NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|742255993|gb|AJB28465|]
View 

Protein Classification

7tmD_STE3 domain-containing protein (domain architecture ID 11606510)

7tmD_STE3 domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
7tmD_STE3 cd14966
fungal a-factor pheromone receptor STE3, member of the class D family of seven-transmembrane G ...
1-187 2.28e-91

fungal a-factor pheromone receptor STE3, member of the class D family of seven-transmembrane G protein-coupled receptors; This subfamily represents the a-factor pheromone receptor encoded by the STE3 gene, which is required for pheromone sensing and mating in haploid cells of the yeast Saccharomyces cerevisiae. The STE3-encoded seven-transmembrane domain receptor is a member of the class D GPCRs. Class D receptors are composed of two major subfamilies: Ste2 and Ste3. These two GPCRs (Ste2 and Ste3) sense the polypeptide mating pheromones, alpha-factor and a-factor, which activate a G protein-coupled receptors on the surface of the opposite yeast-mating haploid-types (MATa and MAT-alpha), respectively. Activation of these receptors by pheromones leads to activation of the mitogen-activated protein kinase (MAPK) signal transduction cascades, G1 cell cycle arrest, and polarized cell growth in the direction of the partner cell (a process called shmooing), which ultimately induces cell-cell fusion and the formation of a diploid zygote. Like all GPCRs, these pheromone mating factor receptors possess the same basic architecture of seven-transmembrane (7TM) domains and share common signaling mechanisms; however, there is no significant sequence similarity either between Ste2 and Ste3, or between these two receptors and the other 7TM GPCRs. Thus, STE2 and STE3 represent phylogenetically distinct groups.


:

Pssm-ID: 320097  Cd Length: 259  Bit Score: 267.06  E-value: 2.28e-91
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 742255993   1 WHLQAWNSGTCLFMIWTAIGCLNYFINSIIWHGNAIDWAP--IWCDISTRLTVGLAVAIPAAALCIHRRLYKIATVQTVS 78
Cdd:cd14966   20 WHLRARNVGACLLIFWLFLLNLINFVNAIIWPGDDINRAPdkVWCDISTKLIIGASVGIPAASLCINRRLYRIASTRRVT 99
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 742255993  79 ISRAEKRKAVIVDLSIGLGIPCLQMILQVIVLGHRYDIWEDVGCLPMTSNTPPAYPLTLLWPLAIALASAVYCILTLRAF 158
Cdd:cd14966  100 LTRADKRRRIIIDLLICLGLPILVMALHYIVQGHRYDIFEDVGCYPAIYNSWPALVLVYIWPLIISLIAAVYAVLTLRRF 179
                        170       180       190
                 ....*....|....*....|....*....|
gi 742255993 159 IKRRSQFRELL-SSNSSLTMNRYLRLMMLA 187
Cdd:cd14966  180 FRRRKQFRDLLsSSNSGLTTSRFLRLMALA 209
 
Name Accession Description Interval E-value
7tmD_STE3 cd14966
fungal a-factor pheromone receptor STE3, member of the class D family of seven-transmembrane G ...
1-187 2.28e-91

fungal a-factor pheromone receptor STE3, member of the class D family of seven-transmembrane G protein-coupled receptors; This subfamily represents the a-factor pheromone receptor encoded by the STE3 gene, which is required for pheromone sensing and mating in haploid cells of the yeast Saccharomyces cerevisiae. The STE3-encoded seven-transmembrane domain receptor is a member of the class D GPCRs. Class D receptors are composed of two major subfamilies: Ste2 and Ste3. These two GPCRs (Ste2 and Ste3) sense the polypeptide mating pheromones, alpha-factor and a-factor, which activate a G protein-coupled receptors on the surface of the opposite yeast-mating haploid-types (MATa and MAT-alpha), respectively. Activation of these receptors by pheromones leads to activation of the mitogen-activated protein kinase (MAPK) signal transduction cascades, G1 cell cycle arrest, and polarized cell growth in the direction of the partner cell (a process called shmooing), which ultimately induces cell-cell fusion and the formation of a diploid zygote. Like all GPCRs, these pheromone mating factor receptors possess the same basic architecture of seven-transmembrane (7TM) domains and share common signaling mechanisms; however, there is no significant sequence similarity either between Ste2 and Ste3, or between these two receptors and the other 7TM GPCRs. Thus, STE2 and STE3 represent phylogenetically distinct groups.


Pssm-ID: 320097  Cd Length: 259  Bit Score: 267.06  E-value: 2.28e-91
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 742255993   1 WHLQAWNSGTCLFMIWTAIGCLNYFINSIIWHGNAIDWAP--IWCDISTRLTVGLAVAIPAAALCIHRRLYKIATVQTVS 78
Cdd:cd14966   20 WHLRARNVGACLLIFWLFLLNLINFVNAIIWPGDDINRAPdkVWCDISTKLIIGASVGIPAASLCINRRLYRIASTRRVT 99
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 742255993  79 ISRAEKRKAVIVDLSIGLGIPCLQMILQVIVLGHRYDIWEDVGCLPMTSNTPPAYPLTLLWPLAIALASAVYCILTLRAF 158
Cdd:cd14966  100 LTRADKRRRIIIDLLICLGLPILVMALHYIVQGHRYDIFEDVGCYPAIYNSWPALVLVYIWPLIISLIAAVYAVLTLRRF 179
                        170       180       190
                 ....*....|....*....|....*....|
gi 742255993 159 IKRRSQFRELL-SSNSSLTMNRYLRLMMLA 187
Cdd:cd14966  180 FRRRKQFRDLLsSSNSGLTTSRFLRLMALA 209
STE3 pfam02076
Pheromone A receptor;
1-187 2.72e-88

Pheromone A receptor;


Pssm-ID: 334803  Cd Length: 282  Bit Score: 260.13  E-value: 2.72e-88
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 742255993    1 WHLQAWNSGTCLFMIWTAIGCLNYFINSIIWHGNAIDWAPI---WCDISTRLTVGLAVAIPAAALCIHRRLYKIATVQTV 77
Cdd:pfam02076  16 WHLRARNIGACLLIFWLFLLNLIYFVNAIIWRGDDIDWAPVgygWCDISTKLIIGASVGIPAALLCIARNLYRILSTRRV 95
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 742255993   78 SISRAEKRKAVIVDLSIGLGIPCLQMILQVIVLGHRYDIWEDVGCLPMTSNTPPAYPLTLLWPLAIALASAVYCILTLRA 157
Cdd:pfam02076  96 TLSRREKRRRIIIDLLICLGIPILQMALHYIVQGHRYDIFEDVGCYPAYYNTWPALVLFIIWPPIISLIAAVYAVLTLRR 175
                         170       180       190
                  ....*....|....*....|....*....|.
gi 742255993  158 FIKRRSQFRELL-SSNSSLTMNRYLRLMMLA 187
Cdd:pfam02076 176 FIRRRKQFRDLLsSSNSGLNKSRFLRLLALA 206
 
Name Accession Description Interval E-value
7tmD_STE3 cd14966
fungal a-factor pheromone receptor STE3, member of the class D family of seven-transmembrane G ...
1-187 2.28e-91

fungal a-factor pheromone receptor STE3, member of the class D family of seven-transmembrane G protein-coupled receptors; This subfamily represents the a-factor pheromone receptor encoded by the STE3 gene, which is required for pheromone sensing and mating in haploid cells of the yeast Saccharomyces cerevisiae. The STE3-encoded seven-transmembrane domain receptor is a member of the class D GPCRs. Class D receptors are composed of two major subfamilies: Ste2 and Ste3. These two GPCRs (Ste2 and Ste3) sense the polypeptide mating pheromones, alpha-factor and a-factor, which activate a G protein-coupled receptors on the surface of the opposite yeast-mating haploid-types (MATa and MAT-alpha), respectively. Activation of these receptors by pheromones leads to activation of the mitogen-activated protein kinase (MAPK) signal transduction cascades, G1 cell cycle arrest, and polarized cell growth in the direction of the partner cell (a process called shmooing), which ultimately induces cell-cell fusion and the formation of a diploid zygote. Like all GPCRs, these pheromone mating factor receptors possess the same basic architecture of seven-transmembrane (7TM) domains and share common signaling mechanisms; however, there is no significant sequence similarity either between Ste2 and Ste3, or between these two receptors and the other 7TM GPCRs. Thus, STE2 and STE3 represent phylogenetically distinct groups.


Pssm-ID: 320097  Cd Length: 259  Bit Score: 267.06  E-value: 2.28e-91
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 742255993   1 WHLQAWNSGTCLFMIWTAIGCLNYFINSIIWHGNAIDWAP--IWCDISTRLTVGLAVAIPAAALCIHRRLYKIATVQTVS 78
Cdd:cd14966   20 WHLRARNVGACLLIFWLFLLNLINFVNAIIWPGDDINRAPdkVWCDISTKLIIGASVGIPAASLCINRRLYRIASTRRVT 99
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 742255993  79 ISRAEKRKAVIVDLSIGLGIPCLQMILQVIVLGHRYDIWEDVGCLPMTSNTPPAYPLTLLWPLAIALASAVYCILTLRAF 158
Cdd:cd14966  100 LTRADKRRRIIIDLLICLGLPILVMALHYIVQGHRYDIFEDVGCYPAIYNSWPALVLVYIWPLIISLIAAVYAVLTLRRF 179
                        170       180       190
                 ....*....|....*....|....*....|
gi 742255993 159 IKRRSQFRELL-SSNSSLTMNRYLRLMMLA 187
Cdd:cd14966  180 FRRRKQFRDLLsSSNSGLTTSRFLRLMALA 209
STE3 pfam02076
Pheromone A receptor;
1-187 2.72e-88

Pheromone A receptor;


Pssm-ID: 334803  Cd Length: 282  Bit Score: 260.13  E-value: 2.72e-88
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 742255993    1 WHLQAWNSGTCLFMIWTAIGCLNYFINSIIWHGNAIDWAPI---WCDISTRLTVGLAVAIPAAALCIHRRLYKIATVQTV 77
Cdd:pfam02076  16 WHLRARNIGACLLIFWLFLLNLIYFVNAIIWRGDDIDWAPVgygWCDISTKLIIGASVGIPAALLCIARNLYRILSTRRV 95
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 742255993   78 SISRAEKRKAVIVDLSIGLGIPCLQMILQVIVLGHRYDIWEDVGCLPMTSNTPPAYPLTLLWPLAIALASAVYCILTLRA 157
Cdd:pfam02076  96 TLSRREKRRRIIIDLLICLGIPILQMALHYIVQGHRYDIFEDVGCYPAYYNTWPALVLFIIWPPIISLIAAVYAVLTLRR 175
                         170       180       190
                  ....*....|....*....|....*....|.
gi 742255993  158 FIKRRSQFRELL-SSNSSLTMNRYLRLMMLA 187
Cdd:pfam02076 176 FIRRRKQFRDLLsSSNSGLNKSRFLRLLALA 206
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.17
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH