NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|7245646]
View 

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
GSDH super family cl26817
Glucose / Sorbosone dehydrogenase; Members of this family are glucose/sorbosone dehydrogenases ...
1-454 0e+00

Glucose / Sorbosone dehydrogenase; Members of this family are glucose/sorbosone dehydrogenases that possess a beta-propeller fold.


The actual alignment was detected with superfamily member TIGR03606:

Pssm-ID: 355575  Cd Length: 454  Bit Score: 764.85  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7245646      1 DVPLTPSQFAKAKSENFDKKVILSNLNKPHALLWGPDNQIWLTERATGKILRVNPESGSVKTVFQVPEIVNDADgQNGLL 80
Cdd:TIGR03606   4 DVPLNPSQFAKAASENFDKKVLLSGLNKPWALLWGPDNQLWVTERATGKILRVNPETGEVKVVFTLPEIVNDAQ-HNGLL 82
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7245646     81 GFAFHPDF---KNNPYIYISGTFKNpksTDKELPNQTIIRRYTYNKSTDTLEKPVDLLAGLPSSKDHQSGRLVIGPDQKI 157
Cdd:TIGR03606  83 GLALHPDFmqeKGNPYVYISYTYKN---GDKELPNHTKIVRYTYDKSTQTLEKPVDLLAGLPAGNDHNGGRLVFGPDGKI 159
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7245646    158 YYTIGDQGRNQLAYLFLPNQAQHTPTQQELNGKDYHTYMGKVLRLNLDGSIPKDNPSFNGVVSHIYTLGHRNPQGLAFTP 237
Cdd:TIGR03606 160 YYTIGEQGRNQGANFFLPNQAQHTPTQQELNGKDYHAYMGKVLRLNLDGSIPKDNPSINGVVSHIFTYGHRNPQGLAFTP 239
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7245646    238 NGKLLQSEQGPNSDDEINLIVKGGNYGWPNVAGYKDDSGYAYANYSAAANKSIKDLAQNGvkVAAGVPVTKESEWTGKNF 317
Cdd:TIGR03606 240 DGTLYASEQGPNSDDELNIIVKGGNYGWPNVAGYKDDSGYVYANYSAAANKSIKTLAQNG--IPAGVPVTKESEWTAKNF 317
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7245646    318 VPPLKTLYTVQDTYNYNDPTCGEMTYICWPTVAPSSAYVYKGGKKAITGWENTLLVPSLKRGVIFRIKLDPTYSTTYDDA 397
Cdd:TIGR03606 318 VPPLKTLYTVQDTYNYNDATCGEMTYICWPTIAPSSAYYYKGGEKGITGWENSLLIPSLKRGVIYRIKLDPDYSTVYGDA 397
                         410       420       430       440       450
                  ....*....|....*....|....*....|....*....|....*....|....*..
gi 7245646    398 VPMFKSNNRYRDVIASPDGNVLYVLTDTAGNVQKDDGSVTNTLENPGSLIKFTYKAK 454
Cdd:TIGR03606 398 VPMFKTNNRYRDVIASPDGNVLYVATDNFGNVQKDDGSVTNTLENPGSIIVFTYKGK 454
 
Name Accession Description Interval E-value
non_repeat_PQQ TIGR03606
dehydrogenase, PQQ-dependent, s-GDH family; PQQ, or pyrroloquinoline-quinone, serves as a ...
1-454 0e+00

dehydrogenase, PQQ-dependent, s-GDH family; PQQ, or pyrroloquinoline-quinone, serves as a cofactor for a number of sugar and alcohol dehydrogenases in a limited number of bacterial species. Most characterized PQQ-dependent enzymes have multiple repeats of a sequence region described by pfam01011 (PQQ enzyme repeat), but this protein family in unusual in lacking that repeat. Below the noise cutoff are related proteins mostly from species that lack PQQ biosynthesis.


Pssm-ID: 274675  Cd Length: 454  Bit Score: 764.85  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7245646      1 DVPLTPSQFAKAKSENFDKKVILSNLNKPHALLWGPDNQIWLTERATGKILRVNPESGSVKTVFQVPEIVNDADgQNGLL 80
Cdd:TIGR03606   4 DVPLNPSQFAKAASENFDKKVLLSGLNKPWALLWGPDNQLWVTERATGKILRVNPETGEVKVVFTLPEIVNDAQ-HNGLL 82
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7245646     81 GFAFHPDF---KNNPYIYISGTFKNpksTDKELPNQTIIRRYTYNKSTDTLEKPVDLLAGLPSSKDHQSGRLVIGPDQKI 157
Cdd:TIGR03606  83 GLALHPDFmqeKGNPYVYISYTYKN---GDKELPNHTKIVRYTYDKSTQTLEKPVDLLAGLPAGNDHNGGRLVFGPDGKI 159
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7245646    158 YYTIGDQGRNQLAYLFLPNQAQHTPTQQELNGKDYHTYMGKVLRLNLDGSIPKDNPSFNGVVSHIYTLGHRNPQGLAFTP 237
Cdd:TIGR03606 160 YYTIGEQGRNQGANFFLPNQAQHTPTQQELNGKDYHAYMGKVLRLNLDGSIPKDNPSINGVVSHIFTYGHRNPQGLAFTP 239
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7245646    238 NGKLLQSEQGPNSDDEINLIVKGGNYGWPNVAGYKDDSGYAYANYSAAANKSIKDLAQNGvkVAAGVPVTKESEWTGKNF 317
Cdd:TIGR03606 240 DGTLYASEQGPNSDDELNIIVKGGNYGWPNVAGYKDDSGYVYANYSAAANKSIKTLAQNG--IPAGVPVTKESEWTAKNF 317
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7245646    318 VPPLKTLYTVQDTYNYNDPTCGEMTYICWPTVAPSSAYVYKGGKKAITGWENTLLVPSLKRGVIFRIKLDPTYSTTYDDA 397
Cdd:TIGR03606 318 VPPLKTLYTVQDTYNYNDATCGEMTYICWPTIAPSSAYYYKGGEKGITGWENSLLIPSLKRGVIYRIKLDPDYSTVYGDA 397
                         410       420       430       440       450
                  ....*....|....*....|....*....|....*....|....*....|....*..
gi 7245646    398 VPMFKSNNRYRDVIASPDGNVLYVLTDTAGNVQKDDGSVTNTLENPGSLIKFTYKAK 454
Cdd:TIGR03606 398 VPMFKTNNRYRDVIASPDGNVLYVATDNFGNVQKDDGSVTNTLENPGSIIVFTYKGK 454
GSDH pfam07995
Glucose / Sorbosone dehydrogenase; Members of this family are glucose/sorbosone dehydrogenases ...
26-424 7.70e-71

Glucose / Sorbosone dehydrogenase; Members of this family are glucose/sorbosone dehydrogenases that possess a beta-propeller fold.


Pssm-ID: 336894  Cd Length: 327  Bit Score: 227.04  E-value: 7.70e-71
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7245646     26 LNKPHALLWGPDNQIWLTERAtGKILRVNPESGSVKTVFQVPEIvnDADGQNGLLGFAFHPDFKNNPYIYISGTFKNPKS 105
Cdd:pfam07995   1 LEHPWGLAFLPDGRMLVTERP-GRLRLVDADGKLSTPIAGVPEV--AARGQGGLLDVALHPDFAENRWVYLSYAEAGDDG 77
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7245646    106 TdkelpNQTIIRRYTYNKSTDTLEKPVDLLAGLP--SSKDHQSGRLVIGPDQKIYYTIGDQGRNQLAylflpnqaqhtpt 183
Cdd:pfam07995  78 G-----AGTAVARARLSDDATALEDVEVIFRQIPkvSGGGHFGSRIAFGPDGTLFVTTGDRGDRDLA------------- 139
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7245646    184 qQELNgkdyhTYMGKVLRLNLDGSIPKDNPSFN--GVVSHIYTLGHRNPQGLAFTP-NGKLLQSEQGPNSDDEINLIVKG 260
Cdd:pfam07995 140 -QDLS-----SHLGKILRLNPDGSIPADNPFVGrpGALPEIWSYGHRNPQGLAFDPdTGRLWTHEHGPRGGDEINLIEAG 213
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7245646    261 GNYGWPNVAGYKDDSgyayanysaaanksikdlaqngvkvaaGVPVTKESEWTGknFVPPLktlytvqdtynyndptcge 340
Cdd:pfam07995 214 KNYGWPVVSYGDNYS---------------------------GTPIGEGTTRPG--MEQPV------------------- 245
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7245646    341 mtyICW-PTVAPSSAYVYKGgkKAITGWENTLLVPSLKRGVIFRIKLDpTYSTTYDDAVpMFKSNNRYRDVIASPDGNvL 419
Cdd:pfam07995 246 ---YYWdPSIAPSGMAFYTG--DAFPEWKGDLFVGGLKSQHLVRLTLD-GGRVVEEERL-LGDLGERIRDVRQGPDGA-L 317

                  ....*
gi 7245646    420 YVLTD 424
Cdd:pfam07995 318 YVLTD 322
YliI COG2133
Glucose/arabinose dehydrogenase, beta-propeller fold [Carbohydrate transport and metabolism];
21-427 5.04e-43

Glucose/arabinose dehydrogenase, beta-propeller fold [Carbohydrate transport and metabolism];


Pssm-ID: 225044  Cd Length: 399  Bit Score: 156.04  E-value: 5.04e-43
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7245646   21 VILSNLNKPHALLWGPDNQIWLTERATGKILRV---NPESGSVKTVFQVpeivnDADGQNGLLGFAFHPDF--KNNPYIY 95
Cdd:COG2133  61 VVAQGLEHPWGLARLPDGVLLVTERPTGRLRLIsdgGSASPPVSTVPIV-----LLRGQGGLLDIALSPDFaqGRLVYFG 135
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7245646   96 ISgtfknpkSTDKELPNQTIIRRYTYNKSTDTLEKPVDLLAGLPSSKDHQSGRLVIGPDQKIYYTIGDQGRnqlaylflP 175
Cdd:COG2133 136 IS-------EPGGGLYVANRVAIGRLPGGDTKLSEPKVIFRGIPKGGHHFGGRLVFGPDGKLYVTTGSNGD--------P 200
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7245646  176 NQAQHtptqqelNGKdyHTymGKVLRLNLDGSIPKDNPsfnGVVSHIYTLGHRNPQGLAFTP-NGKLLQSEQGPNSD--- 251
Cdd:COG2133 201 ALAQD-------NVS--LA--GKVLRIDRAGIIPADNP---FPNSEIWSYGHRNPQGLAWHPvTGALWTTEHGPDALrgp 266
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7245646  252 DEINLIVKGGNYGWPnvagykddsgyayanysaaanksikdLAQNGVKVAagvpvtkesewtGKNFVPPLKTLYTVQDTY 331
Cdd:COG2133 267 DELNSIRPGKNYGWP--------------------------YAYFGQNYD------------GRAIPDGTVVAGAIQPVY 308
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7245646  332 NYNdptcgemtyicwPTVAPSSAYVYKGgkKAITGWENTLLVPSLKRGVIFRIKLDPTYSTTYDDAVPMfKSNNRYRDVI 411
Cdd:COG2133 309 TWA------------PHIAPSGMAFYTG--DLFPAYRGDLFVGAHGSWPVLRLRPDGNYKVVLTGFLSG-DLGGRPRDVA 373
                       410
                ....*....|....*.
gi 7245646  412 ASPDGnVLYVLTDTAG 427
Cdd:COG2133 374 VAPDG-ALLVLTDQGD 388
 
Name Accession Description Interval E-value
non_repeat_PQQ TIGR03606
dehydrogenase, PQQ-dependent, s-GDH family; PQQ, or pyrroloquinoline-quinone, serves as a ...
1-454 0e+00

dehydrogenase, PQQ-dependent, s-GDH family; PQQ, or pyrroloquinoline-quinone, serves as a cofactor for a number of sugar and alcohol dehydrogenases in a limited number of bacterial species. Most characterized PQQ-dependent enzymes have multiple repeats of a sequence region described by pfam01011 (PQQ enzyme repeat), but this protein family in unusual in lacking that repeat. Below the noise cutoff are related proteins mostly from species that lack PQQ biosynthesis.


Pssm-ID: 274675  Cd Length: 454  Bit Score: 764.85  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7245646      1 DVPLTPSQFAKAKSENFDKKVILSNLNKPHALLWGPDNQIWLTERATGKILRVNPESGSVKTVFQVPEIVNDADgQNGLL 80
Cdd:TIGR03606   4 DVPLNPSQFAKAASENFDKKVLLSGLNKPWALLWGPDNQLWVTERATGKILRVNPETGEVKVVFTLPEIVNDAQ-HNGLL 82
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7245646     81 GFAFHPDF---KNNPYIYISGTFKNpksTDKELPNQTIIRRYTYNKSTDTLEKPVDLLAGLPSSKDHQSGRLVIGPDQKI 157
Cdd:TIGR03606  83 GLALHPDFmqeKGNPYVYISYTYKN---GDKELPNHTKIVRYTYDKSTQTLEKPVDLLAGLPAGNDHNGGRLVFGPDGKI 159
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7245646    158 YYTIGDQGRNQLAYLFLPNQAQHTPTQQELNGKDYHTYMGKVLRLNLDGSIPKDNPSFNGVVSHIYTLGHRNPQGLAFTP 237
Cdd:TIGR03606 160 YYTIGEQGRNQGANFFLPNQAQHTPTQQELNGKDYHAYMGKVLRLNLDGSIPKDNPSINGVVSHIFTYGHRNPQGLAFTP 239
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7245646    238 NGKLLQSEQGPNSDDEINLIVKGGNYGWPNVAGYKDDSGYAYANYSAAANKSIKDLAQNGvkVAAGVPVTKESEWTGKNF 317
Cdd:TIGR03606 240 DGTLYASEQGPNSDDELNIIVKGGNYGWPNVAGYKDDSGYVYANYSAAANKSIKTLAQNG--IPAGVPVTKESEWTAKNF 317
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7245646    318 VPPLKTLYTVQDTYNYNDPTCGEMTYICWPTVAPSSAYVYKGGKKAITGWENTLLVPSLKRGVIFRIKLDPTYSTTYDDA 397
Cdd:TIGR03606 318 VPPLKTLYTVQDTYNYNDATCGEMTYICWPTIAPSSAYYYKGGEKGITGWENSLLIPSLKRGVIYRIKLDPDYSTVYGDA 397
                         410       420       430       440       450
                  ....*....|....*....|....*....|....*....|....*....|....*..
gi 7245646    398 VPMFKSNNRYRDVIASPDGNVLYVLTDTAGNVQKDDGSVTNTLENPGSLIKFTYKAK 454
Cdd:TIGR03606 398 VPMFKTNNRYRDVIASPDGNVLYVATDNFGNVQKDDGSVTNTLENPGSIIVFTYKGK 454
GSDH pfam07995
Glucose / Sorbosone dehydrogenase; Members of this family are glucose/sorbosone dehydrogenases ...
26-424 7.70e-71

Glucose / Sorbosone dehydrogenase; Members of this family are glucose/sorbosone dehydrogenases that possess a beta-propeller fold.


Pssm-ID: 336894  Cd Length: 327  Bit Score: 227.04  E-value: 7.70e-71
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7245646     26 LNKPHALLWGPDNQIWLTERAtGKILRVNPESGSVKTVFQVPEIvnDADGQNGLLGFAFHPDFKNNPYIYISGTFKNPKS 105
Cdd:pfam07995   1 LEHPWGLAFLPDGRMLVTERP-GRLRLVDADGKLSTPIAGVPEV--AARGQGGLLDVALHPDFAENRWVYLSYAEAGDDG 77
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7245646    106 TdkelpNQTIIRRYTYNKSTDTLEKPVDLLAGLP--SSKDHQSGRLVIGPDQKIYYTIGDQGRNQLAylflpnqaqhtpt 183
Cdd:pfam07995  78 G-----AGTAVARARLSDDATALEDVEVIFRQIPkvSGGGHFGSRIAFGPDGTLFVTTGDRGDRDLA------------- 139
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7245646    184 qQELNgkdyhTYMGKVLRLNLDGSIPKDNPSFN--GVVSHIYTLGHRNPQGLAFTP-NGKLLQSEQGPNSDDEINLIVKG 260
Cdd:pfam07995 140 -QDLS-----SHLGKILRLNPDGSIPADNPFVGrpGALPEIWSYGHRNPQGLAFDPdTGRLWTHEHGPRGGDEINLIEAG 213
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7245646    261 GNYGWPNVAGYKDDSgyayanysaaanksikdlaqngvkvaaGVPVTKESEWTGknFVPPLktlytvqdtynyndptcge 340
Cdd:pfam07995 214 KNYGWPVVSYGDNYS---------------------------GTPIGEGTTRPG--MEQPV------------------- 245
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7245646    341 mtyICW-PTVAPSSAYVYKGgkKAITGWENTLLVPSLKRGVIFRIKLDpTYSTTYDDAVpMFKSNNRYRDVIASPDGNvL 419
Cdd:pfam07995 246 ---YYWdPSIAPSGMAFYTG--DAFPEWKGDLFVGGLKSQHLVRLTLD-GGRVVEEERL-LGDLGERIRDVRQGPDGA-L 317

                  ....*
gi 7245646    420 YVLTD 424
Cdd:pfam07995 318 YVLTD 322
YliI COG2133
Glucose/arabinose dehydrogenase, beta-propeller fold [Carbohydrate transport and metabolism];
21-427 5.04e-43

Glucose/arabinose dehydrogenase, beta-propeller fold [Carbohydrate transport and metabolism];


Pssm-ID: 225044  Cd Length: 399  Bit Score: 156.04  E-value: 5.04e-43
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7245646   21 VILSNLNKPHALLWGPDNQIWLTERATGKILRV---NPESGSVKTVFQVpeivnDADGQNGLLGFAFHPDF--KNNPYIY 95
Cdd:COG2133  61 VVAQGLEHPWGLARLPDGVLLVTERPTGRLRLIsdgGSASPPVSTVPIV-----LLRGQGGLLDIALSPDFaqGRLVYFG 135
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7245646   96 ISgtfknpkSTDKELPNQTIIRRYTYNKSTDTLEKPVDLLAGLPSSKDHQSGRLVIGPDQKIYYTIGDQGRnqlaylflP 175
Cdd:COG2133 136 IS-------EPGGGLYVANRVAIGRLPGGDTKLSEPKVIFRGIPKGGHHFGGRLVFGPDGKLYVTTGSNGD--------P 200
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7245646  176 NQAQHtptqqelNGKdyHTymGKVLRLNLDGSIPKDNPsfnGVVSHIYTLGHRNPQGLAFTP-NGKLLQSEQGPNSD--- 251
Cdd:COG2133 201 ALAQD-------NVS--LA--GKVLRIDRAGIIPADNP---FPNSEIWSYGHRNPQGLAWHPvTGALWTTEHGPDALrgp 266
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7245646  252 DEINLIVKGGNYGWPnvagykddsgyayanysaaanksikdLAQNGVKVAagvpvtkesewtGKNFVPPLKTLYTVQDTY 331
Cdd:COG2133 267 DELNSIRPGKNYGWP--------------------------YAYFGQNYD------------GRAIPDGTVVAGAIQPVY 308
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7245646  332 NYNdptcgemtyicwPTVAPSSAYVYKGgkKAITGWENTLLVPSLKRGVIFRIKLDPTYSTTYDDAVPMfKSNNRYRDVI 411
Cdd:COG2133 309 TWA------------PHIAPSGMAFYTG--DLFPAYRGDLFVGAHGSWPVLRLRPDGNYKVVLTGFLSG-DLGGRPRDVA 373
                       410
                ....*....|....*.
gi 7245646  412 ASPDGnVLYVLTDTAG 427
Cdd:COG2133 374 VAPDG-ALLVLTDQGD 388
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.17
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH