAMLISKFSFTISDN 490
PLN02971 PLN02971
tryptophan N-hydroxylase
3-452 3.65e-31

tryptophan N-hydroxylase


Pssm-ID: 166612  Cd Length: 543  Bit Score: 126.31  E-value: 3.65e-31
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518   3 KKTGAKYPKSLLSLPLVGSLPFLPRHGHMHNNFFKLQKKYGP-IYSVRMGTKTTVIVGHHQLAKEVLIKKGKDFSGRPQM 81
Cdd:PLN02971  52 NKKLHPLPPGPTGFPIVGMIPAMLKNRPVFRWLHSLMKELNTeIACVRLGNTHVIPVTCPKIAREIFKQQDALFASRPLT 131
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518  82 ATLDILSNNRKGIAFADSGAHWQLHRRLAMaTFALFKDGDQKLEKIICQEISTLCDML--ATHNGQSIDISFPVFVAVTN 159
Cdd:PLN02971 132 YAQKILSNGYKTCVITPFGEQFKKMRKVIM-TEIVCPARHRWLHDNRAEETDHLTAWLynMVKNSEPVDLRFVTRHYCGN 210
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518 160 VISLICFNT------SYKNGDPELNVIQNYnEGIIDNLSKD---SLVDLVPWLKIFPNKTLEKLKSHV-----KIRNDLL 225
Cdd:PLN02971 211 AIKRLMFGTrtfsekTEPDGGPTLEDIEHM-DAMFEGLGFTfafCISDYLPMLTGLDLNGHEKIMRESsaimdKYHDPII 289
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518 226 NKILENYKEKFRSdSITNMLDTLMQAKmnsdngnagPDQDSELLSDNHILTTIGDIFGAGVETTTSVVKWTLAFLLHNPQ 305
Cdd:PLN02971 290 DERIKMWREGKRT-QIEDFLDIFISIK---------DEAGQPLLTADEIKPTIKELVMAAPDNPSNAVEWAMAEMINKPE 359
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518 306 VKKKLYEEIDQNVGFSRTPTISDRNRLLLLEATIREVLRLRPVAPMLIPHKANVDSSIGEFAVDKGTEVIINLWALHHNE 385
Cdd:PLN02971 360 ILHKAMEEIDRVVGKERFVQESDIPKLNYVKAIIREAFRLHPVAAFNLPHVALSDTTVAGYHIPKGSQVLLSRYGLGRNP 439
                        410       420       430       440       450       460
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 699027518 386 KEWHQPDQFMPERFLNPAG-TQLISPSVSYLPFGAGPRSCIGEILARQELFLIMAWLLQRFDLEVPDD 452
Cdd:PLN02971 440 KVWSDPLSFKPERHLNECSeVTLTENDLRFISFSTGKRGCAAPALGTAITTMMLARLLQGFKWKLAGS 507
PLN03018 PLN03018
homomethionine N-hydroxylase
17-459 4.15e-26

homomethionine N-hydroxylase


Pssm-ID: 178592  Cd Length: 534  Bit Score: 111.26  E-value: 4.15e-26
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518  17 PLVGSLPFL----PRHGHMHNNFFKLQKKygpIYSVRMGTKTTVIVGHHQLAKEVLIKKGKDFSGRPQMATLDILSNNRK 92
Cdd:PLN03018  49 PILGNLPELimtrPRSKYFHLAMKELKTD---IACFNFAGTHTITINSDEIAREAFRERDADLADRPQLSIMETIGDNYK 125
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518  93 GIAFADSGAHWQLHRR-----------LAMATFALFKDGD----------QKLEKIICQEISTLcdmlathngQSIDISF 151
Cdd:PLN03018 126 SMGTSPYGEQFMKMKKvitteimsvktLNMLEAARTIEADnliayihsmyQRSETVDVRELSRV---------YGYAVTM 196
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518 152 PVFVAVTNVISLICFNTSYKNGDPE---LNVIQNynegIIDNLSKDSLVDLVP-WLKIFP-NKTLEKLKSHVKI----RN 222
Cdd:PLN03018 197 RMLFGRRHVTKENVFSDDGRLGKAEkhhLEVIFN----TLNCLPGFSPVDYVErWLRGWNiDGQEERAKVNVNLvrsyNN 272
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518 223 DLLNKILENYKEKFRSDSITNMLDTLMQAKmnSDNGNAgpdqdseLLSDNHILTTIGDIFGAGVETTTSVVKWTLAFLLH 302
Cdd:PLN03018 273 PIIDERVELWREKGGKAAVEDWLDTFITLK--DQNGKY-------LVTPDEIKAQCVEFCIAAIDNPANNMEWTLGEMLK 343
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518 303 NPQVKKKLYEEIDQNVGFSRTPTISDRNRLLLLEATIREVLRLRPVAPMLIPHKANVDSSIGEFAVDKGTEVIINLWALH 382
Cdd:PLN03018 344 NPEILRKALKELDEVVGKDRLVQESDIPNLNYLKACCRETFRIHPSAHYVPPHVARQDTTLGGYFIPKGSHIHVCRPGLG 423
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518 383 HNEKEWHQPDQFMPERFLNPAG----TQLISPSVSYLPFGAGPRSCIGEILARQELFLIMAWLLQRFDLEVPDDGQLPSL 458
Cdd:PLN03018 424 RNPKIWKDPLVYEPERHLQGDGitkeVTLVETEMRFVSFSTGRRGCVGVKVGTIMMVMMLARFLQGFNWKLHQDFGPLSL 503

                 .
gi 699027518 459 E 459
Cdd:PLN03018 504 E 504
PLN02302 PLN02302
ent-kaurenoic acid oxidase
208-448 7.14e-19

ent-kaurenoic acid oxidase


Pssm-ID: 215171  Cd Length: 490  Bit Score: 89.00  E-value: 7.14e-19
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518 208 NKTLEKLKSHVKIRNDLLNKILENYKEKFRSDSiTNMLDTLMQAKmnsdngnagpDQDSELLSDNHILTTIGDIFGAGVE 287
Cdd:PLN02302 233 HRALKARKKLVALFQSIVDERRNSRKQNISPRK-KDMLDLLLDAE----------DENGRKLDDEEIIDLLLMYLNAGHE 301
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518 288 TTTSVVKWTLAFLLHNPQVKKKLYEEIDQnVGFSRTP-----TISDRNRLLLLEATIREVLRLRPVAPMLIpHKANVDSS 362
Cdd:PLN02302 302 SSGHLTMWATIFLQEHPEVLQKAKAEQEE-IAKKRPPgqkglTLKDVRKMEYLSQVIDETLRLINISLTVF-REAKTDVE 379
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518 363 IGEFAVDKGTEVIINLWALHHNEKEWHQPDQFMPERFLNP---AGTqlispsvsYLPFGAGPRSCIGEILARQELFLIMA 439
Cdd:PLN02302 380 VNGYTIPKGWKVLAWFRQVHMDPEVYPNPKEFDPSRWDNYtpkAGT--------FLPFGLGSRLCPGNDLAKLEISIFLH 451

                 ....*....
gi 699027518 440 WLLQRFDLE 448
Cdd:PLN02302 452 HFLLGYRLE 460
PLN02169 PLN02169
fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase
270-466 1.58e-15

fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase


Pssm-ID: 177826  Cd Length: 500  Bit Score: 78.90  E-value: 1.58e-15
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518 270 SDNHILTTIGDIFGAGVETTTSVVKWTLAFLLHNPQVKKKLYEEIdqNVGFSRtptiSDRNRLLLLEATIREVLRLRPVA 349
Cdd:PLN02169 298 KDKFIRDVIFSLVLAGRDTTSSALTWFFWLLSKHPQVMAKIRHEI--NTKFDN----EDLEKLVYLHAALSESMRLYPPL 371
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518 350 PMLIPHKANVDSSIGEFAVDKGTEVIINLWALHHNEKEWHQ-PDQFMPERFLNPAGTQLISPSVSYLPFGAGPRSCIGEI 428
Cdd:PLN02169 372 PFNHKAPAKPDVLPSGHKVDAESKIVICIYALGRMRSVWGEdALDFKPERWISDNGGLRHEPSYKFMAFNSGPRTCLGKH 451
                        170       180       190
                 ....*....|....*....|....*....|....*...
gi 699027518 429 LARQELFLIMAWLLQRFDLEVPDDGQlpsLEGIPKVVF 466
Cdd:PLN02169 452 LALLQMKIVALEIIKNYDFKVIEGHK---IEAIPSILL 486
PLN02196 PLN02196
abscisic acid 8'-hydroxylase
218-453 3.58e-14

abscisic acid 8'-hydroxylase


Pssm-ID: 177847  Cd Length: 463  Bit Score: 74.20  E-value: 3.58e-14
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518 218 VKIRNDLLNKILENYKEkfRSDSITNMLDTLMQAKMNSDNGNAGPDQDSELLSDNHIL-TTIGDIFGAGvETTTSVVKWT 296
Cdd:PLN02196 211 INLPGTLFHKSMKARKE--LAQILAKILSKRRQNGSSHNDLLGSFMGDKEGLTDEQIAdNIIGVIFAAR-DTTASVLTWI 287
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518 297 LAFLLHNPQVKKKLYEE---IDQNVGFSRTPTISDRNRLLLLEATIREVLRLRPVAPMLIpHKANVDSSIGEFAVDKGTE 373
Cdd:PLN02196 288 LKYLAENPSVLEAVTEEqmaIRKDKEEGESLTWEDTKKMPLTSRVIQETLRVASILSFTF-REAVEDVEYEGYLIPKGWK 366
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518 374 VIINLWALHHNEKEWHQPDQFMPERFlnpagtQLISPSVSYLPFGAGPRSCIGEILARQELFLIMAWLLQ--RFDLEVPD 451
Cdd:PLN02196 367 VLPLFRNIHHSADIFSDPGKFDPSRF------EVAPKPNTFMPFGNGTHSCPGNELAKLEISVLIHHLTTkyRWSIVGTS 440

                 ..
gi 699027518 452 DG 453
Cdd:PLN02196 441 NG 442
PLN02987 PLN02987
Cytochrome P450, family 90, subfamily A
248-445 6.29e-13

Cytochrome P450, family 90, subfamily A


Pssm-ID: 166628  Cd Length: 472  Bit Score: 70.39  E-value: 6.29e-13
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518 248 LMQAKMNSDNGnagpdqdselLSDNHILTTIGDIFGAGVETTTSVVKWTLAFLLHNPQVKKKLYEEIDQNVGFSRTPTI- 326
Cdd:PLN02987 252 MLAALLASDDG----------FSDEEIVDFLVALLVAGYETTSTIMTLAVKFLTETPLALAQLKEEHEKIRAMKSDSYSl 321
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518 327 --SDRNRLLLLEATIREVLRlrpVAPML--IPHKANVDSSIGEFAVDKGTEVIINLWALHHNEKEWHQPDQFMPERFLNP 402
Cdd:PLN02987 322 ewSDYKSMPFTQCVVNETLR---VANIIggIFRRAMTDIEVKGYTIPKGWKVFASFRAVHLDHEYFKDARTFNPWRWQSN 398
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|...
gi 699027518 403 AGTQLisPSVSYLPFGAGPRSCIGEILARQELFLIMAWLLQRF 445
Cdd:PLN02987 399 SGTTV--PSNVFTPFGGGPRLCPGYELARVALSVFLHRLVTRF 439
P450_cycloAA_1 TIGR04538
cytochrome P450, cyclodipeptide synthase-associated; Members of this subfamily are cytochrome ...
263-452 1.38e-12

cytochrome P450, cyclodipeptide synthase-associated; Members of this subfamily are cytochrome P450 enzymes that occur next to tRNA-dependent cyclodipeptide synthases. This group does NOT include CYP121 (Rv2275) from Mycobacterium tuberculosis, adjacent to the cyclodityrosine synthetase Rv2276.


Pssm-ID: 275331  Cd Length: 395  Bit Score: 68.98  E-value: 1.38e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518  263 DQDSELlSDNHILTTIGDIFGAGVETTTSVVKWTLAFLLHNPQvkkkLYEEIdqnvgfsrtptISDRNrllLLEATIREV 342
Cdd:TIGR04538 205 DEGNAM-SDTEILALILNILLAATEPADKTLAYMIYHLLNNPE----QLNDV-----------LDDRK---LLRRAIAET 265
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518  343 LRLRPvaPM-LIPHKANVDSSIGEFAVDKGTEVIINLWALHHNEKEWHQPDQFMPERFLNPAGTQlISPSVSYLPFGAGP 421
Cdd:TIGR04538 266 LRLHS--PVqLIPRQLSQDVTISGKEIKKGDTVFCMIGAANRDPEAFEDPDEFNIHRKDLVNKSA-FTGAARHLAFGSGV 342
                         170       180       190
                  ....*....|....*....|....*....|..
gi 699027518  422 RSCIGEILARQELFLIMAWLLQRF-DLEVPDD 452
Cdd:TIGR04538 343 HNCVGAAFAKRQLEIVANILLDLLkNIRLEED 374
PLN02500 PLN02500
cytochrome P450 90B1
269-454 4.02e-10

cytochrome P450 90B1


Pssm-ID: 215276  Cd Length: 490  Bit Score: 61.80  E-value: 4.02e-10
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518 269 LSDNHILTTIGDIFGAGVETTTSVVKWTLAFLLHNPQVKKKLYEEidqNVGFSRTPTIS--------DRNRLLLLEATIR 340
Cdd:PLN02500 275 LSTEQILDLILSLLFAGHETSSVAIALAIFFLQGCPKAVQELREE---HLEIARAKKQSgeselnweDYKKMEFTQCVIN 351
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518 341 EVLRLRPVAPMLiPHKANVDSSIGEFAVDKGTEVIINLWALHHNEKEWHQPDQFMPERFL--NPAGTQLISPSV---SYL 415
Cdd:PLN02500 352 ETLRLGNVVRFL-HRKALKDVRYKGYDIPSGWKVLPVIAAVHLDSSLYDQPQLFNPWRWQqnNNRGGSSGSSSAttnNFM 430
                        170       180       190
                 ....*....|....*....|....*....|....*....
gi 699027518 416 PFGAGPRSCIGEILARQELFLIMAWLLQRFDLEVPDDGQ 454
Cdd:PLN02500 431 PFGGGPRLCAGSELAKLEMAVFIHHLVLNFNWELAEADQ 469
PLN02426 PLN02426
cytochrome P450, family 94, subfamily C protein
284-452 9.68e-10

cytochrome P450, family 94, subfamily C protein


Pssm-ID: 215235  Cd Length: 502  Bit Score: 60.47  E-value: 9.68e-10
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518 284 AGVETTTSVVkwTLAFLL--HNPQVKKKLYEEIDQNVGFSRTPTISDR-NRLLLLEATIREVLRLRPvaPMLIPHKANVD 360
Cdd:PLN02426 304 AGRDTVASAL--TSFFWLlsKHPEVASAIREEADRVMGPNQEAASFEEmKEMHYLHAALYESMRLFP--PVQFDSKFAAE 379
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518 361 SSI---GEFaVDKGTEVIINLWALHHNEKEWhQPD--QFMPERFLNpAGTQLISPSVSYLPFGAGPRSCIGEILARQELF 435
Cdd:PLN02426 380 DDVlpdGTF-VAKGTRVTYHPYAMGRMERIW-GPDclEFKPERWLK-NGVFVPENPFKYPVFQAGLRVCLGKEMALMEMK 456
                        170
                 ....*....|....*..
gi 699027518 436 LIMAWLLQRFDLEVPDD 452
Cdd:PLN02426 457 SVAVAVVRRFDIEVVGR 473
PLN03195 PLN03195
fatty acid omega-hydroxylase; Provisional
262-445 8.02e-09

fatty acid omega-hydroxylase; Provisional


Pssm-ID: 215627  Cd Length: 516  Bit Score: 57.87  E-value: 8.02e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518 262 PDQDselLSDNHILTTIGDIFGAGVETTTSVVKWTLAFLLHNPQVKKKLYEEI---------------DQN-----VGFS 321
Cdd:PLN03195 284 PDSN---FTDKSLRDIVLNFVIAGRDTTATTLSWFVYMIMMNPHVAEKLYSELkalekerakeedpedSQSfnqrvTQFA 360
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518 322 RTPTISDRNRLLLLEATIREVLRLRPVAPMLIPHKANVDSSIGEFAVDKGTEVIINLWALHHNEKEWhQPD--QFMPERF 399
Cdd:PLN03195 361 GLLTYDSLGKLQYLHAVITETLRLYPAVPQDPKGILEDDVLPDGTKVKAGGMVTYVPYSMGRMEYNW-GPDaaSFKPERW 439
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|....*.
gi 699027518 400 LNPAGTQLISPsVSYLPFGAGPRSCIGEILARQELFLIMAwLLQRF 445
Cdd:PLN03195 440 IKDGVFQNASP-FKFTAFQAGPRICLGKDSAYLQMKMALA-LLCRF 483
PLN03141 PLN03141
3-epi-6-deoxocathasterone 23-monooxygenase; Provisional
266-445 4.71e-05

3-epi-6-deoxocathasterone 23-monooxygenase; Provisional


Pssm-ID: 215600  Cd Length: 452  Bit Score: 45.50  E-value: 4.71e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518 266 SELLSDNHILTTIGDIFGAGVETTTSVVKWTLAFLLHNPQVKKKLYEEidqNVGFSRTPTI-------SDRNRLLLLEAT 338
Cdd:PLN03141 244 SDELTDDLISDNMIDMMIPGEDSVPVLMTLAVKFLSDCPVALQQLTEE---NMKLKRLKADtgeplywTDYMSLPFTQNV 320
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518 339 IREVLRLRPVApMLIPHKANVDSSIGEFAVDKGTEVIINLWALHHNEKEWHQPDQFMPERFLNPAGTqlispSVSYLPFG 418
Cdd:PLN03141 321 ITETLRMGNII-NGVMRKAMKDVEIKGYLIPKGWCVLAYFRSVHLDEENYDNPYQFNPWRWQEKDMN-----NSSFTPFG 394
                        170       180
                 ....*....|....*....|....*..
gi 699027518 419 AGPRSCIGEILARQELFLIMAWLLQRF 445
Cdd:PLN03141 395 GGQRLCPGLDLARLEASIFLHHLVTRF 421
PLN02774 PLN02774
brassinosteroid-6-oxidase
10-448 1.04e-04

brassinosteroid-6-oxidase


Pssm-ID: 178373  Cd Length: 463  Bit Score: 44.38  E-value: 1.04e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518  10 PKSLLSLPLVGSLPFLPRHGhmhNNFFKLQK-KYGPIYSVRMGTKTTVIVGHHQLAKEVLIKKGKDF-SGRPQmATLDIL 87
Cdd:PLN02774  33 PPGTMGWPLFGETTEFLKQG---PDFMKNQRlRYGSFFKSHILGCPTIVSMDPELNRYILMNEGKGLvPGYPQ-SMLDIL 108
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518  88 SNNrkGIAfadsGAHWQLHRRLAMATFALFKDG---DQKLEKIICQEISTLCDMlatHNGQSIDISfpvfvAVTNVISLI 164
Cdd:PLN02774 109 GTC--NIA----AVHGSTHRYMRGSLLSLISPTmirDHLLPKIDEFMRSHLSGW---DGLKTIDIQ-----EKTKEMALL 174
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518 165 CfntsykngdpELNVIQNYNEGIIDNLSKDSLVDLVPWLKIFP-NKTLEKLKSHVKIRNDLLnKILENYKEKFRSDSIT- 242
Cdd:PLN02774 175 S----------ALKQIAGTLSKPISEEFKTEFFKLVLGTLSLPiDLPGTNYRSGVQARKNIV-RMLRQLIQERRASGETh 243
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518 243 -NMLDTLMqakmnSDNGNagpdqdSELLSDNHILTTIGDIFGAGVETTTSVVKWTLAFLLHNPQVKKKLYEE---IDQNV 318
Cdd:PLN02774 244 tDMLGYLM-----RKEGN------RYKLTDEEIIDQIITILYSGYETVSTTSMMAVKYLHDHPKALQELRKEhlaIRERK 312
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518 319 GFSRTPTISDRNRLLLLEATIREVLRLRPVAPMLIpHKANVDSSIGEFAVDKGTEVIINLWALHHNEKEWHQPDQFMPER 398
Cdd:PLN02774 313 RPEDPIDWNDYKSMRFTRAVIFETSRLATIVNGVL-RKTTQDMELNGYVIPKGWRIYVYTREINYDPFLYPDPMTFNPWR 391
                        410       420       430       440       450
                 ....*....|....*....|....*....|....*....|....*....|
gi 699027518 399 FLNpagTQLISPSvSYLPFGAGPRSCIGEILARQELFLIMAWLLQRFDLE 448
Cdd:PLN02774 392 WLD---KSLESHN-YFFLFGGGTRLCPGKELGIVEISTFLHYFVTRYRWE 437
PLN02648 PLN02648
allene oxide synthase
303-436 6.16e-03

allene oxide synthase


Pssm-ID: 215350  Cd Length: 480  Bit Score: 38.76  E-value: 6.16e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 699027518 303 NPQVKKKLYEEIDQNVGFSRT-PTISDRNRLLLLEATIREVLRLRPVAPmLIPHKANVD----SSIGEFAVDKGtEVIIN 377
Cdd:PLN02648 303 GEELQARLAEEVRSAVKAGGGgVTFAALEKMPLVKSVVYEALRIEPPVP-FQYGRAREDfvieSHDAAFEIKKG-EMLFG 380
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 699027518 378 LWAL-HHNEKEWHQPDQFMPERFLNPAGTQLI------------SPSVsylpfgaGPRSCIG----EILARQ---ELFL 436
Cdd:PLN02648 381 YQPLvTRDPKVFDRPEEFVPDRFMGEEGEKLLkyvfwsngreteSPTV-------GNKQCAGkdfvVLVARLfvaELFL 452
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH