NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|7245750]
View 

Protein Classification

immunoglobulin kappa light chain variable domain-containing protein (domain architecture ID 10141732)

immunoglobulin kappa light chain variable domain-containing protein similar to the kappa IV human light chain Len, a protein isolated from a multiple myeloma patient

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
IgV_L_kappa cd04980
Immunoglobulin (Ig) light chain, kappa type, variable (V) domain; IgV_L_kappa: Immunoglobulin ...
2-112 4.01e-61

Immunoglobulin (Ig) light chain, kappa type, variable (V) domain; IgV_L_kappa: Immunoglobulin (Ig) light chain, kappa type, variable (V) domain. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds.There are two types of light chains: kappa and lambda, each composed of a constant domain (CL) and a variable domain (VL). There are five types of heavy chains (alpha, gamma, delta, epsilon, and mu), which determine the type of immunoglobulin: IgA, IgG, IgD, IgE, and IgM, respectively. In higher vertebrates, there are two types of light chain, designated kappa and lambda, which seem to be functionally identical, and can associate with any of the heavy chains.


:

Pssm-ID: 143181  Cd Length: 106  Bit Score: 181.91  E-value: 4.01e-61
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7245750    2 IVMTQSPDSLAVSLGERATINCKSSQSVlyssnSKNYLAWYQQKPGQPPKLLIYWASTRESGVPDRFSGSGSGTDFTLTI 81
Cdd:cd04980   1 IVLTQSPATLSVSPGESATISCKASQSV-----SSNYLAWYQQKPGQAPKLLIYGASTLASGTPSRFSGSGSGTDFTLTI 75
                        90       100       110
                ....*....|....*....|....*....|.
gi 7245750   82 SSLQAEDVAVYYCAQYYSTPYSFGQGTKLEI 112
Cdd:cd04980  76 SRVEPEDAAVYYCQQYGTFPYTFGGGTKLEI 106
 
Name Accession Description Interval E-value
IgV_L_kappa cd04980
Immunoglobulin (Ig) light chain, kappa type, variable (V) domain; IgV_L_kappa: Immunoglobulin ...
2-112 4.01e-61

Immunoglobulin (Ig) light chain, kappa type, variable (V) domain; IgV_L_kappa: Immunoglobulin (Ig) light chain, kappa type, variable (V) domain. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds.There are two types of light chains: kappa and lambda, each composed of a constant domain (CL) and a variable domain (VL). There are five types of heavy chains (alpha, gamma, delta, epsilon, and mu), which determine the type of immunoglobulin: IgA, IgG, IgD, IgE, and IgM, respectively. In higher vertebrates, there are two types of light chain, designated kappa and lambda, which seem to be functionally identical, and can associate with any of the heavy chains.


Pssm-ID: 143181  Cd Length: 106  Bit Score: 181.91  E-value: 4.01e-61
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7245750    2 IVMTQSPDSLAVSLGERATINCKSSQSVlyssnSKNYLAWYQQKPGQPPKLLIYWASTRESGVPDRFSGSGSGTDFTLTI 81
Cdd:cd04980   1 IVLTQSPATLSVSPGESATISCKASQSV-----SSNYLAWYQQKPGQAPKLLIYGASTLASGTPSRFSGSGSGTDFTLTI 75
                        90       100       110
                ....*....|....*....|....*....|.
gi 7245750   82 SSLQAEDVAVYYCAQYYSTPYSFGQGTKLEI 112
Cdd:cd04980  76 SRVEPEDAAVYYCQQYGTFPYTFGGGTKLEI 106
IGv smart00406
Immunoglobulin V-Type;
19-96 9.38e-21

Immunoglobulin V-Type;


Pssm-ID: 214650  Cd Length: 81  Bit Score: 78.96  E-value: 9.38e-21
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7245750      19 ATINCKSSQSvlysSNSKNYLAWYQQKPGQPPKLLIYWASTR----ESGVPDRFSGSG--SGTDFTLTISSLQAEDVAVY 92
Cdd:smart00406   2 VTLSCKFSGS----TFSSYYVSWVRQPPGKGLEWLGYIGSNGssyyQESYKGRFTISKdtSKNDVSLTISNLRVEDTGTY 77

                   ....
gi 7245750      93 YCAQ 96
Cdd:smart00406  78 YCAV 81
V-set pfam07686
Immunoglobulin V-set domain; This domain is found in antibodies as well as neural protein P0 ...
6-112 2.80e-20

Immunoglobulin V-set domain; This domain is found in antibodies as well as neural protein P0 and CTL4 amongst others.


Pssm-ID: 336766  Cd Length: 109  Bit Score: 78.66  E-value: 2.80e-20
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7245750      6 QSPDSLAVSLGERATINCKSSqsvLYSSNSKNYLAWYQQKPGQPPKLLIYWASTR--ESGVPDRFSGSG--SGTDFTLTI 81
Cdd:pfam07686   1 QTPREVTVAEGGSVTLPCTYS---SSMSEGSTSVYWYRQPPGKGPEELIAYYSNKspEGKKKGRFSLRGdpSNSDFSLTI 77
                          90       100       110
                  ....*....|....*....|....*....|.
gi 7245750     82 SSLQAEDVAVYYCAQYYSTPYSFGQGTKLEI 112
Cdd:pfam07686  78 QNLTPSDSGTYFCAVGPNGEGVFGKGTRLTV 108
 
Name Accession Description Interval E-value
IgV_L_kappa cd04980
Immunoglobulin (Ig) light chain, kappa type, variable (V) domain; IgV_L_kappa: Immunoglobulin ...
2-112 4.01e-61

Immunoglobulin (Ig) light chain, kappa type, variable (V) domain; IgV_L_kappa: Immunoglobulin (Ig) light chain, kappa type, variable (V) domain. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds.There are two types of light chains: kappa and lambda, each composed of a constant domain (CL) and a variable domain (VL). There are five types of heavy chains (alpha, gamma, delta, epsilon, and mu), which determine the type of immunoglobulin: IgA, IgG, IgD, IgE, and IgM, respectively. In higher vertebrates, there are two types of light chain, designated kappa and lambda, which seem to be functionally identical, and can associate with any of the heavy chains.


Pssm-ID: 143181  Cd Length: 106  Bit Score: 181.91  E-value: 4.01e-61
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7245750    2 IVMTQSPDSLAVSLGERATINCKSSQSVlyssnSKNYLAWYQQKPGQPPKLLIYWASTRESGVPDRFSGSGSGTDFTLTI 81
Cdd:cd04980   1 IVLTQSPATLSVSPGESATISCKASQSV-----SSNYLAWYQQKPGQAPKLLIYGASTLASGTPSRFSGSGSGTDFTLTI 75
                        90       100       110
                ....*....|....*....|....*....|.
gi 7245750   82 SSLQAEDVAVYYCAQYYSTPYSFGQGTKLEI 112
Cdd:cd04980  76 SRVEPEDAAVYYCQQYGTFPYTFGGGTKLEI 106
IgV_L_lambda cd04984
Immunoglobulin (Ig) lambda light chain variable (V) domain; IgV_L_lambda: Immunoglobulin (Ig) ...
11-110 3.39e-38

Immunoglobulin (Ig) lambda light chain variable (V) domain; IgV_L_lambda: Immunoglobulin (Ig) light chain, lambda type, variable (V) domain. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. There are two types of light chains: kappa and lambda, each composed of a constant domain (CL) and a variable domain (VL). There are five types of heavy chains (alpha, gamma, delta, epsilon, and mu), which determine the type of immunoglobulin: IgA, IgG, IgD, IgE, and IgM, respectively. In higher vertebrates, there are two types of light chain, designated kappa and lambda, which seem to be functionally identical, and can associate with any of the heavy chains.


Pssm-ID: 143185  Cd Length: 98  Bit Score: 123.71  E-value: 3.39e-38
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7245750   11 LAVSLGERATINCKSSQSvlysSNSKNYLAWYQQKPGQPPKLLIYWASTRESGVPDRFSGSGSGTDFTLTISSLQAEDVA 90
Cdd:cd04984   1 LSVSPGETVTITCTGSSG----NISGNYVNWYQQKPGSAPRYLIYEDSDRPSGIPDRFSGSKSGNTASLTISGAQTEDEA 76
                        90       100
                ....*....|....*....|
gi 7245750   91 VYYCAQYYSTPYSFGQGTKL 110
Cdd:cd04984  77 DYYCQVWDSNSYVFGGGTKL 96
IgV cd00099
Immunoglobulin variable domain (IgV); IgV: Immunoglobulin variable domain (IgV). Members of ...
11-112 1.03e-30

Immunoglobulin variable domain (IgV); IgV: Immunoglobulin variable domain (IgV). Members of the IgV family are components of immunoglobulin (Ig) and T cell receptors. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. In Ig, each chain is composed of one variable domain (IgV) and one or more constant domains (IgC); these names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. Within the variable domain, there are regions of even more variability called the hypervariable or complementarity-determining regions (CDRs) which are responsible for antigen binding. A predominant feature of most Ig domains is the disulfide bridge connecting 2 beta-sheets with a tryptophan residue packed against the disulfide bond.


Pssm-ID: 319275  Cd Length: 103  Bit Score: 104.79  E-value: 1.03e-30
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7245750   11 LAVSLGERATINCKSSQSVLYSsnsknYLAWYQQKPGQPPKLLIYWASTRESGVPDRFSGSGSG--TDFTLTISSLQAED 88
Cdd:cd00099   1 VSVSTGESVTLNCVLSGSFSLY-----SISWYRQKPGKQPQFLISGSSTGKPGIPGRFSGTRNGgsSSFSLTISNLRPED 75
                        90       100
                ....*....|....*....|....*...
gi 7245750   89 VAVYYCAQYYS----TPYSFGQGTKLEI 112
Cdd:cd00099  76 SGTYYCAVSEGpgggDKLVFGAGTRLTV 103
IgV_TCR_beta cd05899
Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) bet a chain; IgV_TCR_beta: ...
5-110 8.99e-23

Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) bet a chain; IgV_TCR_beta: immunoglobulin (Ig) variable domain of the beta chain of alpha/beta T-cell antigen receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are composed of alpha and beta, or gamma and delta, polypeptide chains with variable (V) and constant (C) regions. This group includes the variable domain of the alpha chain of alpha/beta TCRs. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. The variable domain of TCRs is responsible for antigen recognition, and is located at the N-terminus of the receptor. Gamma/delta TCRs recognize intact protein antigens; they recognize proteins antigens directly and without antigen processing, and MHC independently of the bound peptide.


Pssm-ID: 143307  Cd Length: 110  Bit Score: 85.03  E-value: 8.99e-23
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7245750    5 TQSPDSLAVSLGERATINCkssqsvlYSSNSKNYLAWYQQKPGQPPKLLIYWAS----TRESGVPDRFSGSG-SGTDFTL 79
Cdd:cd05899   2 TQSPRYLIKGRGQSVTLRC-------SQTSGHDNMYWYRQDPGKGLQLLFYSNGgslnEEEGDPKDRFSASRpSLTRSSL 74
                        90       100       110
                ....*....|....*....|....*....|....
gi 7245750   80 TISSLQAEDVAVYYCA---QYYSTPYSFGQGTKL 110
Cdd:cd05899  75 TIKSAEPEDSAVYLCAsslGGGADEAYFGPGTRL 108
IGv smart00406
Immunoglobulin V-Type;
19-96 9.38e-21

Immunoglobulin V-Type;


Pssm-ID: 214650  Cd Length: 81  Bit Score: 78.96  E-value: 9.38e-21
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7245750      19 ATINCKSSQSvlysSNSKNYLAWYQQKPGQPPKLLIYWASTR----ESGVPDRFSGSG--SGTDFTLTISSLQAEDVAVY 92
Cdd:smart00406   2 VTLSCKFSGS----TFSSYYVSWVRQPPGKGLEWLGYIGSNGssyyQESYKGRFTISKdtSKNDVSLTISNLRVEDTGTY 77

                   ....
gi 7245750      93 YCAQ 96
Cdd:smart00406  78 YCAV 81
IgV_TCR_alpha cd04983
Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) alpha chain and similar ...
5-113 1.28e-20

Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) alpha chain and similar proteins; IgV_TCR_alpha: immunoglobulin (Ig) variable domain of the alpha chain of alpha/beta T-cell antigen receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are composed of alpha and beta, or gamma and delta, polypeptide chains with variable (V) and constant (C) regions. This group represents the variable domain of the alpha chain of TCRs and also includes the variable domain of delta chains of TCRs. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. The variable domain of TCRs is responsible for antigen recognition, and is located at the N-terminus of the receptor. Gamma/delta TCRs recognize intact protein antigens; they recognize proteins antigens directly and without antigen processing, and MHC independently of the bound peptide.


Pssm-ID: 319287  Cd Length: 109  Bit Score: 79.23  E-value: 1.28e-20
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7245750    5 TQSPDSLAVSLGERATINCKssqsvlYSSNSKNYLAWYQQKPGQPPKLLIYWASTRESGVPDRFSGS--GSGTDFTLTIS 82
Cdd:cd04983   2 TQSPQSLSVQEGENVTLNCN------YSTSTFPYLFWYRQYPGQGPEFLLYISSNGEEKEKGRFSATldKSRKSSSLHIT 75
                        90       100       110
                ....*....|....*....|....*....|....
gi 7245750   83 SLQAEDVAVYYCA---QYYSTPYSFGQGTKLEIK 113
Cdd:cd04983  76 AAQLSDSAVYYCAlseSSGTGKLTFGQGTRLTVH 109
V-set pfam07686
Immunoglobulin V-set domain; This domain is found in antibodies as well as neural protein P0 ...
6-112 2.80e-20

Immunoglobulin V-set domain; This domain is found in antibodies as well as neural protein P0 and CTL4 amongst others.


Pssm-ID: 336766  Cd Length: 109  Bit Score: 78.66  E-value: 2.80e-20
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7245750      6 QSPDSLAVSLGERATINCKSSqsvLYSSNSKNYLAWYQQKPGQPPKLLIYWASTR--ESGVPDRFSGSG--SGTDFTLTI 81
Cdd:pfam07686   1 QTPREVTVAEGGSVTLPCTYS---SSMSEGSTSVYWYRQPPGKGPEELIAYYSNKspEGKKKGRFSLRGdpSNSDFSLTI 77
                          90       100       110
                  ....*....|....*....|....*....|.
gi 7245750     82 SSLQAEDVAVYYCAQYYSTPYSFGQGTKLEI 112
Cdd:pfam07686  78 QNLTPSDSGTYFCAVGPNGEGVFGKGTRLTV 108
IgV_TCR_gamma cd04982
Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) gamma chain; IgV_TCR_gamma: ...
4-110 3.90e-16

Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) gamma chain; IgV_TCR_gamma: immunoglobulin (Ig) variable (V) domain of the gamma chain of gamma/delta T-cell receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are heterodimers consisting of alpha and beta chains or gamma and delta chains. Each chain contains a variable (V) and a constant (C) region. The majority of T cells contain alpha/beta TCRs but a small subset contain gamma/delta TCRs. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. Gamma/delta TCRs recognize intact protein antigens; they recognize protein antigens directly and without antigen processing, and MHC independently of the bound peptide. Gamma/delta T cells can also be stimulated by non-peptide antigens such as small phosphate- or amine-containing compounds. The variable domain of gamma/delta TCRs is responsible for antigen recognition and is located at the N-terminus of the receptor.


Pssm-ID: 143183  Cd Length: 116  Bit Score: 68.16  E-value: 3.90e-16
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7245750    4 MTQSPDSLAVSLGERATINCKssqsVLYSSNSKNYLAWYQQKPGQPPKLLIYWAST-----RESGVPDRFSGS--GSGTD 76
Cdd:cd04982   1 LEQPQLSITREESKSVTISCK----VSGIDFSTTYIHWYRQKPGQALERLLYVSSTstqrkLSGGTKNKFEARkdVGKST 76
                        90       100       110
                ....*....|....*....|....*....|....*...
gi 7245750   77 FTLTISSLQAEDVAVYYCAQY-YSTPYS---FGQGTKL 110
Cdd:cd04982  77 STLTIQNLEKEDSATYYCAYWeSGSSYYikvFGSGTKL 114
IG smart00409
Immunoglobulin;
8-112 2.26e-15

Immunoglobulin;


Pssm-ID: 214652  Cd Length: 85  Bit Score: 65.22  E-value: 2.26e-15
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7245750       8 PDSLAVSLGERATINCKssqsvlYSSNSKNYLAWYQQKPgqppKLLIYwastresgvPDRFSGSGSGTDFTLTISSLQAE 87
Cdd:smart00409   1 PPSVTVKEGESVTLSCE------ASGSPPPEVTWYKQGG----KLLAE---------SGRFSVSRSGSTSTLTISNVTPE 61
                           90       100
                   ....*....|....*....|....*
gi 7245750      88 DVAVYYCAQYYSTPYSFGqGTKLEI 112
Cdd:smart00409  62 DSGTYTCAATNSSGSASS-GTTLTV 85
IG_like smart00410
Immunoglobulin like; IG domains that cannot be classified into one of IGv1, IGc1, IGc2, IG.
8-112 2.26e-15

Immunoglobulin like; IG domains that cannot be classified into one of IGv1, IGc1, IGc2, IG.


Pssm-ID: 214653  Cd Length: 85  Bit Score: 65.22  E-value: 2.26e-15
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7245750       8 PDSLAVSLGERATINCKssqsvlYSSNSKNYLAWYQQKPgqppKLLIYwastresgvPDRFSGSGSGTDFTLTISSLQAE 87
Cdd:smart00410   1 PPSVTVKEGESVTLSCE------ASGSPPPEVTWYKQGG----KLLAE---------SGRFSVSRSGSTSTLTISNVTPE 61
                           90       100
                   ....*....|....*....|....*
gi 7245750      88 DVAVYYCAQYYSTPYSFGqGTKLEI 112
Cdd:smart00410  62 DSGTYTCAATNSSGSASS-GTTLTV 85
IgV_TCR_delta cd07706
Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) delta chain; IgV_TCR_delta: ...
5-112 6.77e-13

Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) delta chain; IgV_TCR_delta: immunoglobulin (Ig) variable (V) domain of the delta chain of gamma/delta T-cell receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are heterodimers consisting of alpha and beta chains or gamma and delta chains. Each chain contains a variable (V) and a constant (C) region. The majority of T cells contain alpha/beta TCRs but a small subset contain gamma/delta TCRs. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. Gamma/delta TCRs recognize intact protein antigens; they recognize protein antigens directly and without antigen processing, and MHC independently of the bound peptide. Gamma/delta T cells can also be stimulated by non-peptide antigens such as small phosphate- or amine-containing compounds. The variable domain of gamma/delta TCRs is responsible for antigen recognition and is located at the N-terminus of the receptor.


Pssm-ID: 319330  Cd Length: 112  Bit Score: 59.82  E-value: 6.77e-13
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7245750    5 TQSPDSLAVSLGERATINCkssqsVLYSSNSKNYLAWYQQKPGQPPKLLIYWASTRESGVPDRFSGSGSGTD--FTLTIS 82
Cdd:cd07706   3 TQAQPDVSVQVGEEVTLNC-----RYETSWTNYYLFWYKQLPSGEMTFLIRQDSSRSNATSGRYSVNFQKAQksISLTIS 77
                        90       100       110
                ....*....|....*....|....*....|...
gi 7245750   83 SLQAEDVAVYYCA---QYYSTPYSFGQGTKLEI 112
Cdd:cd07706  78 ALQLEDSAKYFCAlslPYPTDKLIFGKGTRLTV 110
IgV_H cd04981
Immunoglobulin (Ig) heavy chain (H), variable (V) domain; IgV_H: Immunoglobulin (Ig) heavy ...
13-110 4.59e-07

Immunoglobulin (Ig) heavy chain (H), variable (V) domain; IgV_H: Immunoglobulin (Ig) heavy chain (H), variable (V) domain. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. In Ig, each chain is composed of one variable domain (IgV) and one or more constant domains (IgC); these names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. There are five types of heavy chains (alpha, gamma, delta, epsilon, and mu), which determine the type of immunoglobulin: IgA, IgG, IgD, IgE, and IgM, respectively. In higher vertebrates, there are two types of light chain, designated kappa and lambda, which can associate with any of the heavy chains. This family includes alpha, gamma, delta, epsilon, and mu heavy chains.


Pssm-ID: 319286  Cd Length: 117  Bit Score: 44.64  E-value: 4.59e-07
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7245750   13 VSLGERATINCKSSqsvlYSSNSKNYLAWYQQKPGQPPKLL-IYWASTRESGVPDRFSG------SGSGTDFTLTISSLQ 85
Cdd:cd04981   9 VKPGQSLSLSCKAS----GFTFTSYGVGWVRQAPGKGLEWIgGIYPGGGETYYADSVKGrftitrDTSKSTVYLQLNSLT 84
                        90       100       110
                ....*....|....*....|....*....|
gi 7245750   86 AEDVAVYYCAQYYSTPYSF-----GQGTKL 110
Cdd:cd04981  85 PEDTAVYYCARGLGGYGYGyfdywGQGTLV 114
Ig_CD8_alpha cd05720
Immunoglobulin (Ig) like domain of CD8 alpha chain; Ig_CD8_alpha: immunoglobulin (Ig)-like ...
15-94 1.31e-06

Immunoglobulin (Ig) like domain of CD8 alpha chain; Ig_CD8_alpha: immunoglobulin (Ig)-like domain in CD8 alpha. The CD8 glycoprotein plays an essential role in the control of T-cell selection, maturation and the T-cell receptor (TCR)-mediated response to peptide antigen. CD8 is comprised of alpha and beta subunits and is expressed as either an alpha,alpha or alpha,beta dimer. Both dimeric isoforms can serve as a coreceptor for T cell activation and differentiation, however they have distinct physiological roles, different cellular distributions, unique binding partners etc. Each CD8 subunit is comprised of an extracellular domain containing a v-type Ig-like domain, a single pass transmembrane portion and a short intracellular domain. The Ig domain of CD8 alpha binds to antibodies.


Pssm-ID: 143197  Cd Length: 104  Bit Score: 43.25  E-value: 1.31e-06
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7245750   15 LGERATINCKssqsVLYSSNSKnyLAWYQQKPGQPPKL--LIYWAST------RESGVPDRFSGSGSGTDFTLTISSLQA 86
Cdd:cd05720   5 LGQKVELKCE----VLNSSPTG--CSWLFQPPGSAPQPtfLVYLSGSskitwdEEELSSKRFSGSRSSNSFVLTLKNFQK 78

                ....*...
gi 7245750   87 EDVAVYYC 94
Cdd:cd05720  79 ENEGYYFC 86
IgV_SIRP cd16097
Immunoglobulin (Ig)-like domain of Signal-Regulatory Protein (SIRP); IgV: immunoglobulin (Ig) ...
4-113 1.04e-05

Immunoglobulin (Ig)-like domain of Signal-Regulatory Protein (SIRP); IgV: immunoglobulin (Ig)-like domain in Signal-Regulatory Protein (SIRP). The SIRPs belong to the "paired receptors" class of membrane proteins that comprise several genes coding for proteins with similar extracellular regions but very different transmembrane/cytoplasmic regions with different (activating or inhibitory) signaling potentials. They are commonly on NK cells, but are also on many myeloid cells. Their extracellular region contains three Immunoglobulin superfamily domains a single V-set and two C1-set IgSF domains. Their cytoplasmic tails that contain either ITIMs or transmembrane regions that have positively charged residues that allow an association with adaptor proteins, such as DAP12/KARAP, containing ITAMs. There are 3 distinct SIRP members: alpha, beta, and gamma. SIRP alpha (also known as CD172a or SRC homology 2 domain-containing protein tyrosine phosphatase substrate 1/Shps-1) is a membrane receptor that interacts with a ligand CD47 expressed on many cells and gives an inhibitory signal through immunoreceptor tyrosine-based inhibition motifs in the cytoplasmic region that interact with phosphatases SHP-1 and SHP-2. SIRP beta has a short cytoplasmic region and associates with a transmembrane adapter protein DAP12 containing immunoreceptor tyrosine-based activation motifs to give an activating signal. SIRP gamma contains a very short cytoplasmic region lacking obvious signaling motifs but also binds CD47, but with much less affinity.


Pssm-ID: 319346  Cd Length: 111  Bit Score: 41.00  E-value: 1.04e-05
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7245750    4 MTQSPDSLAVSLGERATINCkssqsVLYSSNSKNYLAWYqqKPGQPPKLLIYwaSTRESGVPdRFSGSGSGT-----DFT 78
Cdd:cd16097   2 VIQPEKSVSVAAGESATLHC-----TVTSLIPVGPIQWF--RGAGPGRELIY--NQKEGHFP-RVTTVSDLTkrnnmDFS 71
                        90       100       110       120
                ....*....|....*....|....*....|....*....|
gi 7245750   79 LTISSLQAEDVAVYYCAQY-----YSTPYSFGQGTKLEIK 113
Cdd:cd16097  72 IRISNITPADAGTYYCVKFrkgspDDVEFKSGAGTELSVR 111
Ig_3 pfam13927
Immunoglobulin domain; This family contains immunoglobulin-like domains.
3-94 1.33e-05

Immunoglobulin domain; This family contains immunoglobulin-like domains.


Pssm-ID: 339005  Cd Length: 79  Bit Score: 40.21  E-value: 1.33e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7245750      3 VMTQSPDSLAVSLGERATINCKSSqsvlysSNSKNYLAWYqqKPGQPPklliywastreSGVPDRFSGSGSGTDFTLTIS 82
Cdd:pfam13927   3 VITVSPSSVVVVEGESVTLTCEAT------GGPPPTITWY--KNGEEI-----------SSGSTSARISVSGSNSTLTIS 63
                          90
                  ....*....|..
gi 7245750     83 SLQAEDVAVYYC 94
Cdd:pfam13927  64 NVTREDSGTYTC 75
IgV_CD8_beta cd07700
Immunoglobulin (Ig) like domain of CD8 beta chain; IgV_CD8_beta: immunoglobulin (Ig)-like ...
31-110 6.64e-05

Immunoglobulin (Ig) like domain of CD8 beta chain; IgV_CD8_beta: immunoglobulin (Ig)-like domain in CD8 beta. The CD8 glycoprotein plays an essential role in the control of T-cell selection, maturation and the T-cell receptor (TCR)-mediated response to peptide antigen. CD8 is comprised of alpha and beta subunits and is expressed as either an alpha/alpha or alpha/beta dimer. Both dimeric isoforms can serve as a coreceptor for T cell activation and differentiation, however they have distinct physiological roles, different cellular distributions, unique binding partners etc. Each CD8 subunit is comprised of an extracellular domain containing a V-type Ig-like domain, a single pass transmembrane portion and a short intracellular domain.


Pssm-ID: 319326  Cd Length: 108  Bit Score: 38.96  E-value: 6.64e-05
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7245750   31 YSSNSKNYlaWYQQKPGQPP----KLLIYWASTR-----ESGVPDRFS--GSGSGTDFTLTISSLQAEDVAVYYCAQYYS 99
Cdd:cd07700  18 SPKNTRIY--WLRQRQAPSKdshfEFLASWSPSKgivygEGVDQEKNIilSSSDSSRYILSLMSVKPEDSGTYFCMTVGS 95
                        90
                ....*....|.
gi 7245750  100 TPYSFGQGTKL 110
Cdd:cd07700  96 PELIFGTGTKL 106
IgV_CD79b_beta cd16096
Immunoglobulin variable domain (IgV); IgV: Immunoglobulin variable domain (IgV) in CD79B ...
33-96 8.48e-05

Immunoglobulin variable domain (IgV); IgV: Immunoglobulin variable domain (IgV) in CD79B (Cluster of Differentiation 79B). Members of the IgV family are components of immunoglobulin (Ig) and T cell receptors. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. In Ig, each chain is composed of one variable domain (IgV) and one or more constant domains (IgC); these names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. Within the variable domain, there are regions of even more variability called the hypervariable or complementarity-determining regions (CDRs) which are responsible for antigen binding. A predominant feature of most Ig domains is the disulfide bridge connecting 2 beta-sheets with a tryptophan residue packed against the disulfide bond.


Pssm-ID: 319345  Cd Length: 91  Bit Score: 38.39  E-value: 8.48e-05
                        10        20        30        40        50        60
                ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 7245750   33 SNSKNYLAWYQQKPGQPPKLLIywastRESGvpdRFSGSGSGTDFTLTISSLQAEDVAVYYCAQ 96
Cdd:cd16096  17 TNYSGVMTWFRKKGNQRPQELF-----PEDG---RISQTQNGSVYTLTIQNIQYEDNGIYFCQQ 72
IgV_PD1 cd16088
Immunoglobulin (Ig)-like domain of Programmed cell Death 1 (PD1); Programmed cell Death 1 (PD1, ...
5-101 1.17e-03

Immunoglobulin (Ig)-like domain of Programmed cell Death 1 (PD1); Programmed cell Death 1 (PD1, also known as CD279 or cluster of differentiation 279) is a cell surface receptor that is expressed on T cells and pro-B cells. The protein's structure includes an extracellular IgV domain followed by a transmembrane region and an intracellular tail. Activation of CD4+ T cells, CD8+ T cells, NKT cells, B cells, and monocytes induces PD-1 expression, immediately after which it binds two distinct ligands, PD-L1 (also known as B7-H1 or CD274) and PD-L2, also known as B7-DC. PD-1 plays an important role in down regulating the immune system by preventing the activation of T-cells, reducing autoimmunity and promoting self-tolerance. The inhibitory effect of PD-1 is accomplished by promoting apoptosis in antigen specific T-cells in lymph nodes while simultaneously reducing apoptosis in regulatory T cells. A class of drugs that target PD-1, known as the PD-1 inhibitors, activate the immune system to attack tumors and treat cancer. Comparisons between the mouse PD-1 (mPD-1) and human PD-1 (hPD-1) reveals that unlike the mPD-1 which has a conventional IgSF V-set domain, hPD-1 lacks a C" strand, and instead the C' and D strands are connected by a long and flexible loop. In addition, the BC loop is not stabilized by disulfide bonding to the F strand of the ligand binding beta sheet. These differences result in different binding affinities of human and mouse PD-1 for their ligands.


Pssm-ID: 319337  Cd Length: 110  Bit Score: 35.65  E-value: 1.17e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7245750    5 TQSPDSLAVSLGERATINCKssqsvlYSSNSKNY-LAWYQQKPG-QPPKLLIYWASTRESGVPDRFSGSG--SGTDFTLT 80
Cdd:cd16088   2 TFSPAWLSVTEGANATFTCS------LSNWSEDLmLNWYRLSPSnQTEKLAAFPEDQSQPGQDWRFRVTQlpNGHDFHMN 75
                        90       100
                ....*....|....*....|.
gi 7245750   81 ISSLQAEDVAVYYCAQYYSTP 101
Cdd:cd16088  76 LLDARRNDSGTYLCGAISLHP 96
I-set pfam07679
Immunoglobulin I-set domain;
3-94 3.07e-03

Immunoglobulin I-set domain;


Pssm-ID: 336764  Cd Length: 90  Bit Score: 34.15  E-value: 3.07e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7245750      3 VMTQSPDSLAVSLGERATINCKSSqsvlysSNSKNYLAWYqqKPGQPpklliywasTRESgvpDRFSGSGSGTDFTLTIS 82
Cdd:pfam07679   2 KFTQKPKDVEVSEGESARFTCTVT------GDPDPEVSWF--KDGSP---------LRSS---SRFRVTYEGGTYTLTIS 61
                          90
                  ....*....|..
gi 7245750     83 SLQAEDVAVYYC 94
Cdd:pfam07679  62 NVQIDDSGKYTC 73
Ig_pIgR_like cd05716
Immunoglobulin (Ig)-like domain in the polymeric Ig receptor (pIgR) and similar domains; ...
15-95 4.43e-03

Immunoglobulin (Ig)-like domain in the polymeric Ig receptor (pIgR) and similar domains; Ig_pIgR: Immunoglobulin (Ig)-like domain in the polymeric Ig receptor (pIgR) and similar domains. pIgR delivers dimeric IgA and pentameric IgM to mucosal secretions. Polymeric immunoglobulin (pIgs) are the first defense against pathogens and toxins. IgA and IgM can form polymers via an 18-residue extension at their c-termini referred to as the tailpiece. pIgR transports pIgs across mucosal epithelia into mucosal secretions. Human pIgR is a glycosylated type I transmembrane protein, comprised of a 620 residue extracellular region, a 23 residue transmembrane region, and a 103 residue cytoplasmic tail. The extracellular region contains five domains that share sequence similarity with Ig variable (v) regions. This group also contains the Ig-like extracellular domains of other receptors such as NK Cell Receptor Nkp44 and myeloid receptors, among others.


Pssm-ID: 143193  Cd Length: 98  Bit Score: 33.57  E-value: 4.43e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7245750   15 LGERATINCkssqsvLYSSNSKNYLA-WYQQKPGQPPKLLIYWASTRESGvPDRFS---GSGSGTdFTLTISSLQAEDVA 90
Cdd:cd05716   6 LGGSVTIPC------PYPPKNRSYEKyWCKWGSAGCCLIIVSEGSVQSQY-EGRVSltdDPDNGV-FTVTLNQLRKEDAG 77

                ....*
gi 7245750   91 VYYCA 95
Cdd:cd05716  78 WYWCG 82
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.17
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH