NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|746891777|gb|AJD81758|]
View 

oxytocin receptor, partial [Saguinus martinsi]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
7tm_GPCRs super family cl28897
seven-transmembrane G protein-coupled receptor superfamily; This hierarchical evolutionary ...
1-30 7.02e-16

seven-transmembrane G protein-coupled receptor superfamily; This hierarchical evolutionary model represents the seven-transmembrane (7TM) receptors, often referred to as G protein-coupled receptors (GPCRs), which transmit physiological signals from the outside of the cell to the inside via G proteins. GPCRs constitute the largest known superfamily of transmembrane receptors across the three kingdoms of life that respond to a wide variety of extracellular stimuli including peptides, lipids, neurotransmitters, amino acids, hormones, and sensory stimuli such as light, smell and taste. All GPCRs share a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes. However, some 7TM receptors, such as the type 1 microbial rhodopsins, do not activate G proteins. Based on sequence similarity, GPCRs can be divided into six major classes: class A (the rhodopsin-like family), class B (the Methuselah-like, adhesion and secretin-like receptor family), class C (the metabotropic glutamate receptor family), class D (the fungal mating pheromone receptors), class E (the cAMP receptor family), and class F (the frizzled/smoothened receptor family). Nearly 800 human GPCR genes have been identified and are involved essentially in all major physiological processes. Approximately 40% of clinically marketed drugs mediate their effects through modulation of GPCR function for the treatment of a variety of human diseases including bacterial infections.


The actual alignment was detected with superfamily member cd15387:

Pssm-ID: 475119 [Multi-domain]  Cd Length: 297  Bit Score: 69.46  E-value: 7.02e-16
                         10        20        30
                 ....*....|....*....|....*....|
gi 746891777   1 FIIVMLLASLNSCCNPWIYMLFTGHLFHEL 30
Cdd:cd15387  268 FIIAMLLASLNSCCNPWIYMFFTGHLFHDL 297
 
Name Accession Description Interval E-value
7tmA_OT_R cd15387
oxytocin receptor, member of the class A family of seven-transmembrane G protein-coupled ...
1-30 7.02e-16

oxytocin receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; Oxytocin is a peptide of nine amino acids synthesized in the hypothalamus and is released from the posterior pituitary gland. Oxytocin plays an important role in sexual reproduction of both sexes and is structurally very similar to vasopressin. Although vasopressin and oxytocin differ only by two amino acids and stimulate the same cAMP/PKA pathway, they have divergent physiological functions. Vasopressin is involved in regulating blood pressure and the balance of water and sodium ions, whereas oxytocin plays an important role in the uterus during childbirth and in lactation.


Pssm-ID: 320509 [Multi-domain]  Cd Length: 297  Bit Score: 69.46  E-value: 7.02e-16
                         10        20        30
                 ....*....|....*....|....*....|
gi 746891777   1 FIIVMLLASLNSCCNPWIYMLFTGHLFHEL 30
Cdd:cd15387  268 FIIAMLLASLNSCCNPWIYMFFTGHLFHDL 297
 
Name Accession Description Interval E-value
7tmA_OT_R cd15387
oxytocin receptor, member of the class A family of seven-transmembrane G protein-coupled ...
1-30 7.02e-16

oxytocin receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; Oxytocin is a peptide of nine amino acids synthesized in the hypothalamus and is released from the posterior pituitary gland. Oxytocin plays an important role in sexual reproduction of both sexes and is structurally very similar to vasopressin. Although vasopressin and oxytocin differ only by two amino acids and stimulate the same cAMP/PKA pathway, they have divergent physiological functions. Vasopressin is involved in regulating blood pressure and the balance of water and sodium ions, whereas oxytocin plays an important role in the uterus during childbirth and in lactation.


Pssm-ID: 320509 [Multi-domain]  Cd Length: 297  Bit Score: 69.46  E-value: 7.02e-16
                         10        20        30
                 ....*....|....*....|....*....|
gi 746891777   1 FIIVMLLASLNSCCNPWIYMLFTGHLFHEL 30
Cdd:cd15387  268 FIIAMLLASLNSCCNPWIYMFFTGHLFHDL 297
7tmA_Vasopressin_Oxytocin cd15196
vasopressin and oxytocin receptors, member of the class A family of seven-transmembrane G ...
1-30 8.13e-13

vasopressin and oxytocin receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Vasopressin (also known as arginine vasopressin or anti-diuretic hormone) and oxytocin are synthesized in the hypothalamus and are released from the posterior pituitary gland. The actions of vasopressin are mediated by the interaction of this hormone with three receptor subtypes: V1aR, V1bR, and V2R. These subtypes are differ in localization, function, and signaling pathways. Activation of V1aR and V1bR stimulate phospholipase C, while activation of V2R stimulates adenylate cyclase. Although vasopressin and oxytocin differ only by two amino acids and stimulate the same cAMP/PKA pathway, they have divergent physiological functions. Vasopressin is involved in regulating blood pressure and the balance of water and sodium ions, whereas oxytocin plays an important role in the uterus during childbirth and in lactation.


Pssm-ID: 320324 [Multi-domain]  Cd Length: 264  Bit Score: 60.71  E-value: 8.13e-13
                         10        20        30
                 ....*....|....*....|....*....|
gi 746891777   1 FIIVMLLASLNSCCNPWIYMLFTGHLFHEL 30
Cdd:cd15196  235 FVIIMLLASLNSCTNPWIYLAFSGNLRRAL 264
7tmA_V1bR cd15386
vasopressin receptor subtype 1B, member of the class A family of seven-transmembrane G ...
1-29 8.74e-11

vasopressin receptor subtype 1B, member of the class A family of seven-transmembrane G protein-coupled receptors; The V1b receptor is specifically expressed in corticotropes of the anterior pituitary and plays a critical role in regulating the activity of hypothalamic-pituitary-adrenal axis, a key part of the neuroendocrine system that controls reactions to stress, by maintaining adrenocorticotropic hormone (ACTH) and corticosterone levels. Vasopressin (also known as arginine vasopressin or anti-diuretic hormone) is synthesized in the hypothalamus and is released from the posterior pituitary gland. The actions of vasopressin are mediated by the interaction of this hormone with three receptor subtypes: V1aR, V1bR, and V2R. These subtypes are differ in localization, function, and signaling pathways. Activation of V1aR and V1bR stimulate phospholipase C, while activation of V2R stimulates adenylate cyclase. Although vasopressin and oxytocin differ only by two amino acids and stimulate the same cAMP/PKA pathway, they have divergent physiological functions. Vasopressin is involved in regulating blood pressure and the balance of water and sodium ions, whereas oxytocin plays an important role in the uterus during childbirth and in lactation.


Pssm-ID: 320508 [Multi-domain]  Cd Length: 302  Bit Score: 55.57  E-value: 8.74e-11
                         10        20
                 ....*....|....*....|....*....
gi 746891777   1 FIIVMLLASLNSCCNPWIYMLFTGHLFHE 29
Cdd:cd15386  273 FTITMLLASLSSCCNPWIYMFFSGHLLQD 301
7tmA_V1aR cd15385
vasopressin receptor subtype 1A, member of the class A family of seven-transmembrane G ...
1-29 4.73e-10

vasopressin receptor subtype 1A, member of the class A family of seven-transmembrane G protein-coupled receptors; V1a-type receptor is a G(q/11)-coupled receptor that mediates blood vessel constriction. Vasopressin (also known as arginine vasopressin or anti-diuretic hormone) is synthesized in the hypothalamus and is released from the posterior pituitary gland. The actions of vasopressin are mediated by the interaction of this hormone with three receptor subtypes: V1aR, V1bR, and V2R. These subtypes are differ in localization, function, and signaling pathways. Activation of V1aR and V1bR stimulate phospholipase C, while activation of V2R stimulates adenylate cyclase. Although vasopressin and oxytocin differ only by two amino acids and stimulate the same cAMP/PKA pathway, they have divergent physiological functions. Vasopressin is involved in regulating blood pressure and the balance of water and sodium ions, whereas oxytocin plays an important role in the uterus during childbirth and in lactation.


Pssm-ID: 320507 [Multi-domain]  Cd Length: 301  Bit Score: 53.67  E-value: 4.73e-10
                         10        20
                 ....*....|....*....|....*....
gi 746891777   1 FIIVMLLASLNSCCNPWIYMLFTGHLFHE 29
Cdd:cd15385  272 VTITALLASLNSCCNPWIYMFFSGHLLQD 300
7tmA_V2R cd15388
vasopressin receptor 2, member of the class A family of seven-transmembrane G protein-coupled ...
1-30 1.34e-09

vasopressin receptor 2, member of the class A family of seven-transmembrane G protein-coupled receptors; The vasopressin type 2 receptor (V2R) is a G(s)-coupled receptor that controls balance of water and sodium ion by regulating their reabsorption in the renal collecting duct. Mutations of V2R is responsible for nephrogenic diabetes insipidus. Vasopressin (also known as arginine vasopressin or anti-diuretic hormone) is synthesized in the hypothalamus and is released from the posterior pituitary gland. The actions of vasopressin are mediated by the interaction of this hormone with three receptor subtypes: V1aR, V1bR, and V2R. These subtypes are differ in localization, function, and signaling pathways. Activation of V1aR and V1bR stimulate phospholipase C, while activation of V2R stimulates adenylate cyclase. Although vasopressin and oxytocin differ only by two amino acids and stimulate the same cAMP/PKA pathway, they have divergent physiological functions. Vasopressin is involved in regulating blood pressure and the balance of water and sodium ions, whereas oxytocin plays an important role in the uterus during childbirth and in lactation.


Pssm-ID: 320510 [Multi-domain]  Cd Length: 295  Bit Score: 52.08  E-value: 1.34e-09
                         10        20        30
                 ....*....|....*....|....*....|
gi 746891777   1 FIIVMLLASLNSCCNPWIYMLFTGHLFHEL 30
Cdd:cd15388  266 FTILMLLASLNSCTNPWIYMAFSSSVSKEL 295
7tmA_Vasopressin-like cd14986
vasopressin receptors and its related G protein-coupled receptors, member of the class A ...
1-30 1.44e-09

vasopressin receptors and its related G protein-coupled receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Members of this group form a subfamily within the class A G-protein coupled receptors (GPCRs), which includes the vasopressin and oxytocin receptors, the gonadotropin-releasing hormone receptors (GnRHRs), the neuropeptide S receptor (NPSR), and orphan GPR150. These receptors share significant sequence homology with each other, suggesting that they have a common evolutionary origin. Vasopressin, also known as arginine vasopressin or anti-diuretic hormone, is a neuropeptide synthesized in the hypothalamus. The actions of vasopressin are mediated by the interaction of this hormone with three tissue-specific subtypes: V1AR, V1BR, and V2R. Although vasopressin differs from oxytocin by only two amino acids, they have divergent physiological functions. Vasopressin is involved in regulating osmotic and cardiovascular homeostasis, whereas oxytocin plays an important role in the uterus during childbirth and in lactation. GnRHR, also known as luteinizing hormone releasing hormone receptor (LHRHR), plays an central role in vertebrate reproductive function; its activation by binding to GnRH leads to the release of follicle stimulating hormone (FSH) and luteinizing hormone (LH) from the pituitary gland. Neuropeptide S (NPS) promotes arousal and anxiolytic-like effects by activating its cognate receptor NPSR. NPSR has also been associated with asthma and allergy. GPR150 is an orphan receptor closely related to the oxytocin and vasopressin receptors.


Pssm-ID: 320117 [Multi-domain]  Cd Length: 295  Bit Score: 51.99  E-value: 1.44e-09
                         10        20        30
                 ....*....|....*....|....*....|
gi 746891777   1 FIIVMLLASLNSCCNPWIYMLFTGHLFHEL 30
Cdd:cd14986  266 YVVSETLASLNSALNPLIYGFFSSHLSFEH 295
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.21
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Wang J et al. (2023), "The conserved domain database in 2023", Nucleic Acids Res.51(D)384-8.
  • Lu S et al. (2020), "The conserved domain database in 2020", Nucleic Acids Res.48(D)265-8.
  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH