NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|74211194|dbj|BAE37673|]
View 

unnamed protein product, partial [Mus musculus]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

 Name Accession Description Interval E-value
GAT_STAM1 cd21389
non-canonical GAT domain found in signal transducing adapter molecule 1 (STAM-1) and similar ...
 6-82 9.21e-50

non-canonical GAT domain found in signal transducing adapter molecule 1 (STAM-1) and similar proteins; STAM-1 is involved in intracellular signal transduction mediated by cytokines and growth factors. It may also play a role in T-cell development. STAM-1 is a component of the ESCRT-0 complex that binds ubiquitin and acts as sorting machinery that recognizes ubiquitinated receptors and transfers them for further sequential lysosomal sorting/trafficking processes. Members of this subfamily contain a non-canonical GAT (GGA and Tom1) domain consisting of two helices. A canonical GAT domain is a monomeric three-helix bundle that bind to ubiquitin. STAM-1, together with another GAT domain-containing protein Hrs, forms a Hrs/STAM1 core complex that consists of two intertwined GAT domains, each consisting of two helices from one subunit, and one from the other subunit. The two GAT domains are connected by a two-stranded coiled-coil. The Hrs/STAM1 complex, an intertwined GAT heterodimer, is a scaffold for binding of ubiquitinated cargo proteins and coordinating ubiquitination and deubiquitination reactions that regulate sorting.


:

Pssm-ID: 410594  Cd Length: 77  Bit Score: 157.85  E-value: 9.21e-50
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 74211194   6 FIDEDKMDQLLQMLQSTDPSDNQPDLPELLHLEAMCHQMGPLIDEKLEDIDRKHSELSELNVKVMEALSLYTKLMNE 82
Cdd:cd21389   1 YIDEDKMDQLLQMLQSADPTDDQPDLPELLHLEAMCHQMGPLIDEKLEDIDRKHSELSELNVKVMEALSLYAKLMNE 77
 
Name Accession Description Interval E-value
GAT_STAM1 cd21389
non-canonical GAT domain found in signal transducing adapter molecule 1 (STAM-1) and similar ...
 6-82 9.21e-50

non-canonical GAT domain found in signal transducing adapter molecule 1 (STAM-1) and similar proteins; STAM-1 is involved in intracellular signal transduction mediated by cytokines and growth factors. It may also play a role in T-cell development. STAM-1 is a component of the ESCRT-0 complex that binds ubiquitin and acts as sorting machinery that recognizes ubiquitinated receptors and transfers them for further sequential lysosomal sorting/trafficking processes. Members of this subfamily contain a non-canonical GAT (GGA and Tom1) domain consisting of two helices. A canonical GAT domain is a monomeric three-helix bundle that bind to ubiquitin. STAM-1, together with another GAT domain-containing protein Hrs, forms a Hrs/STAM1 core complex that consists of two intertwined GAT domains, each consisting of two helices from one subunit, and one from the other subunit. The two GAT domains are connected by a two-stranded coiled-coil. The Hrs/STAM1 complex, an intertwined GAT heterodimer, is a scaffold for binding of ubiquitinated cargo proteins and coordinating ubiquitination and deubiquitination reactions that regulate sorting.


Pssm-ID: 410594  Cd Length: 77  Bit Score: 157.85  E-value: 9.21e-50
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 74211194   6 FIDEDKMDQLLQMLQSTDPSDNQPDLPELLHLEAMCHQMGPLIDEKLEDIDRKHSELSELNVKVMEALSLYTKLMNE 82
Cdd:cd21389   1 YIDEDKMDQLLQMLQSADPTDDQPDLPELLHLEAMCHQMGPLIDEKLEDIDRKHSELSELNVKVMEALSLYAKLMNE 77
 
Name Accession Description Interval E-value
GAT_STAM1 cd21389
non-canonical GAT domain found in signal transducing adapter molecule 1 (STAM-1) and similar ...
 6-82 9.21e-50

non-canonical GAT domain found in signal transducing adapter molecule 1 (STAM-1) and similar proteins; STAM-1 is involved in intracellular signal transduction mediated by cytokines and growth factors. It may also play a role in T-cell development. STAM-1 is a component of the ESCRT-0 complex that binds ubiquitin and acts as sorting machinery that recognizes ubiquitinated receptors and transfers them for further sequential lysosomal sorting/trafficking processes. Members of this subfamily contain a non-canonical GAT (GGA and Tom1) domain consisting of two helices. A canonical GAT domain is a monomeric three-helix bundle that bind to ubiquitin. STAM-1, together with another GAT domain-containing protein Hrs, forms a Hrs/STAM1 core complex that consists of two intertwined GAT domains, each consisting of two helices from one subunit, and one from the other subunit. The two GAT domains are connected by a two-stranded coiled-coil. The Hrs/STAM1 complex, an intertwined GAT heterodimer, is a scaffold for binding of ubiquitinated cargo proteins and coordinating ubiquitination and deubiquitination reactions that regulate sorting.


Pssm-ID: 410594  Cd Length: 77  Bit Score: 157.85  E-value: 9.21e-50
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 74211194   6 FIDEDKMDQLLQMLQSTDPSDNQPDLPELLHLEAMCHQMGPLIDEKLEDIDRKHSELSELNVKVMEALSLYTKLMNE 82
Cdd:cd21389   1 YIDEDKMDQLLQMLQSADPTDDQPDLPELLHLEAMCHQMGPLIDEKLEDIDRKHSELSELNVKVMEALSLYAKLMNE 77
GAT_STAM2 cd21390
non-canonical GAT domain found in signal transducing adapter molecule 2 (STAM-2) and similar ...
 1-91 4.28e-46

non-canonical GAT domain found in signal transducing adapter molecule 2 (STAM-2) and similar proteins; STAM-2 is a Hrs-binding protein involved in intracellular signal transduction mediated by cytokines and growth factors. STAM-2 is a component of the ESCRT-0 complex that binds ubiquitin and acts as sorting machinery that recognizes ubiquitinated receptors and transfers them for further sequential lysosomal sorting/trafficking processes. Members of this family contain a non-canonical GAT (GGA and Tom1) domain consisting of two helices. A canonical GAT domain is a monomeric three-helix bundle that bind to ubiquitin. STAM-2, together with another GAT domain-containing protein Hrs, forms a Hrs/STAM2 core complex that consists of two intertwined GAT domains, each consisting of two helices from one subunit, and one from the other subunit. The two GAT domains are connected by a two-stranded coiled-coil. The Hrs/STAM2 complex, an intertwined GAT heterodimer, is a scaffold for binding of ubiquitinated cargo proteins and coordinating ubiquitination and deubiquitination reactions that regulate sorting.


Pssm-ID: 410595  Cd Length: 91  Bit Score: 148.89  E-value: 4.28e-46
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74211194   1 EPEPAFIDEDKMDQLLQMLQSTDPSDNQPDLPELLHLEAMCHQMGPLIDEKLEDIDRKHSELSELNVKVMEALSLYTKLM 80
Cdd:cd21390   1 EPEPVYIDEEKMDKTLQLLQSIDPTDSKPDSPELLDLEDICQQMGPMIDEKLEEIDRKHSELSELNVKVLEALELYNKLM 80

                        90
                ....*....|.
gi 74211194  81 NEDPMYSMYAK 91
Cdd:cd21390  81 NEAPMYSVYSK 91
GAT_STAM cd21388
non-canonical GAT domain found in metazoan signal transducing adapter molecules (STAMs) and ...
 6-82 9.24e-38

non-canonical GAT domain found in metazoan signal transducing adapter molecules (STAMs) and similar proteins; STAMs are Hrs-binding proteins involved in intracellular signal transduction mediated by cytokines and growth factors. They are components of the ESCRT-0 complex that binds ubiquitin and acts as sorting machinery that recognizes ubiquitinated receptors and transfers them for further sequential lysosomal sorting/trafficking processes. Members of this family contain a non-canonical GAT (GGA and Tom1) domain consisting of two helices. A canonical GAT domain is a monomeric three-helix bundle that bind to ubiquitin. STAM, together with another GAT domain-containing protein Hrs, forms a Hrs/STAM core complex that consists of two intertwined GAT domains, each consisting of two helices from one subunit, and one from the other subunit. The two GAT domains are connected by a two-stranded coiled-coil. The Hrs/STAM complex, an intertwined GAT heterodimer, is a scaffold for binding of ubiquitinated cargo proteins and coordinating ubiquitination and deubiquitination reactions that regulate sorting.


Pssm-ID: 410593  Cd Length: 77  Bit Score: 127.04  E-value: 9.24e-38
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 74211194   6 FIDEDKMDQLLQMLQSTDPSDNQPDLPELLHLEAMCHQMGPLIDEKLEDIDRKHSELSELNVKVMEALSLYTKLMNE 82
Cdd:cd21388   1 EIDEEKIDRCLQMLQNADPTGERPDPPELLQLEAECKQMGPLIDAELERIDRKHAELTELNVKLMDALALYHDLMQE 77
GAT_STAM_Vps27-like cd21384
non-canonical GAT domain found in metazoan signal transducing adapter molecules (STAMs), ...
 6-82 3.06e-27

non-canonical GAT domain found in metazoan signal transducing adapter molecules (STAMs), fungal vacuolar protein sorting-associated protein 27 (Vps27), and similar proteins; This family includes several components of the ESCRT-0 complex, including STAMs, hepatocyte growth factor-regulated tyrosine kinase substrate (Hrs), as well as vacuolar protein sorting-associated protein 27 (Vps27) and class E vacuolar protein-sorting machinery protein Hse1 from fungi. The ESCRT-0 complex binds ubiquitin and acts as a sorting machinery that recognizes ubiquitinated receptors and transfers them for further sequential lysosomal sorting/trafficking processes. Members in this family contain a non-canonical GAT (GGA and Tom1) domain consisting of two helices. By contrast, a canonical GAT domain is a monomeric three-helix bundle that bind to ubiquitin. Hrs together with STAM forms a Hrs/STAM core complex. Vps27, together with Hse1, forms a Vps27/Hse1 core complex. Those complexes consist of two intertwined non-canonical GAT domains, each consisting of two helices from one subunit, and one from the other subunit. The intertwined GAT heterodimer acts as a scaffold for binding of ubiquitinated cargo proteins and coordinating ubiquitination and deubiquitination reactions that regulate sorting.


Pssm-ID: 410589  Cd Length: 79  Bit Score: 100.31  E-value: 3.06e-27
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 74211194   6 FIDEDKMDQLLQMLQSTDPSDN--QPDLPELLHLEAMCHQMGPLIDEKLEDIDRKHSELSELNVKVMEALSLYTKLMNE 82
Cdd:cd21384   1 FSQKDTIDQLHNSLNSASKRGNseILQDPHLLDLYQSVTPMRPQLTE*LNDYAKKKEDLLELNQKLAEAERSYNQL*DR 79
GAT_Hse1 cd21386
non-canonical GAT domain found in fungal class E vacuolar protein-sorting machinery protein ...
 6-82 9.27e-03

non-canonical GAT domain found in fungal class E vacuolar protein-sorting machinery protein Hse1 and similar proteins; Hse1 is a component of the ESCRT-0 complex which is the sorting receptor for ubiquitinated cargo proteins at the multivesicular body (MVB), and recruits ESCRT-I to the MVB outer membrane. Members of this family contain a non-canonical GAT (GGA and Tom1) domain consisting of two helices. A canonical GAT domain is a monomeric three-helix bundle that bind to ubiquitin. Hse1, together with another GAT domain-containing protein Vps27, forms a Vps27/Hse1 core complex that consists of two intertwined non-canonical GAT domains, each consisting of two helices from one subunit, and one from the other subunit. The two GAT domains are connected by a two-stranded coiled-coil. The Vps27/Hse1 complex, an intertwined GAT heterodimer, is a scaffold for binding of ubiquitinated cargo proteins and coordinating ubiquitination and deubiquitination reactions that regulate sorting.


Pssm-ID: 410591  Cd Length: 84  Bit Score: 34.58  E-value: 9.27e-03
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 74211194   6 FIDEDKMDQLLQMLQSTDPS-DNQPDLPELLHLEAMCHQMGPLIDEKLEDIDRKHSELSELNVKVMEALSLYTKLMNE 82
Cdd:cd21386   5 FSQAKNIDKLLAKLSSADPArDELIDDDEIQELYGSVLPLRPQLVKLIDKYAQKKEDLKSLNEVLANARKDYNELLEK 82
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.21
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Wang J et al. (2023), "The conserved domain database in 2023", Nucleic Acids Res.51(D)384-8.
  • Lu S et al. (2020), "The conserved domain database in 2020", Nucleic Acids Res.48(D)265-8.
  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH