NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|755546238|ref|XP_011242945|]
View 

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
PMP22_Claudin super family cl21598
PMP-22/EMP/MP20/Claudin family;
9-198 1.17e-53

PMP-22/EMP/MP20/Claudin family;


The actual alignment was detected with superfamily member pfam10242:

Pssm-ID: 419754  Cd Length: 181  Bit Score: 170.20  E-value: 1.17e-53
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 755546238    9 RSMLWTLLSIVVAFAELVAFMSADWLIGKAKTRsgsgdeqagmnsEPHYLGILCIRTPAMQQvsRDTLCGTYAKSFGEIA 88
Cdd:pfam10242   1 VGVLWALLTICFAILSVVAFVQPYWLGGSVDSP------------QAGSFGLYSRCIGVMLQ--MELTCGGYALDFLAIP 66
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 755546238   89 SGFWQATAIFLAVGIFILCVVALVSVFTMCVQSIMRKSIFNVCGLLQGIAGLFLILGLILYPAGWGCQKAID-CGRYASP 167
Cdd:pfam10242  67 SSAWQAAMFFVGLGTFLLLLIACLSLFTFCRQSIISKSVFKICGWLQLVAGLCLMLGCMLYPDGWDSPEVRRlCGPESGK 146
                         170       180       190
                  ....*....|....*....|....*....|....*
gi 755546238  168 YKPGDCSLGWAFYTA----TGGTVLTFICAVFSAQ 198
Cdd:pfam10242 147 YSLGLCSIGWAYYLAiigiLDALLLTFLAFVLSLR 181
 
Name Accession Description Interval E-value
L_HMGIC_fpl pfam10242
Lipoma HMGIC fusion partner-like protein; This is a group of proteins expressed from a series ...
9-198 1.17e-53

Lipoma HMGIC fusion partner-like protein; This is a group of proteins expressed from a series of genes referred to as Lipoma HMGIC fusion partner-like. The proteins carry four highly conserved transmembrane domains in this entry. In certain instances, eg in LHFPL5, mutations cause deafness in humans and hypospadias, and LHFPL1 is transcribed in six liver tumor cell lines.


Pssm-ID: 370913  Cd Length: 181  Bit Score: 170.20  E-value: 1.17e-53
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 755546238    9 RSMLWTLLSIVVAFAELVAFMSADWLIGKAKTRsgsgdeqagmnsEPHYLGILCIRTPAMQQvsRDTLCGTYAKSFGEIA 88
Cdd:pfam10242   1 VGVLWALLTICFAILSVVAFVQPYWLGGSVDSP------------QAGSFGLYSRCIGVMLQ--MELTCGGYALDFLAIP 66
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 755546238   89 SGFWQATAIFLAVGIFILCVVALVSVFTMCVQSIMRKSIFNVCGLLQGIAGLFLILGLILYPAGWGCQKAID-CGRYASP 167
Cdd:pfam10242  67 SSAWQAAMFFVGLGTFLLLLIACLSLFTFCRQSIISKSVFKICGWLQLVAGLCLMLGCMLYPDGWDSPEVRRlCGPESGK 146
                         170       180       190
                  ....*....|....*....|....*....|....*
gi 755546238  168 YKPGDCSLGWAFYTA----TGGTVLTFICAVFSAQ 198
Cdd:pfam10242 147 YSLGLCSIGWAYYLAiigiLDALLLTFLAFVLSLR 181
 
Name Accession Description Interval E-value
L_HMGIC_fpl pfam10242
Lipoma HMGIC fusion partner-like protein; This is a group of proteins expressed from a series ...
9-198 1.17e-53

Lipoma HMGIC fusion partner-like protein; This is a group of proteins expressed from a series of genes referred to as Lipoma HMGIC fusion partner-like. The proteins carry four highly conserved transmembrane domains in this entry. In certain instances, eg in LHFPL5, mutations cause deafness in humans and hypospadias, and LHFPL1 is transcribed in six liver tumor cell lines.


Pssm-ID: 370913  Cd Length: 181  Bit Score: 170.20  E-value: 1.17e-53
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 755546238    9 RSMLWTLLSIVVAFAELVAFMSADWLIGKAKTRsgsgdeqagmnsEPHYLGILCIRTPAMQQvsRDTLCGTYAKSFGEIA 88
Cdd:pfam10242   1 VGVLWALLTICFAILSVVAFVQPYWLGGSVDSP------------QAGSFGLYSRCIGVMLQ--MELTCGGYALDFLAIP 66
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 755546238   89 SGFWQATAIFLAVGIFILCVVALVSVFTMCVQSIMRKSIFNVCGLLQGIAGLFLILGLILYPAGWGCQKAID-CGRYASP 167
Cdd:pfam10242  67 SSAWQAAMFFVGLGTFLLLLIACLSLFTFCRQSIISKSVFKICGWLQLVAGLCLMLGCMLYPDGWDSPEVRRlCGPESGK 146
                         170       180       190
                  ....*....|....*....|....*....|....*
gi 755546238  168 YKPGDCSLGWAFYTA----TGGTVLTFICAVFSAQ 198
Cdd:pfam10242 147 YSLGLCSIGWAYYLAiigiLDALLLTFLAFVLSLR 181
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH