NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|7766970]
View 

Protein Classification

acetyl-CoA C-acetyltransferase (domain architecture ID 11481662)

acetyl-CoA C-acetyltransferase catalyzes the reversible condensation of two acetyl-CoA units to form acetoacetyl-CoA

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
PRK05790 PRK05790
putative acyltransferase; Provisional
2-387 0e+00

putative acyltransferase; Provisional


:

Pssm-ID: 180261  Cd Length: 393  Bit Score: 701.14  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970     2 IVIASAARTAVGSFNGAFANTPAHELGATVISAVLERAGVAAGEVNEVILGQVLPAGEGQNPARQAAMKAGVPQEATAWG 81
Cdd:PRK05790   4 VVIVSAARTPIGKFGGALKDVSAVELGAIVIKAALERAGVPPEQVDEVIMGQVLQAGAGQNPARQAALKAGLPVEVPALT 83
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970    82 MNQLCGSGLRAVALGMQQIATGDASIIVAGGMESMSMAPHC-AHLRGGVKMGDFKMIDTMIKDGLTDAFYGYHMGTTAEN 160
Cdd:PRK05790  84 INKVCGSGLKAVALAAQAIRAGDADIVVAGGQESMSQAPHVlPGSRWGQKMGDVELVDTMIHDGLTDAFNGYHMGITAEN 163
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   161 VAKQWQLSRDEQDAFAVASQNKAEAAQKDGRFKDEIVPFIVKGRKGD-ITVDADEYIRHGATLDSMAKLRPAFDKEGTVT 239
Cdd:PRK05790 164 LAEQYGITREEQDEFALASQQKAEAAIKAGRFKDEIVPVTIKQRKGDpVVVDTDEHPRPDTTAESLAKLRPAFDKDGTVT 243
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   240 AGNASGLNDGAAAALLMSEAEASRRGIQPLGRIVSWATVGVDPKVMGTGPIPASRKALERAGWKIGDLDLVEANEAFAAQ 319
Cdd:PRK05790 244 AGNASGINDGAAAVVVMSEAKAKELGLTPLARIVSYAVAGVDPAIMGIGPVPAIRKALEKAGWSLADLDLIEINEAFAAQ 323
                        330       340       350       360       370       380
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 7766970   320 ACAVNKDLGWDPSIVNVNGGAIAIGHPIGASGARILNTLLFEMKRRGARKGLATLCIGGGMGVAMCIE 387
Cdd:PRK05790 324 ALAVEKELGLDPEKVNVNGGAIALGHPIGASGARILVTLLHEMKRRGAKKGLATLCIGGGQGVALIVE 391
 
Name Accession Description Interval E-value
PRK05790 PRK05790
putative acyltransferase; Provisional
2-387 0e+00

putative acyltransferase; Provisional


Pssm-ID: 180261  Cd Length: 393  Bit Score: 701.14  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970     2 IVIASAARTAVGSFNGAFANTPAHELGATVISAVLERAGVAAGEVNEVILGQVLPAGEGQNPARQAAMKAGVPQEATAWG 81
Cdd:PRK05790   4 VVIVSAARTPIGKFGGALKDVSAVELGAIVIKAALERAGVPPEQVDEVIMGQVLQAGAGQNPARQAALKAGLPVEVPALT 83
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970    82 MNQLCGSGLRAVALGMQQIATGDASIIVAGGMESMSMAPHC-AHLRGGVKMGDFKMIDTMIKDGLTDAFYGYHMGTTAEN 160
Cdd:PRK05790  84 INKVCGSGLKAVALAAQAIRAGDADIVVAGGQESMSQAPHVlPGSRWGQKMGDVELVDTMIHDGLTDAFNGYHMGITAEN 163
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   161 VAKQWQLSRDEQDAFAVASQNKAEAAQKDGRFKDEIVPFIVKGRKGD-ITVDADEYIRHGATLDSMAKLRPAFDKEGTVT 239
Cdd:PRK05790 164 LAEQYGITREEQDEFALASQQKAEAAIKAGRFKDEIVPVTIKQRKGDpVVVDTDEHPRPDTTAESLAKLRPAFDKDGTVT 243
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   240 AGNASGLNDGAAAALLMSEAEASRRGIQPLGRIVSWATVGVDPKVMGTGPIPASRKALERAGWKIGDLDLVEANEAFAAQ 319
Cdd:PRK05790 244 AGNASGINDGAAAVVVMSEAKAKELGLTPLARIVSYAVAGVDPAIMGIGPVPAIRKALEKAGWSLADLDLIEINEAFAAQ 323
                        330       340       350       360       370       380
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 7766970   320 ACAVNKDLGWDPSIVNVNGGAIAIGHPIGASGARILNTLLFEMKRRGARKGLATLCIGGGMGVAMCIE 387
Cdd:PRK05790 324 ALAVEKELGLDPEKVNVNGGAIALGHPIGASGARILVTLLHEMKRRGAKKGLATLCIGGGQGVALIVE 391
thiolase cd00751
Thiolase are ubiquitous enzymes that catalyze the reversible thiolytic cleavage of ...
3-387 0e+00

Thiolase are ubiquitous enzymes that catalyze the reversible thiolytic cleavage of 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA, a 2-step reaction involving a covalent intermediate formed with a catalytic cysteine. They are found in prokaryotes and eukaryotes (cytosol, microbodies and mitochondria). There are 2 functional different classes: thiolase-I (3-ketoacyl-CoA thiolase) and thiolase-II (acetoacetyl-CoA thiolase). Thiolase-I can cleave longer fatty acid molecules and plays an important role in the beta-oxidative degradation of fatty acids. Thiolase-II has a high substrate specificity. Although it can cleave acetoacyl-CoA, its main function is the synthesis of acetoacyl-CoA from two molecules of acetyl-CoA, which gives it importance in several biosynthetic pathways.


Pssm-ID: 238383 [Multi-domain]  Cd Length: 386  Bit Score: 605.63  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970    3 VIASAARTAVGSFNGAFANTPAHELGATVISAVLERAGVAAGEVNEVILGQVLPAGEGQNPARQAAMKAGVPQEATAWGM 82
Cdd:cd00751   1 VIVSAVRTPIGRFGGALKDVSADDLGAAVIKALLERAGLDPEEVDDVIMGNVLQAGEGQNPARQAALLAGLPESVPATTV 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   83 NQLCGSGLRAVALGMQQIATGDASIIVAGGMESMSMAPHCAHLRGGVKMGDFKMIDTMIKDGLTDAFYGYHMGTTAENVA 162
Cdd:cd00751  81 NRVCGSGLQAVALAAQSIAAGEADVVVAGGVESMSRAPYLLPKARRGGRLGLNTLDGMLDDGLTDPFTGLSMGITAENVA 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970  163 KQWQLSRDEQDAFAVASQNKAEAAQKDGRFKDEIVPFIVKGRKGDITVDADEYIRHGATLDSMAKLRPAFDKEGTVTAGN 242
Cdd:cd00751 161 EKYGISREEQDEFALRSHQRAAAAQEAGRFKDEIVPVEVPGRKGPVVVDRDEGPRPDTTLEKLAKLKPAFKKDGTVTAGN 240
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970  243 ASGLNDGAAAALLMSEAEASRRGIQPLGRIVSWATVGVDPKVMGTGPIPASRKALERAGWKIGDLDLVEANEAFAAQACA 322
Cdd:cd00751 241 ASGINDGAAAVLLMSEEKAKELGLKPLARIVGYAVAGVDPAIMGIGPVPAIPKALKRAGLTLDDIDLIEINEAFAAQALA 320
                       330       340       350       360       370       380
                ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 7766970  323 VNKDLGWDPSIVNVNGGAIAIGHPIGASGARILNTLLFEMKRRGARKGLATLCIGGGMGVAMCIE 387
Cdd:cd00751 321 CLKELGLDPEKVNVNGGAIALGHPLGASGARIVVTLLHELKRRGGRYGLATMCIGGGQGAAMVIE 385
AcCoA-C-Actrans TIGR01930
acetyl-CoA acetyltransferases; This model represents a large family of enzymes which catalyze ...
4-387 2.11e-179

acetyl-CoA acetyltransferases; This model represents a large family of enzymes which catalyze the thiolysis of a linear fatty acid CoA (or acetoacetyl-CoA) using a second CoA molecule to produce acetyl-CoA and a CoA-ester product two carbons shorter (or, alternatively, the condensation of two molecules of acetyl-CoA to produce acetoacetyl-CoA and CoA). This enzyme is also known as "thiolase", "3-ketoacyl-CoA thiolase", "beta-ketothiolase" and "Fatty oxidation complex beta subunit". When catalyzing the degradative reaction on fatty acids the corresponding EC number is 2.3.1.16. The condensation reaction corresponds to 2.3.1.9. Note that the enzymes which catalyze the condensation are generally not involved in fatty acid biosynthesis, which is carried out by a decarboxylating condensation of acetyl and malonyl esters of acyl carrier proteins. Rather, this activity may produce acetoacetyl-CoA for pathways such as IPP biosynthesis in the absence of sufficient fatty acid oxidation. [Fatty acid and phospholipid metabolism, Other]


Pssm-ID: 273881 [Multi-domain]  Cd Length: 385  Bit Score: 503.68  E-value: 2.11e-179
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970      4 IASAARTAVGSFNGAFANTPAHELGATVISAVLERAGVAAGEVNEVILGQVLPAGEGQNPARQAAMKAGVPQEATAWGMN 83
Cdd:TIGR01930   1 IVAAARTPIGKFGGSLKDVSAEDLGAAVIKELLERNPLDPELIDDVIFGNVLQAGEQQNIARQAALLAGLPESVPAYTVN 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970     84 QLCGSGLRAVALGMQQIATGDASIIVAGGMESMSMAP--HCAHLRGGVKMGDFKMIDTMIKDgLTDAFYGYHMGTTAENV 161
Cdd:TIGR01930  81 RQCASGLQAVILAAQLIRAGEADVVVAGGVESMSRVPygVPRSLRWGVKPGNAELEDARLKD-LTDANTGLPMGVTAENL 159
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970    162 AKQWQLSRDEQDAFAVASQNKAEAAQKDGRFKDEIVPFIVKGRKGDITVDADEYIRHGATLDSMAKLRPAFDKEGTVTAG 241
Cdd:TIGR01930 160 AKKYGISREEQDEYALRSHQRAAKAWEEGLFKDEIVPVTVKGRKGPVTVSSDEGIRPNTTLEKLAKLKPAFDPDGTVTAG 239
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970    242 NASGLNDGAAAALLMSEAEASRRGIQPLGRIVSWATVGVDPKVMGTGPIPASRKALERAGWKIGDLDLVEANEAFAAQAC 321
Cdd:TIGR01930 240 NSSPLNDGAAALLLMSEEKAKELGLTPLARIVSFAVAGVDPEIMGLGPVPAIPKALKKAGLSISDIDLFEINEAFAAQVL 319
                         330       340       350       360       370       380
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 7766970    322 AVNKDLGWDPSIVNVNGGAIAIGHPIGASGARILNTLLFEMKRRGARKGLATLCIGGGMGVAMCIE 387
Cdd:TIGR01930 320 ACIKELGLDLEKVNVNGGAIALGHPLGASGARIVTTLLHELKRRGGRYGLATMCIGGGQGAAVILE 385
Thiolase_N pfam00108
Thiolase, N-terminal domain; Thiolase is reported to be structurally related to beta-ketoacyl ...
2-259 2.38e-133

Thiolase, N-terminal domain; Thiolase is reported to be structurally related to beta-ketoacyl synthase (pfam00109), and also chalcone synthase.


Pssm-ID: 333844 [Multi-domain]  Cd Length: 260  Bit Score: 382.04  E-value: 2.38e-133
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970      2 IVIASAARTAVGSFNGAFANTPAHELGATVISAVLERAGVAAGEVNEVILGQVLPAGEGQNPARQAAMKAGVPQEATAWG 81
Cdd:pfam00108   1 VVIVSAARTPFGSFGGSLKDVSAVELGAEAIKAALERAGVDPEDVDEVIVGNVLQAGEGQNPARQAALKAGIPDSAPAVT 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970     82 MNQLCGSGLRAVALGMQQIATGDASIIVAGGMESMSMAPHCA--HLRGGVKMGDFKMIDTMIKDGLTDAFYGYHMGTTAE 159
Cdd:pfam00108  81 INKVCGSGLKAVYLAAQSIASGDADVVVAGGVESMSHAPYALptDARSGLKHGDEKKHDLLIPDGLTDAFNGYHMGITAE 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970    160 NVAKQWQLSRDEQDAFAVASQNKAEAAQKDGRFKDEIVPFIVKGRKGDITVDADEYIRHGATLDSMAKLRPAFDKEGTVT 239
Cdd:pfam00108 161 NVAKKYGISREEQDEFAVKSHQKAAAAQKAGKFKDEIVPVTVKGRKGKPTVDTDEGIRPPTTAEPLAKLKPAFDKEGTVT 240
                         250       260
                  ....*....|....*....|
gi 7766970    240 AGNASGLNDGAAAALLMSEA 259
Cdd:pfam00108 241 AGNASGINDGAAALLLMSES 260
PaaJ COG0183
Acetyl-CoA acetyltransferase [Lipid transport and metabolism];
2-387 2.34e-131

Acetyl-CoA acetyltransferase [Lipid transport and metabolism];


Pssm-ID: 223261 [Multi-domain]  Cd Length: 392  Bit Score: 382.03  E-value: 2.34e-131
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970    2 IVIASAARTAVGSFN-GAFANTPAHELGATVISAVLER--AGVAAGEVNEVILGQVLPAGE-GQNPARQAAMKAGVPQEA 77
Cdd:COG0183   4 VAIVGAGRTPFGKFGdGSLAELAAEALGAALIDAGLERapADVDAADVDDVILGCVLQAGEqGQNIARQAALAAGLPGSV 83
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   78 TAWGMNQLCGSGLRAVALGMQQIATGDASIIVAGGMESMSMAPhcaHLRGGVKMGDFkMIDTMIKDGLTDAFYGYHMGTT 157
Cdd:COG0183  84 PAVTVNRACASGLAAVRLAAQAIASGEADVVLAGGVEKMSDAP---MGREGVRVLDS-AVDPMFEDPLGDATPGYLMGLT 159
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970  158 AENVAKQWQLSRDEQDAFAVASQNKAEAAQKDGRFkDEIVPFIVKGRkgdiTVDADEYIRH--GATLDSMAKLRPAFDKE 235
Cdd:COG0183 160 AERYAKRYGISREDQDEVAVKSHKNAAANPKAGFF-DEITPEDVLNS----PVVADPLRRLdcSPTSDGAAALVPAFEEV 234
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970  236 -GTVTAGNASGLNDGAAAALLMSEAEASRRGIQPLGRIVSWATVGVDPKVMgTGPIPASRKALERAGWK-IGDLDLVEAN 313
Cdd:COG0183 235 gGTVTAGNASGINDGAAALLLMSESKAKELGLAPLAAIRAYAMAGVDPSIM-DGPVAAVHDALTIAGLLaLEDLGLAEKG 313
                       330       340       350       360       370       380       390
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 7766970  314 EAFAAQACAVNKDLGWDPsiVNVNGGAIAIGHPIGASGARILNTLLFEMKRRG----ARKGLATLCIGGG-MGVAMCIE 387
Cdd:COG0183 314 EAFAAVALGVTKILGDLP--VNPSGGAIALGHPIGATGARILVELARQLRGRGqvvaKRRGLATLCIGGGgQGVAAVLE 390
 
Name Accession Description Interval E-value
PRK05790 PRK05790
putative acyltransferase; Provisional
2-387 0e+00

putative acyltransferase; Provisional


Pssm-ID: 180261  Cd Length: 393  Bit Score: 701.14  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970     2 IVIASAARTAVGSFNGAFANTPAHELGATVISAVLERAGVAAGEVNEVILGQVLPAGEGQNPARQAAMKAGVPQEATAWG 81
Cdd:PRK05790   4 VVIVSAARTPIGKFGGALKDVSAVELGAIVIKAALERAGVPPEQVDEVIMGQVLQAGAGQNPARQAALKAGLPVEVPALT 83
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970    82 MNQLCGSGLRAVALGMQQIATGDASIIVAGGMESMSMAPHC-AHLRGGVKMGDFKMIDTMIKDGLTDAFYGYHMGTTAEN 160
Cdd:PRK05790  84 INKVCGSGLKAVALAAQAIRAGDADIVVAGGQESMSQAPHVlPGSRWGQKMGDVELVDTMIHDGLTDAFNGYHMGITAEN 163
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   161 VAKQWQLSRDEQDAFAVASQNKAEAAQKDGRFKDEIVPFIVKGRKGD-ITVDADEYIRHGATLDSMAKLRPAFDKEGTVT 239
Cdd:PRK05790 164 LAEQYGITREEQDEFALASQQKAEAAIKAGRFKDEIVPVTIKQRKGDpVVVDTDEHPRPDTTAESLAKLRPAFDKDGTVT 243
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   240 AGNASGLNDGAAAALLMSEAEASRRGIQPLGRIVSWATVGVDPKVMGTGPIPASRKALERAGWKIGDLDLVEANEAFAAQ 319
Cdd:PRK05790 244 AGNASGINDGAAAVVVMSEAKAKELGLTPLARIVSYAVAGVDPAIMGIGPVPAIRKALEKAGWSLADLDLIEINEAFAAQ 323
                        330       340       350       360       370       380
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 7766970   320 ACAVNKDLGWDPSIVNVNGGAIAIGHPIGASGARILNTLLFEMKRRGARKGLATLCIGGGMGVAMCIE 387
Cdd:PRK05790 324 ALAVEKELGLDPEKVNVNGGAIALGHPIGASGARILVTLLHEMKRRGAKKGLATLCIGGGQGVALIVE 391
thiolase cd00751
Thiolase are ubiquitous enzymes that catalyze the reversible thiolytic cleavage of ...
3-387 0e+00

Thiolase are ubiquitous enzymes that catalyze the reversible thiolytic cleavage of 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA, a 2-step reaction involving a covalent intermediate formed with a catalytic cysteine. They are found in prokaryotes and eukaryotes (cytosol, microbodies and mitochondria). There are 2 functional different classes: thiolase-I (3-ketoacyl-CoA thiolase) and thiolase-II (acetoacetyl-CoA thiolase). Thiolase-I can cleave longer fatty acid molecules and plays an important role in the beta-oxidative degradation of fatty acids. Thiolase-II has a high substrate specificity. Although it can cleave acetoacyl-CoA, its main function is the synthesis of acetoacyl-CoA from two molecules of acetyl-CoA, which gives it importance in several biosynthetic pathways.


Pssm-ID: 238383 [Multi-domain]  Cd Length: 386  Bit Score: 605.63  E-value: 0e+00
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970    3 VIASAARTAVGSFNGAFANTPAHELGATVISAVLERAGVAAGEVNEVILGQVLPAGEGQNPARQAAMKAGVPQEATAWGM 82
Cdd:cd00751   1 VIVSAVRTPIGRFGGALKDVSADDLGAAVIKALLERAGLDPEEVDDVIMGNVLQAGEGQNPARQAALLAGLPESVPATTV 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   83 NQLCGSGLRAVALGMQQIATGDASIIVAGGMESMSMAPHCAHLRGGVKMGDFKMIDTMIKDGLTDAFYGYHMGTTAENVA 162
Cdd:cd00751  81 NRVCGSGLQAVALAAQSIAAGEADVVVAGGVESMSRAPYLLPKARRGGRLGLNTLDGMLDDGLTDPFTGLSMGITAENVA 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970  163 KQWQLSRDEQDAFAVASQNKAEAAQKDGRFKDEIVPFIVKGRKGDITVDADEYIRHGATLDSMAKLRPAFDKEGTVTAGN 242
Cdd:cd00751 161 EKYGISREEQDEFALRSHQRAAAAQEAGRFKDEIVPVEVPGRKGPVVVDRDEGPRPDTTLEKLAKLKPAFKKDGTVTAGN 240
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970  243 ASGLNDGAAAALLMSEAEASRRGIQPLGRIVSWATVGVDPKVMGTGPIPASRKALERAGWKIGDLDLVEANEAFAAQACA 322
Cdd:cd00751 241 ASGINDGAAAVLLMSEEKAKELGLKPLARIVGYAVAGVDPAIMGIGPVPAIPKALKRAGLTLDDIDLIEINEAFAAQALA 320
                       330       340       350       360       370       380
                ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 7766970  323 VNKDLGWDPSIVNVNGGAIAIGHPIGASGARILNTLLFEMKRRGARKGLATLCIGGGMGVAMCIE 387
Cdd:cd00751 321 CLKELGLDPEKVNVNGGAIALGHPLGASGARIVVTLLHELKRRGGRYGLATMCIGGGQGAAMVIE 385
AcCoA-C-Actrans TIGR01930
acetyl-CoA acetyltransferases; This model represents a large family of enzymes which catalyze ...
4-387 2.11e-179

acetyl-CoA acetyltransferases; This model represents a large family of enzymes which catalyze the thiolysis of a linear fatty acid CoA (or acetoacetyl-CoA) using a second CoA molecule to produce acetyl-CoA and a CoA-ester product two carbons shorter (or, alternatively, the condensation of two molecules of acetyl-CoA to produce acetoacetyl-CoA and CoA). This enzyme is also known as "thiolase", "3-ketoacyl-CoA thiolase", "beta-ketothiolase" and "Fatty oxidation complex beta subunit". When catalyzing the degradative reaction on fatty acids the corresponding EC number is 2.3.1.16. The condensation reaction corresponds to 2.3.1.9. Note that the enzymes which catalyze the condensation are generally not involved in fatty acid biosynthesis, which is carried out by a decarboxylating condensation of acetyl and malonyl esters of acyl carrier proteins. Rather, this activity may produce acetoacetyl-CoA for pathways such as IPP biosynthesis in the absence of sufficient fatty acid oxidation. [Fatty acid and phospholipid metabolism, Other]


Pssm-ID: 273881 [Multi-domain]  Cd Length: 385  Bit Score: 503.68  E-value: 2.11e-179
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970      4 IASAARTAVGSFNGAFANTPAHELGATVISAVLERAGVAAGEVNEVILGQVLPAGEGQNPARQAAMKAGVPQEATAWGMN 83
Cdd:TIGR01930   1 IVAAARTPIGKFGGSLKDVSAEDLGAAVIKELLERNPLDPELIDDVIFGNVLQAGEQQNIARQAALLAGLPESVPAYTVN 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970     84 QLCGSGLRAVALGMQQIATGDASIIVAGGMESMSMAP--HCAHLRGGVKMGDFKMIDTMIKDgLTDAFYGYHMGTTAENV 161
Cdd:TIGR01930  81 RQCASGLQAVILAAQLIRAGEADVVVAGGVESMSRVPygVPRSLRWGVKPGNAELEDARLKD-LTDANTGLPMGVTAENL 159
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970    162 AKQWQLSRDEQDAFAVASQNKAEAAQKDGRFKDEIVPFIVKGRKGDITVDADEYIRHGATLDSMAKLRPAFDKEGTVTAG 241
Cdd:TIGR01930 160 AKKYGISREEQDEYALRSHQRAAKAWEEGLFKDEIVPVTVKGRKGPVTVSSDEGIRPNTTLEKLAKLKPAFDPDGTVTAG 239
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970    242 NASGLNDGAAAALLMSEAEASRRGIQPLGRIVSWATVGVDPKVMGTGPIPASRKALERAGWKIGDLDLVEANEAFAAQAC 321
Cdd:TIGR01930 240 NSSPLNDGAAALLLMSEEKAKELGLTPLARIVSFAVAGVDPEIMGLGPVPAIPKALKKAGLSISDIDLFEINEAFAAQVL 319
                         330       340       350       360       370       380
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 7766970    322 AVNKDLGWDPSIVNVNGGAIAIGHPIGASGARILNTLLFEMKRRGARKGLATLCIGGGMGVAMCIE 387
Cdd:TIGR01930 320 ACIKELGLDLEKVNVNGGAIALGHPLGASGARIVTTLLHELKRRGGRYGLATMCIGGGQGAAVILE 385
nondecarbox_cond_enzymes cd00826
nondecarboxylating condensing enzymes; In general, thiolases catalyze the reversible thiolytic ...
5-388 1.17e-173

nondecarboxylating condensing enzymes; In general, thiolases catalyze the reversible thiolytic cleavage of 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA, a 2-step reaction involving a covalent intermediate formed with a catalytic cysteine. There are 2 functional different classes: thiolase-I (3-ketoacyl-CoA thiolase) and thiolase-II (acetoacetyl-CoA thiolase). Thiolase-I can cleave longer fatty acid molecules and plays an important role in the beta-oxidative degradation of fatty acids. Thiolase-II has a high substrate specificity. Although it can cleave acetoacyl-CoA, its main function is the synthesis of acetoacyl-CoA from two molecules of acetyl-CoA, which gives it importance in several biosynthetic pathways.


Pssm-ID: 238422 [Multi-domain]  Cd Length: 393  Bit Score: 489.31  E-value: 1.17e-173
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970    5 ASAARTAVGSF---NGAFANTPAHELGATVISAVLERAGVAAGEVNEVILGQVLPAGEGQNPARQAAMKAGVPQEATAWG 81
Cdd:cd00826   1 AGAAMTAFGKFggeNGADANDLAHEAGAKAIAAALEPAGVAAGAVEEACLGQVLGAGEGQNCAQQAAMHAGGLQEAPAIG 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   82 MNQLCGSGLRAVALGMQQIATGDASIIVAGGMESMSmaphcahlrggvkmgdfkmidtmikdgltdafygyhmgTTAENV 161
Cdd:cd00826  81 MNNLCGSGLRALALAMQLIAGGDANCILAGGFEKME--------------------------------------TSAENN 122
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970  162 AKQWQL--------SRDEQDAFAVASQNKAEAAQKDGRFKDEIVPFIVKGRKGDITVDADEYIRHG--ATLDSMAKLRPA 231
Cdd:cd00826 123 AKEKHIdvlinkygMRACPDAFALAGQAGAEAAEKDGRFKDEFAKFGVKGRKGDIHSDADEYIQFGdeASLDEIAKLRPA 202
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970  232 FDKEGTVTAGNASGLNDGAAAALLMSEAEAS-------RRGIQPLGRIVSWATVGVDPK----VMGTGPIPASRKALERA 300
Cdd:cd00826 203 FDKEDFLTAGNACGLNDGAAAAILMSEAEAQkhglqskAREIQALEMITDMASTFEDKKvikmVGGDGPIEAARKALEKA 282
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970  301 GWKIGDLDLVEANEAFAAQACAVNKDLGWDP------------------SIVNVNGGAIAIGHPIGASGARILNTLLFEM 362
Cdd:cd00826 283 GLGIGDLDLIEAHDAFAANACATNEALGLCPegqggalvdrgdntyggkSIINPNGGAIAIGHPIGASGAAICAELCFEL 362
                       410       420       430
                ....*....|....*....|....*....|.
gi 7766970  363 KRR-----GARKGLATLCIGGGMGVAMCIES 388
Cdd:cd00826 363 KGEagkrqGAGAGLALLCIGGGGGAAMCIES 393
PRK09051 PRK09051
beta-ketothiolase; Provisional
2-389 5.30e-170

beta-ketothiolase; Provisional


Pssm-ID: 181625  Cd Length: 394  Bit Score: 480.23  E-value: 5.30e-170
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970     2 IVIASAARTAVGSFNGAFANTPAHELGATVISAVLERAGVAAGEVNEVILGQVLPAgEGQNP--ARQAAMKAGVPQEATA 79
Cdd:PRK09051   5 VVVVSGVRTAIGTFGGSLKDVAPTDLGATVVREALARAGVDPDQVGHVVFGHVIPT-EPRDMylSRVAAINAGVPQETPA 83
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970    80 WGMNQLCGSGLRAVALGMQQIATGDASIIVAGGMESMSMAPHCA-HLRGGVKMGDFKMIDTMIKdGLTDAFYGYHMGTTA 158
Cdd:PRK09051  84 FNVNRLCGSGLQAIVSAAQAILLGDADVAIGGGAESMSRAPYLLpAARWGARMGDAKLVDMMVG-ALHDPFGTIHMGVTA 162
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   159 ENVAKQWQLSRDEQDAFAVASQNKAEAAQKDGRFKDEIVPFIVKGRKGDITVDADEYIRHGATLDSMAKLRPAFDKE-GT 237
Cdd:PRK09051 163 ENVAAKYGISREAQDALALESHRRAAAAIAAGYFKDQIVPVEIKTRKGEVVFDTDEHVRADTTLEDLAKLKPVFKKEnGT 242
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   238 VTAGNASGLNDGAAAALLMSEAEASRRGIQPLGRIVSWATVGVDPKVMGTGPIPASRKALERAGWKIGDLDLVEANEAFA 317
Cdd:PRK09051 243 VTAGNASGINDGAAAVVLAEADAAEARGLKPLARLVGYAHAGVDPEYMGIGPVPATQKALERAGLTVADLDVIEANEAFA 322
                        330       340       350       360       370       380       390
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 7766970   318 AQACAVNKDLGWDPSIVNVNGGAIAIGHPIGASGARILNTLLFEMKRRGARKGLATLCIGGGMGVAMCIESL 389
Cdd:PRK09051 323 AQACAVTRELGLDPAKVNPNGSGISLGHPVGATGAIITVKALYELQRIGGRYALVTMCIGGGQGIAAIFERL 394
PRK05656 PRK05656
acetyl-CoA acetyltransferase; Provisional
2-387 3.90e-167

acetyl-CoA acetyltransferase; Provisional


Pssm-ID: 168156  Cd Length: 393  Bit Score: 472.84  E-value: 3.90e-167
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970     2 IVIASAARTAVGSFNGAFANTPAHELGATVISAVLERAGVAAGEVNEVILGQVLPAGEGQNPARQAAMKAGVPQEATAWG 81
Cdd:PRK05656   4 VVIVAATRTAIGSFQGSLANIPAVELGAAVIRRLLEQTGLDPAQVDEVILGQVLTAGAGQNPARQAAIKAGLPHSVPAMT 83
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970    82 MNQLCGSGLRAVALGMQQIATGDASIIVAGGMESMSMAPHC-AHLRGGVKMGDFKMIDTMIKDGLTDAFYGYHMGTTAEN 160
Cdd:PRK05656  84 LNKVCGSGLKALHLAAQAIRCGDAEVIIAGGQENMSLAPYVlPGARTGLRMGHAQLVDSMITDGLWDAFNDYHMGITAEN 163
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   161 VAKQWQLSRDEQDAFAVASQNKAEAAQKDGRFKDEIVPFIVKGRKGD-ITVDADEYIRHGATLDSMAKLRPAFDKEGTVT 239
Cdd:PRK05656 164 LVEKYGISREAQDAFAAASQQKAVAAIEAGRFDDEITPILIPQRKGEpLAFATDEQPRAGTTAESLAKLKPAFKKDGSVT 243
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   240 AGNASGLNDGAAAALLMSEAEASRRGIQPLGRIVSWATVGVDPKVMGTGPIPASRKALERAGWKIGDLDLVEANEAFAAQ 319
Cdd:PRK05656 244 AGNASSLNDGAAAVLLMSAAKAKALGLPVLAKIAAYANAGVDPAIMGIGPVSATRRCLDKAGWSLAELDLIEANEAFAAQ 323
                        330       340       350       360       370       380
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 7766970   320 ACAVNKDLGWDPSIVNVNGGAIAIGHPIGASGARILNTLLFEMKRRGARKGLATLCIGGGMGVAMCIE 387
Cdd:PRK05656 324 SLAVGKELGWDAAKVNVNGGAIALGHPIGASGCRVLVTLLHEMIRRDAKKGLATLCIGGGQGVALAIE 391
PRK06633 PRK06633
acetyl-CoA acetyltransferase; Provisional
2-389 1.75e-164

acetyl-CoA acetyltransferase; Provisional


Pssm-ID: 168632  Cd Length: 392  Bit Score: 466.04  E-value: 1.75e-164
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970     2 IVIASAARTAVGSFNGAFANTPAHELGATVISAVLERAGVAAGEVNEVILGQVLPAGEGQNPARQAAMKAGVPQEATAWG 81
Cdd:PRK06633   5 VYITHAKRTAFGSFMGSLSTTPAPMLAAHLIKDILQNSKIDPALVNEVILGQVITGGSGQNPARQTLIHAGIPKEVPGYT 84
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970    82 MNQLCGSGLRAVALGMQQIATGDASIIVAGGMESMSMAPHCAHLRGGVKMGDFKMIDTMIKDGLTDAFYGYHMGTTAENV 161
Cdd:PRK06633  85 INKVCGSGLKSVALAANSIMTGDNEIVIAGGQENMSLGMHGSYIRAGAKFGDIKMVDLMQYDGLTDVFSGVFMGITAENI 164
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   162 AKQWQLSRDEQDAFAVASQNKAEAAQKDGRFKDEIVPFIVKGRKGDITVDADEYIRHGATLDSMAKLRPAFDKEGTVTAG 241
Cdd:PRK06633 165 SKQFNISRQEQDEFALSSHKKAAKAQLAGIFKDEILPIEVTIKKTTSLFDHDETVRPDTSLEILSKLRPAFDKNGVVTAG 244
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   242 NASGLNDGAAAALLMSEAEASRRGIQPLGRIVSWATVGVDPKVMGTGPIPASRKALERAGWKIGDLDLVEANEAFAAQAC 321
Cdd:PRK06633 245 NASSINDGAACLMVVSEEALKKHNLTPLARIVSYASAGVDPSIMGTAPVPASQKALSKAGWSVNDLEVIEVNEAFAAQSI 324
                        330       340       350       360       370       380
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 7766970   322 AVNKDLGWDPSIVNVNGGAIAIGHPIGASGARILNTLLFEMKRRGARKGLATLCIGGGMGVAMCIESL 389
Cdd:PRK06633 325 YVNREMKWDMEKVNINGGAIAIGHPIGASGGRVLITLIHGLRRAKAKKGLVTLCIGGGMGMAMCVEAV 392
PRK08235 PRK08235
acetyl-CoA acetyltransferase; Provisional
3-387 4.27e-150

acetyl-CoA acetyltransferase; Provisional


Pssm-ID: 181311  Cd Length: 393  Bit Score: 429.52  E-value: 4.27e-150
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970     3 VIASAARTAVGSFNGAFANTPAHELGATVISAVLERAGVAAGEVNEVILGQVLPAGEGQNPARQAAMKAGVPQEATAWGM 82
Cdd:PRK08235   5 VIVSAARTPFGKFGGSLKDVKATELGGIAIKEALERANVSAEDVEEVIMGTVLQGGQGQIPSRQAARAAGIPWEVQTETV 84
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970    83 NQLCGSGLRAVALGMQQIATGDASIIVAGGMESMSMAPH-CAHLRGGVKMGDFKMIDTMIKDGLTDAFYGYHMGTTAENV 161
Cdd:PRK08235  85 NKVCASGLRAVTLADQIIRAGDASVIVAGGMESMSNAPYiLPGARWGYRMGDNEVIDLMVADGLTCAFSGVHMGVYGGEV 164
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   162 AKQWQLSRDEQDAFAVASQNKAEAAQKDGRFKDEIVPFIVKGRKGD-ITVDADEYIRHGATLDSMAKLRPAFDKEGTVTA 240
Cdd:PRK08235 165 AKELGISREAQDEWAYRSHQRAVSAHEEGRFEEEIVPVTIPQRKGDpIVVAKDEAPRKDTTIEKLAKLKPVFDKTGTITA 244
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   241 GNASGLNDGAAAALLMSEAEASRRGIQPLGRIVSWATVGVDPKVMGTGPIPASRKALERAGWKIGDLDLVEANEAFAAQA 320
Cdd:PRK08235 245 GNAPGVNDGAAALVLMSEDRAKQEGRKPLATILAHTAIAVEAKDFPRTPGYAINALLEKTGKTVEDIDLFEINEAFAAVA 324
                        330       340       350       360       370       380
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 7766970   321 CAVNKDLGWDPSIVNVNGGAIAIGHPIGASGARILNTLLFEMKRRGARKGLATLCIGGGMGVAMCIE 387
Cdd:PRK08235 325 LASTEIAGIDPEKVNVNGGAVALGHPIGASGARIIVTLIHELKRRGGGIGIAAICSGGGQGDAVLIE 391
PRK06205 PRK06205
acetyl-CoA acetyltransferase; Provisional
2-387 1.25e-144

acetyl-CoA acetyltransferase; Provisional


Pssm-ID: 235741  Cd Length: 404  Bit Score: 415.93  E-value: 1.25e-144
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970     2 IVIASAARTAVGSFNGAFANTPAHELGATVISAVLERAGVAAGEVNEVILGQVLPAGEGQNPARQAAMKAGVPQEATAWG 81
Cdd:PRK06205   4 AVICEPVRTPVGRFGGAFKDVPAEELAATVIRALVERTGIDPARIDDVIFGQGYPNGEAPAIGRVAALDAGLPVTVPGMQ 83
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970    82 MNQLCGSGLRAVALGMQQIATGDASIIVAGGMESMSMAPHCAH-LRGGVKMGDFKMIDTMIKDGLTD--AFYGY--HMGT 156
Cdd:PRK06205  84 LDRRCGSGLQAVITAAMQVQTGAADVVIAGGAESMSNVEFYTTdMRWGVRGGGVQLHDRLARGRETAggRRFPVpgGMIE 163
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   157 TAENVAKQWQLSRDEQDAFAVASQNKAEAAQKDGRFKDEIVPFIVKGRKGD-ITVDADEYIRHGATLDSMAKLRP---AF 232
Cdd:PRK06205 164 TAENLRREYGISREEQDALAVRSHQRAVAAQEAGRFDDEIVPVTVPQRKGDpTVVDRDEHPRADTTLESLAKLRPimgKQ 243
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   233 DKEGTVTAGNASGLNDGAAAALLMSEAEASRRGIQPLGRIVSWATVGVDPKVMGTGPIPASRKALERAGWKIGDLDLVEA 312
Cdd:PRK06205 244 DPEATVTAGNASGQNDAAAACLVTTEDKAEELGLRPLARLVSWAVAGVEPSRMGIGPVPATEKALARAGLTLDDIDLIEL 323
                        330       340       350       360       370       380       390
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 7766970   313 NEAFAAQACAVNKDLGW---DPSIVNVNGGAIAIGHPIGASGARILNTLLFEMKRRGARKGLATLCIGGGMGVAMCIE 387
Cdd:PRK06205 324 NEAFAAQVLAVLKEWGFgadDEERLNVNGSGISLGHPVGATGGRILATLLRELQRRQARYGLETMCIGGGQGLAAVFE 401
Thiolase_N pfam00108
Thiolase, N-terminal domain; Thiolase is reported to be structurally related to beta-ketoacyl ...
2-259 2.38e-133

Thiolase, N-terminal domain; Thiolase is reported to be structurally related to beta-ketoacyl synthase (pfam00109), and also chalcone synthase.


Pssm-ID: 333844 [Multi-domain]  Cd Length: 260  Bit Score: 382.04  E-value: 2.38e-133
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970      2 IVIASAARTAVGSFNGAFANTPAHELGATVISAVLERAGVAAGEVNEVILGQVLPAGEGQNPARQAAMKAGVPQEATAWG 81
Cdd:pfam00108   1 VVIVSAARTPFGSFGGSLKDVSAVELGAEAIKAALERAGVDPEDVDEVIVGNVLQAGEGQNPARQAALKAGIPDSAPAVT 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970     82 MNQLCGSGLRAVALGMQQIATGDASIIVAGGMESMSMAPHCA--HLRGGVKMGDFKMIDTMIKDGLTDAFYGYHMGTTAE 159
Cdd:pfam00108  81 INKVCGSGLKAVYLAAQSIASGDADVVVAGGVESMSHAPYALptDARSGLKHGDEKKHDLLIPDGLTDAFNGYHMGITAE 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970    160 NVAKQWQLSRDEQDAFAVASQNKAEAAQKDGRFKDEIVPFIVKGRKGDITVDADEYIRHGATLDSMAKLRPAFDKEGTVT 239
Cdd:pfam00108 161 NVAKKYGISREEQDEFAVKSHQKAAAAQKAGKFKDEIVPVTVKGRKGKPTVDTDEGIRPPTTAEPLAKLKPAFDKEGTVT 240
                         250       260
                  ....*....|....*....|
gi 7766970    240 AGNASGLNDGAAAALLMSEA 259
Cdd:pfam00108 241 AGNASGINDGAAALLLMSES 260
PaaJ COG0183
Acetyl-CoA acetyltransferase [Lipid transport and metabolism];
2-387 2.34e-131

Acetyl-CoA acetyltransferase [Lipid transport and metabolism];


Pssm-ID: 223261 [Multi-domain]  Cd Length: 392  Bit Score: 382.03  E-value: 2.34e-131
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970    2 IVIASAARTAVGSFN-GAFANTPAHELGATVISAVLER--AGVAAGEVNEVILGQVLPAGE-GQNPARQAAMKAGVPQEA 77
Cdd:COG0183   4 VAIVGAGRTPFGKFGdGSLAELAAEALGAALIDAGLERapADVDAADVDDVILGCVLQAGEqGQNIARQAALAAGLPGSV 83
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   78 TAWGMNQLCGSGLRAVALGMQQIATGDASIIVAGGMESMSMAPhcaHLRGGVKMGDFkMIDTMIKDGLTDAFYGYHMGTT 157
Cdd:COG0183  84 PAVTVNRACASGLAAVRLAAQAIASGEADVVLAGGVEKMSDAP---MGREGVRVLDS-AVDPMFEDPLGDATPGYLMGLT 159
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970  158 AENVAKQWQLSRDEQDAFAVASQNKAEAAQKDGRFkDEIVPFIVKGRkgdiTVDADEYIRH--GATLDSMAKLRPAFDKE 235
Cdd:COG0183 160 AERYAKRYGISREDQDEVAVKSHKNAAANPKAGFF-DEITPEDVLNS----PVVADPLRRLdcSPTSDGAAALVPAFEEV 234
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970  236 -GTVTAGNASGLNDGAAAALLMSEAEASRRGIQPLGRIVSWATVGVDPKVMgTGPIPASRKALERAGWK-IGDLDLVEAN 313
Cdd:COG0183 235 gGTVTAGNASGINDGAAALLLMSESKAKELGLAPLAAIRAYAMAGVDPSIM-DGPVAAVHDALTIAGLLaLEDLGLAEKG 313
                       330       340       350       360       370       380       390
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 7766970  314 EAFAAQACAVNKDLGWDPsiVNVNGGAIAIGHPIGASGARILNTLLFEMKRRG----ARKGLATLCIGGG-MGVAMCIE 387
Cdd:COG0183 314 EAFAAVALGVTKILGDLP--VNPSGGAIALGHPIGATGARILVELARQLRGRGqvvaKRRGLATLCIGGGgQGVAAVLE 390
PRK09050 PRK09050
beta-ketoadipyl CoA thiolase; Validated
4-387 1.32e-130

beta-ketoadipyl CoA thiolase; Validated


Pssm-ID: 181624  Cd Length: 401  Bit Score: 380.45  E-value: 1.32e-130
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970     4 IASAARTAVGSFNGAFANTPAHELGATVISAVLER-AGVAAGEVNEVILGQVLPAGE-GQNPARQAAMKAGVPQEATAWG 81
Cdd:PRK09050   6 ICDAIRTPIGRYGGALSSVRADDLGAVPLKALMARnPGVDWEAVDDVIYGCANQAGEdNRNVARMSALLAGLPVSVPGTT 85
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970    82 MNQLCGSGLRAVALGMQQIATGDASIIVAGGMESMSMAPHCahlrggvkMG--------DFKMIDTMIK----DGLTDAF 149
Cdd:PRK09050  86 INRLCGSGMDAVGTAARAIKAGEAELMIAGGVESMSRAPFV--------MGkadsafsrQAEIFDTTIGwrfvNPLMKAQ 157
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   150 YGYH-MGTTAENVAKQWQLSRDEQDAFAVASQNKAEAAQKDGRFKDEIVPFIVKGRKGD-ITVDADEYIRHGATLDSMAK 227
Cdd:PRK09050 158 YGVDsMPETAENVAEDYNISRADQDAFALRSQQRAAAAQAAGFLAEEIVPVTIPQKKGDpVVVDRDEHPRPETTLEALAK 237
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   228 LRPAFDKEGTVTAGNASGLNDGAAAALLMSEAEASRRGIQPLGRIVSWATVGVDPKVMGTGPIPASRKALERAGWKIGDL 307
Cdd:PRK09050 238 LKPVFRPDGTVTAGNASGVNDGAAALLLASEAAAKKHGLTPRARILGMATAGVEPRIMGIGPAPATRKLLARLGLTIDQF 317
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   308 DLVEANEAFAAQACAVNKDLGW--DPSIVNVNGGAIAIGHPIGASGARILNTLLFEMKRRGARKGLATLCIGGGMGVAMC 385
Cdd:PRK09050 318 DVIELNEAFAAQGLAVLRQLGLadDDARVNPNGGAIALGHPLGMSGARLVLTALHQLERTGGRYALCTMCIGVGQGIALA 397

                 ..
gi 7766970   386 IE 387
Cdd:PRK09050 398 IE 399
PLN02644 PLN02644
acetyl-CoA C-acetyltransferase
2-389 1.15e-125

acetyl-CoA C-acetyltransferase


Pssm-ID: 215347 [Multi-domain]  Cd Length: 394  Bit Score: 367.50  E-value: 1.15e-125
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970     2 IVIASAARTAVGSFNGAFANTPAHELGATVISAVLERAGVAAGEVNEVILGQVLPAGEGQNPARQAAMKAGVPQEATAWG 81
Cdd:PLN02644   3 VCIVGVARTPIGGFLGSLSSLSATELGSIAIQAALERAGVDPALVQEVFFGNVLSANLGQAPARQAALGAGLPPSTICTT 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970    82 MNQLCGSGLRAVALGMQQIATGDASIIVAGGMESMSMAPH-CAHLRGGVKMGDFKMIDTMIKDGLTDAFYGYHMGTTAEN 160
Cdd:PLN02644  83 VNKVCASGMKAVMLAAQSIQLGINDVVVAGGMESMSNAPKyLPEARKGSRLGHDTVVDGMLKDGLWDVYNDFGMGVCAEL 162
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   161 VAKQWQLSRDEQDAFAVASQNKAEAAQKDGRFKDEIVPFIVKGRKGD--ITVDADEYIRHgATLDSMAKLRPAFDKE-GT 237
Cdd:PLN02644 163 CADQYSISREEQDAYAIQSYERAIAAQEAGAFAWEIVPVEVPGGRGRpsVIVDKDEGLGK-FDPAKLRKLRPSFKEDgGS 241
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   238 VTAGNASGLNDGAAAALLMSEAEASRRGIQPLGRIVSWATVGVDPKVMGTGPIPASRKALERAGWKIGDLDLVEANEAFA 317
Cdd:PLN02644 242 VTAGNASSISDGAAALVLVSGEKALELGLQVIAKIRGYADAAQAPELFTTAPALAIPKALKHAGLEASQVDYYEINEAFS 321
                        330       340       350       360       370       380       390
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 7766970   318 AQACAVNKDLGWDPSIVNVNGGAIAIGHPIGASGARILNTLLFEMKRRGARKGLATLCIGGGMGVAMCIESL 389
Cdd:PLN02644 322 VVALANQKLLGLDPEKVNVHGGAVSLGHPIGCSGARILVTLLGVLRSKNGKYGVAGICNGGGGASAIVVELM 393
PRK06954 PRK06954
acetyl-CoA acetyltransferase; Provisional
2-387 6.24e-121

acetyl-CoA acetyltransferase; Provisional


Pssm-ID: 180775  Cd Length: 397  Bit Score: 355.74  E-value: 6.24e-121
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970     2 IVIASAARTAVGSFNGAFANTPAHELGATVISAVLERAGVAAGEVNEVILGQVLPAGEGQNPARQAAMKAGVPQEATAWG 81
Cdd:PRK06954   9 IVIASAARTPMAAFQGEFASLTAPQLGAAAIAAAVERAGLKPEQIDEVVMGCVLPAGQGQAPARQAALGAGLPLSVGCTT 88
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970    82 MNQLCGSGLRAVALGMQQIATGDASIIVAGGMESMSMAPH-CAHLRGGVKMGDFKMIDTMIKDGLTDAF-YGYHMGTTAE 159
Cdd:PRK06954  89 VNKMCGSGMRAAMFAHDMLVAGSVDVIVAGGMESMTNAPYlLPKARGGMRMGHGQVLDHMFLDGLEDAYdKGRLMGTFAE 168
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   160 NVAKQWQLSRDEQDAFAVASQNKAEAAQKDGRFKDEIVPFIVKGRKGDITVDADEYIRHgATLDSMAKLRPAFDKEGTVT 239
Cdd:PRK06954 169 ECAGEYGFTREAQDAFAIESLARAKRANEDGSFAWEIAPVTVAGKKGDTVIDRDEQPFK-ANPEKIPTLKPAFSKTGTVT 247
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   240 AGNASGLNDGAAAALLMSEAEASRRGIQPLGRIVSWATVGVDPKVMGTGPIPASRKALERAGWKIGDLDLVEANEAFAAQ 319
Cdd:PRK06954 248 AANSSSISDGAAALVMMRASTAKRLGLAPLARVVGHSTFAQAPSKFTTAPVGAIRKLFEKNGWRAAEVDLFEINEAFAVV 327
                        330       340       350       360       370       380
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 7766970   320 ACAVNKDLGWDPSIVNVNGGAIAIGHPIGASGARILNTLLFEMKRRGARKGLATLCIGGGMGVAMCIE 387
Cdd:PRK06954 328 TMAAMKEHGLPHEKVNVNGGACALGHPIGASGARILVTLIGALRARGGKRGVASLCIGGGEATAMGIE 395
PRK07661 PRK07661
acetyl-CoA acetyltransferase; Provisional
3-389 3.27e-119

acetyl-CoA acetyltransferase; Provisional


Pssm-ID: 181072  Cd Length: 391  Bit Score: 350.97  E-value: 3.27e-119
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970     3 VIASAARTAVGSFN-GAFANTPAHELGATVISAVLERAGVAAGEVNEVILGQVLPAGE-GQNPARQAAMKAGVPQEATAW 80
Cdd:PRK07661   5 VIVAGARTPVGKAKkGSLKTVRPDDLGALVVKETLKRAGNYEGPIDDLIIGCAMPEAEqGLNMARNIGALAGLPYTVPAI 84
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970    81 GMNQLCGSGLRAVALGMQQIATGDASIIVAGGMESMSMAPHCAHlrggVKMGDFKMIDTMIKdgltdafYGYHMGTTAEN 160
Cdd:PRK07661  85 TINRYCSSGLQSIAYGAERIMLGHSEAVIAGGAESMSLVPMMGH----VVRPNPRLVEAAPE-------YYMGMGHTAEQ 153
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   161 VAKQWQLSRDEQDAFAVASQNKAEAAQKDGRFKDEIVPFIVKGRKGD---------ITVDADEYIRHGATLDSMAKLRPA 231
Cdd:PRK07661 154 VAVKYGISREDQDAFAVRSHQRAAKALAEGKFADEIVPVDVTLRTVGennklqeetITFSQDEGVRADTTLEILGKLRPA 233
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   232 FDKEGTVTAGNASGLNDGAAAALLMSEAEASRRGIQPLGRIVSWATVGVDPKVMGTGPIPASRKALERAGWKIGDLDLVE 311
Cdd:PRK07661 234 FNVKGSVTAGNSSQMSDGAAAVLLMDREKAESDGLKPLAKFRSFAVAGVPPEVMGIGPIAAIPKALKLAGLELSDIGLFE 313
                        330       340       350       360       370       380       390
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 7766970   312 ANEAFAAQACAVNKDLGWDPSIVNVNGGAIAIGHPIGASGARILNTLLFEMKRRGARKGLATLCIGGGMGVAMCIESL 389
Cdd:PRK07661 314 LNEAFASQSIQVIRELGLDEEKVNVNGGAIALGHPLGCTGAKLTLSLIHEMKRRNEQFGIVTMCIGGGMGAAGVFELL 391
fadA PRK08947
3-ketoacyl-CoA thiolase; Reviewed
2-387 5.95e-118

3-ketoacyl-CoA thiolase; Reviewed


Pssm-ID: 181592  Cd Length: 387  Bit Score: 347.72  E-value: 5.95e-118
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970     2 IVIASAARTAVG-SFNGAFANTPAHELGATVISAVLER-AGVAAGEVNEVILGQVLPAGE-GQNPARQAAMKAGVPQEAT 78
Cdd:PRK08947   4 VVIVDAIRTPMGrSKGGAFRNVRAEDLSAHLMRSLLARnPALDPAEIDDIIWGCVQQTLEqGFNIARNAALLAGIPHSVP 83
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970    79 AWGMNQLCGSGLRAVALGMQQIATGDASIIVAGGMESMsmaphcahlrGGVKMGdfKMIDTMIKDGLTDAFYGYHMGTTA 158
Cdd:PRK08947  84 AVTVNRLCGSSMQALHDAARAIMTGDGDVFLIGGVEHM----------GHVPMN--HGVDFHPGLSKNVAKAAGMMGLTA 151
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   159 ENVAKQWQLSRDEQDAFAVASQNKAEAAQKDGRFKDEIVPfiVKGRKGD---ITVDADEYIRHGATLDSMAKLRPAFD-K 234
Cdd:PRK08947 152 EMLGKMHGISREQQDAFAARSHQRAWAATQEGRFKNEIIP--TEGHDADgvlKLFDYDEVIRPETTVEALAALRPAFDpV 229
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   235 EGTVTAGNASGLNDGAAAALLMSEAEASRRGIQPLGRIVSWATVGVDPKVMGTGPIPASRKALERAGWKIGDLDLVEANE 314
Cdd:PRK08947 230 NGTVTAGTSSALSDGASAMLVMSESRAKELGLKPRARIRSMAVAGCDPSIMGYGPVPATQKALKRAGLSISDIDVFELNE 309
                        330       340       350       360       370       380       390
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 7766970   315 AFAAQACAVNKDLGWDPSI---VNVNGGAIAIGHPIGASGARILNTLLFEMKRRGARKGLATLCIGGGMGVAMCIE 387
Cdd:PRK08947 310 AFAAQSLPCLKDLGLLDKMdekVNLNGGAIALGHPLGCSGARISTTLLNLMERKDAQFGLATMCIGLGQGIATVFE 385
pcaF TIGR02430
3-oxoadipyl-CoA thiolase; Members of this family are designated beta-ketoadipyl CoA thiolase, ...
4-389 7.98e-118

3-oxoadipyl-CoA thiolase; Members of this family are designated beta-ketoadipyl CoA thiolase, an enzyme that acts at the end of pathways for the degradation of protocatechuate (from benzoate and related compounds) and of phenylacetic acid.


Pssm-ID: 131483  Cd Length: 400  Bit Score: 347.93  E-value: 7.98e-118
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970      4 IASAARTAVGSFNGAFANTPAHELGATVISAVLER-AGVAAGEVNEVILGQVLPAGE-GQNPARQAAMKAGVPQEATAWG 81
Cdd:TIGR02430   5 ICDAIRTPIGRYGGSLSSVRADDLAAVPIKALLARnPQLDWAAIDDVIYGCANQAGEdNRNVARMAALLAGLPVSVPGTT 84
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970     82 MNQLCGSGLRAVALGMQQIATGDASIIVAGGMESMSMAPHCAHLRGGVKMGDFKMIDTMIK----DGLTDAFYGYH-MGT 156
Cdd:TIGR02430  85 VNRLCGSGLDAIGMAARAIKAGEADLLIAGGVESMSRAPFVMGKADSAFSRSAKIEDTTIGwrfiNPLMKALYGVDsMPE 164
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970    157 TAENVAKQWQLSRDEQDAFAVASQNKAEAAQKDGRFKDEIVPFIVKGRKGDIT-VDADEYIRHGATLDSMAKLRPAFDKE 235
Cdd:TIGR02430 165 TAENVAEEFGISREDQDAFALRSQQRTAAAQASGFFAEEIVPVVIPQKKGEPTvVDQDEHPRPETTLEGLAKLKPVVRPD 244
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970    236 GTVTAGNASGLNDGAAAALLMSEAEASRRGIQPLGRIVSWATVGVDPKVMGTGPIPASRKALERAGWKIGDLDLVEANEA 315
Cdd:TIGR02430 245 GTVTAGNASGVNDGAAALLLASEEAVQRHGLTPRARILAAATAGVEPRIMGIGPVPATQKLLARAGLSIDQFDVIELNEA 324
                         330       340       350       360       370       380       390
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 7766970    316 FAAQACAVNKDLGW--DPSIVNVNGGAIAIGHPIGASGARILNTLLFEMKRRGARKGLATLCIGGGMGVAMCIESL 389
Cdd:TIGR02430 325 FAAQALAVLRELGLadDDARVNPNGGAIALGHPLGASGARLVLTALRQLERSGGRYALCTMCIGVGQGIALAIERV 400
PRK09052 PRK09052
acetyl-CoA acetyltransferase; Provisional
4-389 5.17e-116

acetyl-CoA acetyltransferase; Provisional


Pssm-ID: 181626  Cd Length: 399  Bit Score: 343.14  E-value: 5.17e-116
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970     4 IASAARTAVG-SFNGAFANTPAHELGATVISAVLERA-GVAAGEVNEVILGQVLPAGE-GQNPARQAAMKAGVPQEATAW 80
Cdd:PRK09052  10 IVAATRTPVGkAPRGMFKNTRPDDLLAHVLRSAVAQVpGLDPKLIEDAIVGCAMPEAEqGLNVARIGALLAGLPNSVGGV 89
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970    81 GMNQLCGSGLRAVALGMQQIATGDASIIVAGGMESMSMAPhcahlrggvKMGDFKMIDTMIKDGLTDAFYGYHMGTTAEN 160
Cdd:PRK09052  90 TVNRFCASGLQAVAMAADRIRVGEADVMIAAGVESMSMVP---------MMGNKPSMSPAIFARDENVGIAYGMGLTAEK 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   161 VAKQWQLSRDEQDAFAVASQNKAEAAQKDGRFKDEIVPFIVKGRKGDI----------TVDADEYIRHGATLDSMAKLRP 230
Cdd:PRK09052 161 VAEQWKVSREDQDAFALESHQKAIAAQQAGEFKDEITPYEITERFPDLatgevdvktrTVDLDEGPRADTSLEGLAKLKP 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   231 AFDKEGTVTAGNASGLNDGAAAALLMSEAEASRRGIQPLGRIVSWATVGVDPKVMGTGPIPASRKALERAGWKIGDLDLV 310
Cdd:PRK09052 241 VFANKGSVTAGNSSQTSDGAGAVILVSEKALKQFNLTPLARFVSFAVAGVPPEIMGIGPIEAIPAALKQAGLKQDDLDWI 320
                        330       340       350       360       370       380       390
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 7766970   311 EANEAFAAQACAVNKDLGWDPSIVNVNGGAIAIGHPIGASGARILNTLLFEMKRRGARKGLATLCIGGGMGVAMCIESL 389
Cdd:PRK09052 321 ELNEAFAAQSLAVIRDLGLDPSKVNPLGGAIALGHPLGATGAIRTATVVHGLRRTNLKYGMVTMCVGTGMGAAGIFERL 399
PRK06445 PRK06445
acetyl-CoA acetyltransferase; Provisional
2-387 5.31e-116

acetyl-CoA acetyltransferase; Provisional


Pssm-ID: 180563 [Multi-domain]  Cd Length: 394  Bit Score: 342.86  E-value: 5.31e-116
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970     2 IVIASAARTAVGSFN------GAFANTPAHELGATVISAVLERAGVAAGEVNEVILGQVLPAGEGQN-PARQAAMKAGVP 74
Cdd:PRK06445   4 VYLVDFARTAFSRFRpkdpqkDVFNNIRPEELAAMLINRLIEKTGIKPEEIDDIITGCALQVGENWLyGGRHPIFLARLP 83
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970    75 QEATAWGMNQLCGSGLRAVALGMQQIATGDASIIVAGGMESMSMAPhcahlrggvkMGDFKMIDTMIKdGLTDAFY---- 150
Cdd:PRK06445  84 YNIPAMAVDRQCASSLTTVSIGAMEIATGMADIVIAGGVEHMTRTP----------MGDNPHIEPNPK-LLTDPKYieyd 152
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   151 ---GYHMGTTAENVAKQWQLSRDEQDAFAVASQNKAEAAQKDGRFKDEIVPFIVKGRKGDITVDADEYIRHGATLDSMAK 227
Cdd:PRK06445 153 lttGYVMGLTAEKLAEEAGIKREEMDRWSLRSHQLAAKAIQEGYFKDEILPIEVEVEGKKKVVDVDQSVRPDTSLEKLAK 232
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   228 LRPAFDKEGTVTAGNASGLNDGAAAALLMSEAEASRRGIQPLGRIVSWATVGVDPKVMGTGPIPASRKALERAGWKIGDL 307
Cdd:PRK06445 233 LPPAFKPDGVITAGNSSPLNSGASYVLLMSKKAVKKYGLKPMAKIRSFGFAGVPPAIMGKGPVPASKKALEKAGLSVKDI 312
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   308 DLVEANEAFAAQACAVNKDLGWDPSIVNVNGGAIAIGHPIGASGARILNTLLFEMKRRGARKGLATLCIGGGMGVAMCIE 387
Cdd:PRK06445 313 DLWEINEAFAVVVLYAIKELGLDPETVNIKGGAIAIGHPLGATGARIVGTLARQLQIKGKDYGVATLCVGGGQGGAVVLE 392
PLN02287 PLN02287
3-ketoacyl-CoA thiolase
2-387 1.13e-115

3-ketoacyl-CoA thiolase


Pssm-ID: 215161  Cd Length: 452  Bit Score: 344.06  E-value: 1.13e-115
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970     2 IVIASAARTAV-GSFNGAFANTPAHELGATVISAVLERAGVAAGEVNEVILGQVL-PAGEGQNPARQAAMKAGVPQEATA 79
Cdd:PLN02287  48 VVIVAAYRTPIcKAKRGGFKDTYPDDLLAPVLKAVVEKTGLNPSEVGDIVVGTVLaPGSQRANECRMAAFYAGFPETVPV 127
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970    80 WGMNQLCGSGLRAVALGMQQIATGDASIIVAGGMESMSMAPhcAHLRGGV--KMGDFKMI-DTMIKdgltdafygyhMGT 156
Cdd:PLN02287 128 RTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGVESMTTNP--MAWEGGVnpRVESFSQAqDCLLP-----------MGI 194
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   157 TAENVAKQWQLSRDEQDAFAVASQNKAEAAQKDGRFKDEIVPF---IVKGRKGD---ITVDADEYIRHGATLDSMAKLRP 230
Cdd:PLN02287 195 TSENVAERFGVTREEQDQAAVESHRKAAAATASGKFKDEIVPVhtkIVDPKTGEekpIVISVDDGIRPNTTLADLAKLKP 274
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   231 AFDKEGTVTAGNASGLNDGAAAALLMSEAEASRRGIQPLGRIVSWATVGVDPKVMGTGPIPASRKALERAGWKIGDLDLV 310
Cdd:PLN02287 275 VFKKNGTTTAGNSSQVSDGAGAVLLMKRSVAMQKGLPILGVFRSFAAVGVDPAVMGIGPAVAIPAAVKAAGLELDDIDLF 354
                        330       340       350       360       370       380       390
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 7766970   311 EANEAFAAQACAVNKDLGWDPSIVNVNGGAIAIGHPIGASGARILNTLLFEMKRRG--ARKGLATLCIGGGMGVAMCIE 387
Cdd:PLN02287 355 EINEAFASQFVYCCKKLGLDPEKVNVNGGAIALGHPLGATGARCVATLLHEMKRRGkdCRFGVVSMCIGTGMGAAAVFE 433
PRK06366 PRK06366
acetyl-CoA acetyltransferase; Provisional
2-387 1.07e-112

acetyl-CoA acetyltransferase; Provisional


Pssm-ID: 102340  Cd Length: 388  Bit Score: 334.29  E-value: 1.07e-112
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970     2 IVIASAARTAVGSFNGAFANTPAHELGATVISAVLERAGVAAGEVNEVILGQVLPAGEGQNPARQAAMKAGVPQEATAWG 81
Cdd:PRK06366   4 VYIVSAKRTAIGKFGRSFSKIKAPQLGGAAIKAVIDDAKLDPALVQEVIMGNVIQAGVGQNPAGQAAYHAGLPFGVTKYT 83
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970    82 MNQLCGSGLRAVALGMQQIATGDASIIVAGGMESMSMAPHC--AHLRGGVKM---GDFKMIDTMIKDGLTDAFYGYHMGT 156
Cdd:PRK06366  84 VNVVCASGMLAVESAAREIMLGERDLVIAGGMENMSNAPFLlpSDLRWGPKHllhKNYKIDDAMLVDGLIDAFYFEHMGV 163
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   157 TAENVAKQWQLSRDEQDAFAVASQNKAEAAQKDGRFKDEIVPFIvkgrkgdiTVDADEYIRHgATLDSMAKLRPAFDKEG 236
Cdd:PRK06366 164 SAERTARKYGITREMADEYSVQSYERAIRATESGEFRNEIVPFN--------DLDRDEGIRK-TTMEDLAKLPPAFDKNG 234
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   237 TVTAGNASGLNDGAAAALLMSEAEASRRGIQPLGRIVSWATVGVDPKVMGTGPIPASRKALERAGWKIGDLDLVEANEAF 316
Cdd:PRK06366 235 ILTAGNSAQLSDGGSALVMASEKAINEYGLKPIARITGYESASLDPLDFVEAPIPATRKLLEKQNKSIDYYDLVEHNEAF 314
                        330       340       350       360       370       380       390
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 7766970   317 AAQACAVNKDLGWDPSIVNVNGGAIAIGHPIGASGARILNTLLFEMKRRGARKGLATLCIGGGMGVAMCIE 387
Cdd:PRK06366 315 SIASIIVRDQLKIDNERFNVNGGAVAIGHPIGNSGSRIIVTLINALKTRHMKTGLATLCHGGGGAHTLTLE 385
PRK13359 PRK13359
beta-ketoadipyl CoA thiolase; Provisional
4-389 1.60e-112

beta-ketoadipyl CoA thiolase; Provisional


Pssm-ID: 183998  Cd Length: 400  Bit Score: 334.44  E-value: 1.60e-112
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970     4 IASAARTAVGSFNGAFANTPAHELGATVISAVLER-AGVAAGEVNEVILGQVLPAGE-GQNPARQAAMKAGVPQEATAWG 81
Cdd:PRK13359   6 ICDAIRTPIGRYGGALSSVRADDLGAVPLKALVERnPDVDWAAIDDVIYGCANQAGEdNRNVARMSLLLAGLPHGVPGST 85
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970    82 MNQLCGSGLRAVALGMQQIATGDASIIVAGGMESMSMAPHCAHLRGGVKMGDFKMIDTMIK----DGLTDAFYGYH-MGT 156
Cdd:PRK13359  86 INRLCGSGMDAVGVAARAIKSGEAALMIAGGVESMSRAPFVMGKAESAFSRQAEIFDTTIGwrfvNPLMKQLYGVDsMPE 165
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   157 TAENVAKQWQLSRDEQDAFAVASQNKAEAAQKDGRFKDEIVPFIVKGRKGD-ITVDADEYIRhGATLDSMAKLRPAFDKE 235
Cdd:PRK13359 166 TAENVATDYNVSRADQDAFALRSQQKAARAQADGTLAQEIVPVTIPQKKGDpLVVSRDEHPR-ETTLEALAKLKGVVRPD 244
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   236 GTVTAGNASGLNDGAAAALLMSEAEASRRGIQPLGRIVSWATVGVDPKVMGTGPIPASRKALERAGWKIGDLDLVEANEA 315
Cdd:PRK13359 245 GTVTAGNASGVNDGACALLLASEAAARRHGLKPRARVLGIATAGVEPRVMGIGPAPATQKLLARLGMTLDQFDVIELNEA 324
                        330       340       350       360       370       380       390
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 7766970   316 FAAQACAVNKDLGW--DPSIVNVNGGAIAIGHPIGASGARILNTLLFEMKRRGARKGLATLCIGGGMGVAMCIESL 389
Cdd:PRK13359 325 FASQGLAVLRELGLadDDARVNPNGGAIALGHPLGASGARLVTTALYQLERTGGRFALCTMCIGVGQGIAIAIERV 400
PRK08242 PRK08242
acetyl-CoA acetyltransferase; Validated
4-387 6.77e-106

acetyl-CoA acetyltransferase; Validated


Pssm-ID: 236197  Cd Length: 402  Bit Score: 317.21  E-value: 6.77e-106
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970     4 IASAART--AVGSFNGAFANTPAHELGATVISAVLERAGVAAGEVNEVILGQVLPAGE-GQNPARQAAMKAGVPQEATAW 80
Cdd:PRK08242   6 IYDAVRTprGKGKKDGSLHEVKPVRLAAGLLEALRDRNGLDTAAVDDVVLGCVTPVGDqGADIARTAVLAAGLPETVPGV 85
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970    81 GMNQLCGSGLRAVALGMQQIATGDASIIVAGGMESMSMAPHcahlrgGVKMGDFKMiDTMIkdgltdAFYGYHM--GTTA 158
Cdd:PRK08242  86 QINRFCASGLEAVNLAAAKVRSGWDDLVIAGGVESMSRVPM------GSDGGAWAM-DPST------NFPTYFVpqGISA 152
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   159 ENVAKQWQLSRDEQDAFAVASQNKAEAAQKDGRFKDEIVPfiVKGRKGDITVDADEYIRHGATLDSMAKLRPAFDKEGTV 238
Cdd:PRK08242 153 DLIATKYGFSREDVDAYAVESQQRAAAAWAEGYFAKSVVP--VKDQNGLTILDHDEHMRPGTTMESLAKLKPSFAMMGEM 230
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   239 ---------------------TAGNASGLNDGAAAALLMSEAEASRRGIQPLGRIVSWATVGVDPKVMGTGPIPASRKAL 297
Cdd:PRK08242 231 ggfdavalqkypeverinhvhHAGNSSGIVDGAAAVLIGSEEAGKALGLKPRARIVATATIGSDPTIMLTGPVPATRKAL 310
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   298 ERAGWKIGDLDLVEANEAFAAQACAVNKDLGWDPSIVNVNGGAIAIGHPIGASGARILNTLLFEMKRRGARKGLATLCIG 377
Cdd:PRK08242 311 AKAGLTVDDIDLFELNEAFASVVLRFMQALDIPHDKVNVNGGAIAMGHPLGATGAMILGTVLDELERRGKRTALITLCVG 390
                        410
                 ....*....|
gi 7766970   378 GGMGVAMCIE 387
Cdd:PRK08242 391 GGMGIATIIE 400
PRK07108 PRK07108
acetyl-CoA acetyltransferase; Provisional
3-389 1.08e-103

acetyl-CoA acetyltransferase; Provisional


Pssm-ID: 180843  Cd Length: 392  Bit Score: 311.32  E-value: 1.08e-103
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970     3 VIASAARTAVG-SFNGAFANTPAHELGATVISAVLERAGVAAGEVNEVILGQVLPAGE-GQNPARQAAMKAGVPQEATAW 80
Cdd:PRK07108   5 VIVSTARTPLAkSWRGAFNMTHGATLGGHVVQHAVERAKLDPAEVEDVIMGCANPEGAtGANIARQIALRAGLPVTVPGM 84
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970    81 GMNQLCGSGLRAVALGMQQIATGDASIIVAGGMESMSMAPHcahlrggvKMGDFKMIDTMIKDGLTDAFYgyHMGTTAEN 160
Cdd:PRK07108  85 TVNRFCSSGLQTIALAAQRVIAGEGDVFVAGGVESISCVQN--------EMNRHMLREGWLVEHKPEIYW--SMLQTAEN 154
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   161 VAKQWQLSRDEQDAFAVASQNKAEAAQKDGRFKDEIVPFIVKGRKGD----------ITVDADEYIRHGATLDSMAKLRP 230
Cdd:PRK07108 155 VAKRYGISKERQDEYGVQSQQRAAAAQAAGRFDDEIVPITVTAGVADkatgrlftkeVTVSADEGIRPDTTLEGVSKIRS 234
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   231 AFDKeGTVTAGNASGLNDGAAAALLMSEAEASRRGIQPLGRIVSWATVGVDPKVMGTGPIPASRKALERAGWKIGDLDLV 310
Cdd:PRK07108 235 ALPG-GVITAGNASQFSDGASACVVMNAKVAEREGLQPLGIFRGFAVAGCEPDEMGIGPVFAVPKLLKQAGLKVDDIDLW 313
                        330       340       350       360       370       380       390
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 7766970   311 EANEAFAAQACAVNKDLGWDPSIVNVNGGAIAIGHPIGASGARILNTLLFEMKRRGARKGLATLCIGGGMGVAMCIESL 389
Cdd:PRK07108 314 ELNEAFAVQVLYCRDTLGIPMDRLNVNGGAIAVGHPYGVSGARLTGHALIEGKRRGAKYVVVTMCIGGGQGAAGLFEVL 392
PRK08131 PRK08131
acetyl-CoA acetyltransferase; Provisional
4-387 4.95e-103

acetyl-CoA acetyltransferase; Provisional


Pssm-ID: 181242  Cd Length: 401  Bit Score: 310.17  E-value: 4.95e-103
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970     4 IASAARTAVGSFNGAFANTPAHELGATVISAVLERAGVAAGEVNEVILGQVLPAGE-GQNPARQAAMKAGVPQEATAWGM 82
Cdd:PRK08131   6 IYDGLRSPFGRHAGALASVRPDDLAATVIRRLLEKSGFPGDDIEDVILGCTNQAGEdSRNVARNALLLAGLPVTVPGQTV 85
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970    83 NQLCGSGLRAVALGMQQIATGDASIIVAGGMESMSMAPHCAHLRGGVKMGDFKMIDTMI-----KDGLTDAFYGYHMGTT 157
Cdd:PRK08131  86 NRLCASGLAAVIDAARAITCGEGDLYLAGGVESMSRAPFVMGKAESAFSRDAKVFDTTIgarfpNPKIVAQYGNDSMPET 165
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   158 AENVAKQWQLSRDEQDAFAVASQNKAEAAQKDGRFKDEIVPFIVK--GRKGDITVDADEYIRHGATLDSMAKLRPAFDkE 235
Cdd:PRK08131 166 GDNVAAEFGISREDADRFAAQSQAKYQAAKEEGFFADEITPIEVPqgRKLPPKLVAEDEHPRPSSTVEALTKLKPLFE-G 244
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   236 GTVTAGNASGLNDGAAAALLMSEAEASRRGIQPLGRIVSWATVGVDPKVMGTGPIPASRKALERAGWKIGDLDLVEANEA 315
Cdd:PRK08131 245 GVVTAGNASGINDGAAALLIGSRAAGEKYGLKPMARILSSAAAGVEPRIMGIGPVEAIKKALARAGLTLDDMDIIEINEA 324
                        330       340       350       360       370       380       390
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 7766970   316 FAAQACAVNKDLG--WDPSIVNVNGGAIAIGHPIGASGARILNTLLFEMKRRGARKGLATLCIGGGMGVAMCIE 387
Cdd:PRK08131 325 FASQVLGCLKGLGvdFDDPRVNPNGGAIAVGHPLGASGARLALTAARELQRRGKRYAVVSLCIGVGQGLAMVIE 398
PRK07851 PRK07851
acetyl-CoA acetyltransferase; Provisional
3-389 2.40e-100

acetyl-CoA acetyltransferase; Provisional


Pssm-ID: 181146  Cd Length: 406  Bit Score: 303.46  E-value: 2.40e-100
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970     3 VIASAARTAVG-SFNGAFANTPAHELGATVISAVLERA-GVAAGEVNEVILGQVLPAGE-GQNPARQAAMKAGVPQEATA 79
Cdd:PRK07851   5 VIVSTARSPIGrAFKGSLKDMRPDDLAAQMVRAALDKVpALDPTDIDDLMLGCGLPGGEqGFNMARVVAVLLGYDFLPGT 84
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970    80 wGMNQLCGSGLRAVALGMQQIATGDASIIVAGGMESMS---------------------MAPHCAHLRGGVKMGDfkmiD 138
Cdd:PRK07851  85 -TVNRYCSSSLQTTRMAFHAIKAGEGDVFISAGVETVSrfakgnsdslpdtknplfaeaQARTAARAEGGAEAWH----D 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   139 TMIKDGLTDAFYGyhMGTTAENVAKQWQLSRDEQDAFAVASQNKAEAAQKDGRFKDEIVPfiVKGRKGdITVDADEYIRH 218
Cdd:PRK07851 160 PREDGLLPDVYIA--MGQTAENVAQLTGISREEQDEWGVRSQNRAEEAIANGFFEREITP--VTLPDG-TVVSTDDGPRA 234
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   219 GATLDSMAKLRPAFDKEGTVTAGNASGLNDGAAAALLMSEAEASRRGIQPLGRIVSWATVGVDPKVMGTGPIPASRKALE 298
Cdd:PRK07851 235 GTTYEKVSQLKPVFRPDGTVTAGNACPLNDGAAAVVIMSDTKARELGLTPLARIVSTGVSGLSPEIMGLGPVEASKQALA 314
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   299 RAGWKIGDLDLVEANEAFAAQACAVNKDLGWDPSIVNVNGGAIAIGHPIGASGARILNTLLFEMKRRGARKGLATLCIGG 378
Cdd:PRK07851 315 RAGMSIDDIDLVEINEAFAAQVLPSARELGIDEDKLNVSGGAIALGHPFGMTGARITTTLLNNLQTHDKTFGLETMCVGG 394
                        410
                 ....*....|.
gi 7766970   379 GMGVAMCIESL 389
Cdd:PRK07851 395 GQGMAMVLERL 405
fadA TIGR02445
fatty oxidation complex, beta subunit FadA; This subunit of the FadBA complex has acetyl-CoA ...
2-387 7.56e-100

fatty oxidation complex, beta subunit FadA; This subunit of the FadBA complex has acetyl-CoA C-acyltransferase (EC 2.3.1.16) activity, and is also known as beta-ketothiolase and fatty oxidation complex, beta subunit. This protein is almost always located adjacent to FadB (TIGR02437). The FadBA complex is the major complex active for beta-oxidation of fatty acids in E. coli. [Fatty acid and phospholipid metabolism, Degradation]


Pssm-ID: 131498  Cd Length: 385  Bit Score: 301.48  E-value: 7.56e-100
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970      2 IVIASAARTAVG-SFNGAFANTPAHELGATVISAVLER-AGVAAGEVNEVILGQVLPAGE-GQNPARQAAMKAGVPQEAT 78
Cdd:TIGR02445   2 VVIVDFGRTPMGrSKGGAFRNTRAEDLSAHLMSKLLARnPKVDPAEVEDIYWGCVQQTLEqGFNIARNAALLAQIPHTSA 81
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970     79 AWGMNQLCGSGLRAVALGMQQIATGDASIIVAGGMESMSMAPhcahLRGGVKMGDFKMIDTMIKDGLtdafygyhMGTTA 158
Cdd:TIGR02445  82 AVTVNRLCGSSMQALHDAARAIMTGDADVCLVGGVEHMGHVP----MMHGVDFHPGMSLHVAKAAGM--------MGLTA 149
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970    159 ENVAKQWQLSRDEQDAFAVASQNKAEAAQKDGRFKDEIVPfiVKGRKGD---ITVDADEYIRHGATLDSMAKLRPAFD-K 234
Cdd:TIGR02445 150 EMLGKMHGISREQQDAFAARSHARAHAATQEGKFKNEIIP--TQGHDADgflKQFDYDEVIRPETTVESLAALRPAFDpK 227
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970    235 EGTVTAGNASGLNDGAAAALLMSEAEASRRGIQPLGRIVSWATVGVDPKVMGTGPIPASRKALERAGWKIGDLDLVEANE 314
Cdd:TIGR02445 228 NGTVTAGTSSALSDGASAMLVMSEQRANELGLKPRARIRSMAVAGCDPSIMGYGPVPATQKALKRAGLSISDIDVFELNE 307
                         330       340       350       360       370       380       390
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 7766970    315 AFAAQACAVNKDLGWDPSI---VNVNGGAIAIGHPIGASGARILNTLLFEMKRRGARKGLATLCIGGGMGVAMCIE 387
Cdd:TIGR02445 308 AFAAQALPCLKDLGLLDKMdekVNLNGGAIALGHPLGCSGARISTTLLNLMEQKDATFGLATMCIGLGQGIATVFE 383
PRK08170 PRK08170
acetyl-CoA acetyltransferase; Provisional
8-389 1.38e-95

acetyl-CoA acetyltransferase; Provisional


Pssm-ID: 181265  Cd Length: 426  Bit Score: 291.92  E-value: 1.38e-95
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970     8 ARTAVGSFNGAfantpahELGATVISAVLERAGVAAGEVNEVILGQVLPAGEGQNPARQAAMKAGVPQEATAWGMNQLCG 87
Cdd:PRK08170  18 ARGGPGPFSAS-------DLAVAAGRALLNRQPFAPDDLDEVILGCAMPSPDEANIARVVALRLGCGEKVPAWTVQRNCA 90
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970    88 SGLRAVALGMQQIATGDASIIVAGGMESMSMAP----------------------HCAHLrGGVKMGDFKMIDTMIKdGL 145
Cdd:PRK08170  91 SGMQALDSAAANIALGRADLVLAGGVEAMSHAPllfsekmvrwlagwyaaksigqKLAAL-GKLRPSYLAPVIGLLR-GL 168
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   146 TDAFYGYHMGTTAENVAKQWQLSRDEQDAFAVASQNKAEAAQKDGRFKdEIVPFIvkGRKGDItVDADEYIRHGATLDSM 225
Cdd:PRK08170 169 TDPVVGLNMGQTAEVLAHRFGITREQMDAYAARSHQRLAAAQAEGRLK-EVVPLF--DRDGKF-YDHDDGVRPDSSMEKL 244
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   226 AKLRPAFDKE-GTVTAGNASGLNDGAAAALLMSEAEASRRGIQPLGRIVSWATVGVDPKVMGTGPIPASRKALERAGWKI 304
Cdd:PRK08170 245 AKLKPFFDRPyGRVTAGNSSQITDGACWLLLASEEAVKKYGLPPLGRIVDSQWAALDPSQMGLGPVHAATPLLQRHGLTL 324
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   305 GDLDLVEANEAFAAQ--AC--AVNKD------LGW-------DPSIVNVNGGAIAIGHPIGASGARILNTLLFEMKRRGA 367
Cdd:PRK08170 325 EDLDLWEINEAFAAQvlAClaAWADEeycreqLGLdgalgelDRERLNVDGGAIALGHPVGASGARIVLHLLHALKRRGT 404
                        410       420
                 ....*....|....*....|..
gi 7766970   368 RKGLATLCIGGGMGVAMCIESL 389
Cdd:PRK08170 405 KRGIAAICIGGGQGGAMLLERV 426
PRK07801 PRK07801
acetyl-CoA acetyltransferase; Provisional
4-389 1.93e-93

acetyl-CoA acetyltransferase; Provisional


Pssm-ID: 181123  Cd Length: 382  Bit Score: 284.68  E-value: 1.93e-93
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970     4 IASAARTAVGSFNGAFANTPAHELGATVISAVLERAGVAAGEVNEVILGQVLPAG-EGQNPARQAAMKAGVPQEATAWGM 82
Cdd:PRK07801   6 IVDAVRTPVGKRKGGLAGVHPADLGAHVLKGLVDRTGIDPAAVDDVIFGCVDTIGpQAGNIARTSWLAAGLPEEVPGVTV 85
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970    83 NQLCGSGLRAVALGMQQIATGDASIIVAGGMESMSMAPHCAHLRGGVKMG------DFKMIDTMIKDGLTDAFYGyhmgt 156
Cdd:PRK07801  86 DRQCGSSQQAIHFAAQAVMSGTQDLVVAGGVQNMSQIPISSAMTAGEQLGftspfaESKGWLHRYGDQEVSQFRG----- 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   157 tAENVAKQWQLSRDEQDAFAVASQNKAEAAQKDGRFKDEIVPFivkgrkGDITVDadEYIRHgATLDSMAKLRPAFDkEG 236
Cdd:PRK07801 161 -AELIAEKWGISREEMERFALESHRRAFAAIRAGRFDNEIVPV------GGVTVD--EGPRE-TSLEKMAGLKPLVE-GG 229
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   237 TVTAGNASGLNDGAAAALLMSEAEASRRGIQPLGRIVSWATVGVDPKVMGTGPIPASRKALERAGWKIGDLDLVEANEAF 316
Cdd:PRK07801 230 RLTAAVASQISDGASAVLLASERAVKRHGLTPRARIHHLSVRGDDPVFMLTAPIPATRYALEKTGLSIDDIDVVEINEAF 309
                        330       340       350       360       370       380       390
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 7766970   317 AAQACAVNKDLGWDPSIVNVNGGAIAIGHPIGASGARILNTLLFEMKRRGARKGLATLCIGGGMGVAMCIESL 389
Cdd:PRK07801 310 APVVLAWLKETGADPAKVNPNGGAIALGHPLGATGAKLMTTLLHELERTGGRYGLQTMCEGGGTANVTIIERL 382
PRK07850 PRK07850
acetyl-CoA acetyltransferase; Provisional
3-389 2.93e-90

acetyl-CoA acetyltransferase; Provisional


Pssm-ID: 181145  Cd Length: 387  Bit Score: 276.99  E-value: 2.93e-90
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970     3 VIASAARTAVGSFNGAFANTPAHELGATVISAVLERAGVAAGEVNEVILGQVLPAGE-GQNPARQAAMKAGVPQEATAWG 81
Cdd:PRK07850   5 VIVEAVRTPIGKRNGWLSGLHAAELLGAVQRAVLDRAGIDPGDVEQVIGGCVTQAGEqSNNITRTAWLHAGLPYHVGATT 84
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970    82 MNQLCGSGLRAVALGMQQIATGDASIIVAGGMESMSMAPHCAHLrgGVKMGDFKMIDTMIKDGltDAFygyhmgTTAENV 161
Cdd:PRK07850  85 IDCQCGSAQQANHLVAGLIAAGAIDVGIACGVEAMSRVPLGANA--GPGRGLPRPDSWDIDMP--NQF------EAAERI 154
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   162 AKQWQLSRDEQDAFAVASQNKAEAAQKDGRFKDEIVPFI--VKGRKGDIT-----VDADEYIRHgATLDSMAKLRPAFDk 234
Cdd:PRK07850 155 AKRRGITREDVDAFGLRSQRRAAQAWAEGRFDREISPVQapVLDEEGQPTgetrlVTRDQGLRD-TTMEGLAGLKPVLE- 232
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   235 EGTVTAGNASGLNDGAAAALLMSEAEASRRGIQPLGRIVSWATVGVDPKVMGTGPIPASRKALERAGWKIGDLDLVEANE 314
Cdd:PRK07850 233 GGIHTAGTSSQISDGAAAVLWMDEDRARALGLRPRARIVAQALVGAEPYYHLDGPVQATAKVLEKAGMKIGDIDLVEINE 312
                        330       340       350       360       370       380       390
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 7766970   315 AFAAQACAVNKDLGWDPSIVNVNGGAIAIGHPIGASGARILNTLLFEMKRRGARKGLATLCIGGGMGVAMCIESL 389
Cdd:PRK07850 313 AFASVVLSWAQVHEPDMDKVNVNGGAIALGHPVGSTGARLITTALHELERTDKSTALITMCAGGALSTGTIIERI 387
fadI PRK08963
3-ketoacyl-CoA thiolase; Reviewed
2-387 2.06e-89

3-ketoacyl-CoA thiolase; Reviewed


Pssm-ID: 181597  Cd Length: 428  Bit Score: 276.09  E-value: 2.06e-89
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970     2 IVIASAARTAVGSFNGAFANTPAHELGATVISAVLERAGVAAGEVNEVILGQVLPAGEGQNPARQAAMKAGVPQEATAWG 81
Cdd:PRK08963   7 IAIVSGLRTPFAKQATAFHGIPAVDLGKMVVGELLARSEIDPELIEQLVFGQVVQMPEAPNIAREIVLGTGMNVHTDAYS 86
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970    82 MNQLCGSGLRAVALGMQQIATGDASIIVAGGMESMSMAP-----HCAH----LRGGVKMGD-FKMIDTM-IKD------G 144
Cdd:PRK08963  87 VSRACATSFQAVANVAESIMAGTIDIGIAGGADSSSVLPigvskKLARalvdLNKARTLGQrLKLFSRLrLRDllpvppA 166
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   145 LTDAFYGYHMGTTAENVAKQWQLSRDEQDAFAVASQNKAEAAQKDGRFKDEIVPFIVKGRKGdiTVDADEYIRHGATLDS 224
Cdd:PRK08963 167 VAEYSTGLRMGDTAEQMAKTYGISREEQDALAHRSHQLAAQAWAEGKLDDEVMTAHVPPYKQ--PLEEDNNIRGDSTLED 244
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   225 MAKLRPAFD-KEGTVTAGNASGLNDGAAAALLMSEAEASRRGIQPLGRIVSWATVGVDP-KVMGTGPIPASRKALERAGW 302
Cdd:PRK08963 245 YAKLRPAFDrKHGTVTAANSTPLTDGAAAVLLMSESRAKALGLTPLGYLRSYAFAAIDVwQDMLLGPAYATPLALERAGL 324
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   303 KIGDLDLVEANEAFAAQACA----------VNKDLGW-------DPSIVNVNGGAIAIGHPIGASGARILNTLLFEMKRR 365
Cdd:PRK08963 325 TLADLTLIDMHEAFAAQTLAnlqmfaserfAREKLGRsqaigevDMSKFNVLGGSIAYGHPFAATGARMITQTLHELRRR 404
                        410       420
                 ....*....|....*....|..
gi 7766970   366 GARKGLATLCIGGGMGVAMCIE 387
Cdd:PRK08963 405 GGGLGLTTACAAGGLGAAMVLE 426
PRK06504 PRK06504
acetyl-CoA acetyltransferase; Provisional
4-389 2.17e-87

acetyl-CoA acetyltransferase; Provisional


Pssm-ID: 180595  Cd Length: 390  Bit Score: 269.68  E-value: 2.17e-87
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970     4 IASAARTAVGSFNGAFANTPAHELGATVISAVLERAGVAAGEVNEVILGQVLPAGE-GQNPARQAAMKAGVPQEATAWGM 82
Cdd:PRK06504   6 IVAAARTAGGRKGGRLAGWHPADLAAQVLDALVDRSGADPALIEDVIMGCVSQVGEqATNVARNAVLASKLPESVPGTSI 85
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970    83 NQLCGSGLRAVALGMQQIATGDASIIVAGGMESMSMAPHCAHLRGGVKMGDFKMIDTMIKDGLTDAFYGYHMGttAENVA 162
Cdd:PRK06504  86 DRQCGSSQQALHFAAQAVMSGTMDIVIAAGVESMTRVPMGSPSTLPAKNGLGHYKSPGMEERYPGIQFSQFTG--AEMMA 163
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   163 KQWQLSRDEQDAFAVASQNKAEAAQKDGRFKDEIVPFIVKGRKGDITV-DADEYIRHGATLDSMAKLRPaFDKEGTVTAG 241
Cdd:PRK06504 164 KKYGLSKDQLDEFALQSHQRAIAATQAGKFKAEIVPLEITRADGSGEMhTVDEGIRFDATLEGIAGVKL-IAEGGRLTAA 242
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   242 NASGLNDGAAAALLMSEAEASRRGIQPLGRIVSWATVGVDPKVMGTGPIPASRKALERAGWKIGDLDLVEANEAFAAQAC 321
Cdd:PRK06504 243 TASQICDGASGVMVVNERGLKALGVKPLARIHHMTVIGGDPVIMLEAPLPATERALKKAGMKIDDIDLYEVNEAFASVPL 322
                        330       340       350       360       370       380
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 7766970   322 AVNKDLGWDPSIVNVNGGAIAIGHPIGASGARILNTLLFEMKRRGARKGLATLCIGGGMGVAMCIESL 389
Cdd:PRK06504 323 AWLKATGADPERLNVNGGAIALGHPLGASGTKLMTTLVHALKQRGKRYGLQTMCEGGGMANVTIVERL 390
PRK06025 PRK06025
acetyl-CoA acetyltransferase; Provisional
4-389 8.76e-79

acetyl-CoA acetyltransferase; Provisional


Pssm-ID: 235675  Cd Length: 417  Bit Score: 248.15  E-value: 8.76e-79
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970     4 IASAARTAVG---SFNGAFANTPAHELGATVISAVLERAGVAAGEVNEVILGQVLPAG-EGQNPARQAAMKAGVPQEATA 79
Cdd:PRK06025   6 IIDAVRTPRGigkVGKGALAHLHPQHLAATVLKALAERNGLNTADVDDIIWSTSSQRGkQGGDLGRMAALDAGYDIKASG 85
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970    80 WGMNQLCGSGLRAVALGMQQIATGDASIIVAGGMESMSMAPHCAHLRGGVKMGDFKMIDTMIKdgLTDAFYGYHMGTTAE 159
Cdd:PRK06025  86 VTLDRFCGGGITSVNLAAAQIMSGMEDLVIAGGTEMMSYTAAMAAEDMAAGKPPLGMGSGNLR--LRALHPQSHQGVCGD 163
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   160 NVAKQWQLSRDEQDAFAVASQNKAEAAQKDGRFKDEIVPfiVKGRKGDITVDADEYIRHGATLDSMAKLRPAF------- 232
Cdd:PRK06025 164 AIATMEGITREALDALGLESQRRAARAIKEGRFDKSLVP--VYRDDGSVALDHEEFPRPQTTAEGLAALKPAFtaiadyp 241
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   233 -DKEGTV------------------TAGNASGLNDGAAAALLMSEAEASRRGIQPLGRIVSWATVGVDPKVMGTGPIPAS 293
Cdd:PRK06025 242 lDDKGTTyrglinqkypdleikhvhHAGNSSGVVDGAAALLLASKAYAEKHGLKPRARIVAMANMGDDPTLMLNAPVPAA 321
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   294 RKALERAGWKIGDLDLVEANEAFAAQACAVNKDLGWDPSIVNVNGGAIAIGHPIGASGARILNTLLFEMKRRGARKGLAT 373
Cdd:PRK06025 322 KKVLAKAGLTKDDIDLWEINEAFAVVAEKFIRDLDLDRDKVNVNGGAIALGHPIGATGSILIGTVLDELERRGLKRGLVT 401
                        410
                 ....*....|....*.
gi 7766970   374 LCIGGGMGVAMCIESL 389
Cdd:PRK06025 402 MCAAGGMAPAIIIERV 417
PRK06690 PRK06690
acetyl-CoA acetyltransferase; Provisional
3-389 3.79e-76

acetyl-CoA acetyltransferase; Provisional


Pssm-ID: 180659  Cd Length: 361  Bit Score: 239.67  E-value: 3.79e-76
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970     3 VIASAARTAVGSFNGAFANTPAHELGATVI---SAVLERagvaagEVNEVILGQVLpaGEGQNPARQAAMKAGVPQEATA 79
Cdd:PRK06690   4 VIVEAKRTPIGKKNGMLKDYEVQQLAAPLLtflSKGMER------EIDDVILGNVV--GPGGNVARLSALEAGLGLHIPG 75
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970    80 WGMNQLCGSGLRAVALGMQQIATGDASIIVAGGMESMSMAPHCAHLR-GGVKMGDfkmidtmikdgltdafygYHMGTTA 158
Cdd:PRK06690  76 VTIDRQCGAGLEAIRTACHFIQGGAGKCYIAGGVESTSTSPFQNRARfSPETIGD------------------PDMGVAA 137
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   159 ENVAKQWQLSRDEQDAFAVASQNKAEAAQKDGRFKDEIVPFivkgrkGDITVDADEYIRHGATLDSMAKlrPAFDKEGTV 238
Cdd:PRK06690 138 EYVAERYNITREMQDEYACLSYKRTLQALEKGYIHEEILSF------NGLLDESIKKEMNYERIIKRTK--PAFLHNGTV 209
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   239 TAGNASGLNDGAAAALLMSEAEASRRGIQPLGRIVSWATVGVDPKVMGTGPIPASRKALERAGWKIGDLDLVEANEAFAA 318
Cdd:PRK06690 210 TAGNSCGVNDGACAVLVMEEGQARKLGYKPVLRFVRSAVVGVDPNLPGTGPIFAVNKLLNEMNMKVEDIDYFEINEAFAS 289
                        330       340       350       360       370       380       390
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 7766970   319 QACAVNKDLGWDPSIVNVNGGAIAIGHPIGASGARILNTLLFEMKRRGARKGLATLCIGGGMGVAMCIESL 389
Cdd:PRK06690 290 KVVACAKELQIPYEKLNVNGGAIALGHPYGASGAMLVTRLFYQAKREDMKYGIATLGIGGGIGLALLFEKV 360
FadI TIGR02446
fatty oxidation complex, beta subunit FadI; This subunit of the FadJI complex has acetyl-CoA ...
2-387 1.47e-71

fatty oxidation complex, beta subunit FadI; This subunit of the FadJI complex has acetyl-CoA C-acyltransferase (EC 2.3.1.16) activity, and is also known as beta-ketothiolase and fatty oxidation complex, beta subunit, and YfcY. This protein is almost always located adjacent to FadJ (TIGR02440). The FadJI complex is needed for anaerobic beta-oxidation of short-chain fatty acids in E. coli. [Fatty acid and phospholipid metabolism, Degradation]


Pssm-ID: 131499  Cd Length: 430  Bit Score: 230.26  E-value: 1.47e-71
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970      2 IVIASAARTAVGSFNGAFANTPAHELGATVISAVLERAGVAAGEVNEVILGQVLPAGEGQNPARQAAMKAGVPQEATAWG 81
Cdd:TIGR02446   9 IAIVAGLRTPFARQATAFHGIPAVDLGKMVVSELLARSEIDPKLIEQLVFGQVVQMPEAPNIAREIVLGTGMNVHTDAYS 88
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970     82 MNQLCGSGLRAVALGMQQIATGDASIIVAGGMESMSMAPHCAHLRGGVKMGDFKMIDTM-----------IKD------G 144
Cdd:TIGR02446  89 VTRACATSFQSAVNVAESIMAGAIDIGIAGGADSSSVLPIGVSKKLAASLVDLNKARTLgqklkvfsrlgLKDlmpvppA 168
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970    145 LTDAFYGYHMGTTAENVAKQWQLSRDEQDAFAVASQNKAEAAQKDGRFKDEIVPFIVKGRKGDITVDADeyIRHGATLDS 224
Cdd:TIGR02446 169 VAEYSTGLSMGQTAEQMAKTYGITRAEQDALAHRSHTLASQAWRDGKLAGEVMTAFPPPYKQWIAEDNN--IRHNSTLAG 246
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970    225 MAKLRPAFDKE-GTVTAGNASGLNDGAAAALLMSEAEASRRGIQPLGRIVSWATVGVDP-KVMGTGPIPASRKALERAGW 302
Cdd:TIGR02446 247 YAKLRPAFDRKhGSVTAANSTPLTDGAAAVILMREGRAKELGMEPLGYIRSYAFTAIDVwQDMLMGPSYATPLALQRAGL 326
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970    303 KIGDLDLVEANEAFAAQACAVNKDLG-----------------WDPSIVNVNGGAIAIGHPIGASGARILNTLLFEMKRR 365
Cdd:TIGR02446 327 ALSDLTLIDMHEAFAAQTLANVQMFAsdkfaqenlgrskamgeIDMSKFNVLGGSIAYGHPFAATGARMITQTLRELKRR 406
                         410       420
                  ....*....|....*....|..
gi 7766970    366 GARKGLATLCIGGGMGVAMCIE 387
Cdd:TIGR02446 407 GGGLGLNTACAAGGLGAAMILE 428
Thiolase_C pfam02803
Thiolase, C-terminal domain; Thiolase is reported to be structurally related to beta-ketoacyl ...
267-387 1.11e-64

Thiolase, C-terminal domain; Thiolase is reported to be structurally related to beta-ketoacyl synthase (pfam00109), and also chalcone synthase.


Pssm-ID: 280896 [Multi-domain]  Cd Length: 123  Bit Score: 201.72  E-value: 1.11e-64
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970    267 QPLGRIVSWATVGVDPKVMGTGPIPASRKALERAGWKIGDLDLVEANEAFAAQACAVNKDLGWDPSIVNVNGGAIAIGHP 346
Cdd:pfam02803   2 KPLARIRSYATAGVDPAIMGIGPAYAIPKALKKAGLTVNDIDLFEINEAFAAQALAVAKDLGIDPEKVNVNGGAIALGHP 81
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|.
gi 7766970    347 IGASGARILNTLLFEMKRRGARKGLATLCIGGGMGVAMCIE 387
Cdd:pfam02803  82 LGASGARILVTLLHELKRRGGKYGLASLCIGGGQGVAMIIE 122
PRK09268 PRK09268
acetyl-CoA acetyltransferase; Provisional
16-388 1.29e-57

acetyl-CoA acetyltransferase; Provisional


Pssm-ID: 236440  Cd Length: 427  Bit Score: 193.58  E-value: 1.29e-57
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970    16 NGAFANTPAHELGATVISAVLERAGVAAGEVNEVILGQVLPAGEGQNPARQAAMKAGVPQEATAWGMNQLCGSGLRAVAL 95
Cdd:PRK09268  23 NGAYADASNQDMLTAALDGLVDRFGLQGERLGEVVAGAVLKHSRDFNLTRECVLGSALSPYTPAYDLQQACGTGLEAAIL 102
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970    96 GMQQIATGDASIIVAGGMESMSMAPHCAH--LR-------------------GGVKMGDFKMIDTMIKDGLTdafyGYHM 154
Cdd:PRK09268 103 VANKIALGQIDSGIAGGVDTTSDAPIAVNegLRkillelnrakttgdrlkalGKLRPKHLAPEIPRNGEPRT----GLSM 178
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   155 GTTAENVAKQWQLSRDEQDAFAVASQNKAEAAQKDGRFKDEIVPFivkgrKGditVDADEYIRHGATLDSMAKLRPAFDK 234
Cdd:PRK09268 179 GEHAAITAKEWGISREAQDELAAASHQNLAAAYDRGFFDDLITPF-----LG---LTRDNNLRPDSSLEKLAKLKPVFGK 250
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   235 --EGTVTAGNASGLNDGAAAALLMSEAEASRRGIQPLGRIVSWATVGVDpKVMG-----TGPIPASRKALERAGWKIGDL 307
Cdd:PRK09268 251 ggRATMTAGNSTPLTDGASVVLLASEEWAAEHGLPVLAYLVDAETAAVD-FVHGkegllMAPAYAVPRLLARNGLTLQDF 329
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   308 DLVEANEAFAAQACAVNK----------DLGW-------DPSIVNVNGGAIAIGHPIGASGARILNTLLFEMKRRGARKG 370
Cdd:PRK09268 330 DFYEIHEAFASQVLATLKawedeeycreRLGLdaplgsiDRSKLNVNGSSLAAGHPFAATGGRIVATLAKLLAEKGSGRG 409
                        410
                 ....*....|....*...
gi 7766970   371 LATLCIGGGMGVAMCIES 388
Cdd:PRK09268 410 LISICAAGGQGVTAILER 427
cond_enzymes cd00327
Condensing enzymes; Family of enzymes that catalyze a (decarboxylating or non-decarboxylating) ...
24-386 1.74e-52

Condensing enzymes; Family of enzymes that catalyze a (decarboxylating or non-decarboxylating) Claisen-like condensation reaction. Members are share strong structural similarity, and are involved in the synthesis and degradation of fatty acids, and the production of polyketides, a diverse group of natural products.


Pssm-ID: 238201 [Multi-domain]  Cd Length: 254  Bit Score: 174.94  E-value: 1.74e-52
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   24 AHELGATVISAVLERAGVAAGEVNEVILGQVLPAGEGQNPARQAAMKAGVPqEATAWGMNQLCGSGLRAVALGMQQIATG 103
Cdd:cd00327   7 ASELGFEAAEQAIADAGLSKGPIVGVIVGTTGGSGEFSGAAGQLAYHLGIS-GGPAYSVNQACATGLTALALAVQQVQNG 85
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970  104 DASIIVAGGMESmsmaphcahlrggvkmgdfkmidtmikdgltdafygyhmgttaenvakqwqlsrdeqdafavasqnka 183
Cdd:cd00327  86 KADIVLAGGSEE-------------------------------------------------------------------- 97
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970  184 eaaqkdgrfkdeivpfivkgrkgditvdadeyirhgatldsmaklrpafdkegtvtagnaSGLNDGAAAALLMSEAEASR 263
Cdd:cd00327  98 ------------------------------------------------------------FVFGDGAAAAVVESEEHALR 117
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970  264 RGIQPLGRIVSWATVGVD----PKVMGTGPIPASRKALERAGWKIGDLDLVEANEAFAAQACAVNKDLGWDPSIV---NV 336
Cdd:cd00327 118 RGAHPQAEIVSTAATFDGasmvPAVSGEGLARAARKALEGAGLTPSDIDYVEAHGTGTPIGDAVELALGLDPDGVrspAV 197
                       330       340       350       360       370
                ....*....|....*....|....*....|....*....|....*....|....*..
gi 7766970  337 NGGAIAIGHPIGASGARILNTLLFEMK-------RRGARKGLATLCIGGGMGVAMCI 386
Cdd:cd00327 198 SATLIMTGHPLGAAGLAILDELLLMLEhefipptPREPRTVLLLGFGLGGTNAAVVL 254
SCP-x_thiolase cd00829
Thiolase domain associated with sterol carrier protein (SCP)-x isoform and related proteins; ...
17-358 1.88e-10

Thiolase domain associated with sterol carrier protein (SCP)-x isoform and related proteins; SCP-2 has multiple roles in intracellular lipid circulation and metabolism. The N-terminal presequence in the SCP-x isoform represents a peroxisomal 3-ketacyl-Coa thiolase specific for branched-chain acyl CoAs, which is proteolytically cleaved from the sterol carrier protein.


Pssm-ID: 238425 [Multi-domain]  Cd Length: 375  Bit Score: 61.51  E-value: 1.88e-10
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   17 GAFANTPAHELGATVISAVLERAGVAAGEVNEVILGQVLPAGEGQNPARQAAMKAGVPqEATAWGMNQLCGSGLRAVALG 96
Cdd:cd00829   9 GRRSDRSPLELAAEAARAALDDAGLEPADIDAVVVGNAAGGRFQSFPGALIAEYLGLL-GKPATRVEAAGASGSAAVRAA 87
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   97 MQQIATGDASIIVAGGMESMSMAPHCAHLRGGVkmGDFKMIDTMIKDGLT--DAF------YGYHMGTTAENVAKqwqls 168
Cdd:cd00829  88 AAAIASGLADVVLVVGAEKMSDVPTGDEAGGRA--SDLEWEGPEPPGGLTppALYalaarrYMHRYGTTREDLAK----- 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970  169 rdeqdafaVASQNKAEA-----AQkdgrfkdeivpfivkgRKGDITVDadeyirhgatlDSMAKlRPAFDKegtVTAGNA 243
Cdd:cd00829 161 --------VAVKNHRNAarnpyAQ----------------FRKPITVE-----------DVLNS-RMIADP---LRLLDC 201
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970  244 SGLNDGAAAALLMSEAEASRRGIQPLgRIVSWAtVGVDPKVMG--------TGPIPASRKALERAGWKIGDLDLVEANEA 315
Cdd:cd00829 202 CPVSDGAAAVVLASEERARELTDRPV-WILGVG-AASDTPSLSerddflslDAARLAARRAYKMAGITPDDIDVAELYDC 279
                       330       340       350       360       370       380
                ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 7766970  316 FAA---------------QACAVNKD----LGWDPSiVNVNGGAIAIGHPIGASGARILNTL 358
Cdd:cd00829 280 FTIaellaledlgfcekgEGGKLVREgdtaIGGDLP-VNTSGGLLSKGHPLGATGLAQAVEA 340
PRK06289 PRK06289
acetyl-CoA acetyltransferase; Provisional
235-378 8.52e-07

acetyl-CoA acetyltransferase; Provisional


Pssm-ID: 235771 [Multi-domain]  Cd Length: 403  Bit Score: 50.46  E-value: 8.52e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   235 EGTVTAGNASGLNDGAAAALLMSEAEASR-RGIQPLGRIVSW----ATVGVDPKVMGT--GP--IPASRK----ALERAG 301
Cdd:PRK06289 211 EGRLRRQDCSQVTDGGAGVVLASDAYLRDyADARPIPRIKGWghrtAPLGLEQKLDRSagDPyvLPHVRQavldAYRRAG 290
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   302 WKIGDLDLVEANEAFAAQACAVNKDLG-------W----DPSI-------VNVNGGAIAIGHPIGASGARILNTLLFEMK 363
Cdd:PRK06289 291 VGLDDLDGFEVHDCFTPSEYLAIDHIGltgpgesWkaieNGEIaiggrlpINPSGGLIGGGHPVGASGVRMLLDAAKQVT 370
                        170       180
                 ....*....|....*....|..
gi 7766970   364 RR-------GARKGLaTLCIGG 378
Cdd:PRK06289 371 GTagdyqveGAKTFG-TLNIGG 391
PRK05952 PRK05952
3-oxoacyl-(acyl carrier protein) synthase II; Reviewed
232-352 1.26e-06

3-oxoacyl-(acyl carrier protein) synthase II; Reviewed


Pssm-ID: 235653 [Multi-domain]  Cd Length: 381  Bit Score: 49.67  E-value: 1.26e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   232 FDK--EGTVtagnasgLNDGAAAALLMSEAEASRRGIQPLGRIVSW-----ATVGVDPKVMGTGPIPASRKALERAGWKI 304
Cdd:PRK05952 199 FDRqrEGLV-------LGEGGAILVLESAELAQKRGAKIYGQILGFgltcdAYHMSAPEPDGKSAIAAIQQCLARSGLTP 271
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*
gi 7766970   305 GDLDLVEA-------NEAFAAQACAVnkdlgWDPSIVNVNGGAIAIGHPIGASGA 352
Cdd:PRK05952 272 EDIDYIHAhgtatrlNDQREANLIQA-----LFPHRVAVSSTKGATGHTLGASGA 321
PRK12578 PRK12578
acetyl-CoA acetyltransferase; Provisional
26-351 4.57e-06

acetyl-CoA acetyltransferase; Provisional


Pssm-ID: 183606 [Multi-domain]  Cd Length: 385  Bit Score: 47.92  E-value: 4.57e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970    26 ELGATVISAVLERAGVAAGEVNEVILGQVLPAGEGQNPARQAAMKAG----VPQEATAwgmnqLCGSGLRAVALGMQQIA 101
Cdd:PRK12578  23 ELAWESIKEALNDAGVSQTDIELVVVGSTAYRGIELYPAPIVAEYSGltgkVPLRVEA-----MCATGLAASLTAYTAVA 97
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   102 TGDASIIVAGGMESMSMAPHCAHL----RGGVKMGDFKMIDTMIKdgltdAFYGY----HM---GTTaenvakqwqlsrD 170
Cdd:PRK12578  98 SGLVDMAIAVGVDKMTEVDTSTSLaiggRGGNYQWEYHFYGTTFP-----TYYALyatrHMavyGTT------------E 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   171 EQDAFAVASQNKAEAAQKDGRFKDEI-VPFIVKGRkgditvdadeYIRHGATLdsmaklrpaFDkegtvtagnASGLNDG 249
Cdd:PRK12578 161 EQMALVSVKAHKYGAMNPKAHFQKPVtVEEVLKSR----------AISWPIKL---------LD---------SCPISDG 212
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   250 AAAALLMSEAEASRRGI-QP--------------LGRIVSWatVGVDPKVMgtgpipASRKALERAGWKIGDLDLVEANE 314
Cdd:PRK12578 213 SATAIFASEEKVKELKIdSPvwitgigyandyayVARRGEW--VGFKATQL------AARQAYNMAKVTPNDIEVATVHD 284
                        330       340       350       360       370
                 ....*....|....*....|....*....|....*....|....*....|....*
gi 7766970   315 AFAAQACAVNKDLGWDPS------------------IVNVNGGAIAIGHPIGASG 351
Cdd:PRK12578 285 AFTIAEIMGYEDLGFTEKgkggkfieegqsekggkvGVNLFGGLKAKGHPLGATG 339
FabB COG0304
3-oxoacyl-(acyl-carrier-protein) synthase [Lipid transport and metabolism, Secondary ...
249-352 4.67e-06

3-oxoacyl-(acyl-carrier-protein) synthase [Lipid transport and metabolism, Secondary metabolites biosynthesis, transport and catabolism];


Pssm-ID: 223381 [Multi-domain]  Cd Length: 412  Bit Score: 48.03  E-value: 4.67e-06
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970  249 GAAAALLMSEAEASRRGIQPLGRIVSWATVG-----VDPKVMGTGPIPASRKALERAGWKIGDLDLVEA-----NEAFAA 318
Cdd:COG0304 233 GAGALVLEELEHALARGAKIYAEIVGYGTTSdayhiTAPAPDGEGAIRAMRAALADAGLTPEDIDYINAhgtstPANDKA 312
                        90       100       110
                ....*....|....*....|....*....|....
gi 7766970  319 QACAVNKDLGWDPSIVNVNGGAIAIGHPIGASGA 352
Cdd:COG0304 313 ESLAIKRVFGEHAKSLPVSSTKSLTGHTLGAAGA 346
KAS_I_II cd00834
Beta-ketoacyl-acyl carrier protein (ACP) synthase (KAS), type I and II. KASs are responsible ...
229-352 6.55e-06

Beta-ketoacyl-acyl carrier protein (ACP) synthase (KAS), type I and II. KASs are responsible for the elongation steps in fatty acid biosynthesis. KASIII catalyses the initial condensation and KAS I and II catalyze further elongation steps by Claisen condensation of malonyl-acyl carrier protein (ACP) with acyl-ACP.


Pssm-ID: 238430 [Multi-domain]  Cd Length: 406  Bit Score: 47.53  E-value: 6.55e-06
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970  229 RPaFDKE--GTVtagnasgLNDGAAAALLMSEAEASRRGIQPLGRIVSWATVG-----VDPKVMGTGPIPASRKALERAG 301
Cdd:cd00834 218 RP-FDKDrdGFV-------LGEGAGVLVLESLEHAKARGAKIYAEILGYGASSdayhiTAPDPDGEGAARAMRAALADAG 289
                        90       100       110       120       130
                ....*....|....*....|....*....|....*....|....*....|....*....
gi 7766970  302 WKIGDLDLV-------EANEAFAAQAC-AVNKDLGWDPSIVNVNGgaiAIGHPIGASGA 352
Cdd:cd00834 290 LSPEDIDYInahgtstPLNDAAESKAIkRVFGEHAKKVPVSSTKS---MTGHLLGAAGA 345
PRK06064 PRK06064
acetyl-CoA acetyltransferase; Provisional
86-353 9.87e-06

acetyl-CoA acetyltransferase; Provisional


Pssm-ID: 235688 [Multi-domain]  Cd Length: 389  Bit Score: 46.81  E-value: 9.87e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970    86 CGSGLRAVALGMQQIATGDASIIVAGGMESMSMAPHCAHLRGGVKMGDFKMIDTMikdGLTdaFYGY-------HM---G 155
Cdd:PRK06064  85 CASGGAALRQAYLAVASGEADVVLAAGVEKMTDVPTPDATEAIARAGDYEWEEFF---GAT--FPGLyaliarrYMhkyG 159
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   156 TTAENVAKqwqlsrdeqdafaVASQNKAEAAQ-KDGRFKDEIvpfivkgrkgditvdadeyirhgaTLDSMAKLRPAFDK 234
Cdd:PRK06064 160 TTEEDLAL-------------VAVKNHYNGSKnPYAQFQKEI------------------------TVEQVLNSPPVADP 202
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   235 egtVTAGNASGLNDGAAAALLMSEAEASRRGIQPLgRIVSWAtvgvdpkvMGTGPIP---------------ASRKALER 299
Cdd:PRK06064 203 ---LKLLDCSPITDGAAAVILASEEKAKEYTDTPV-WIKASG--------QASDTIAlhdrkdfttldaavvAAEKAYKM 270
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 7766970   300 AGWKIGDLDLVEANEAFA-AQACAVnKDLGW-----------------DPSI-VNVNGGAIAIGHPIGASGAR 353
Cdd:PRK06064 271 AGIEPKDIDVAEVHDCFTiAEILAY-EDLGFakkgeggklaregqtyiGGDIpVNPSGGLKAKGHPVGATGVS 342
PRK07910 PRK07910
3-oxoacyl-(acyl carrier protein) synthase II; Reviewed
223-352 3.29e-05

3-oxoacyl-(acyl carrier protein) synthase II; Reviewed


Pssm-ID: 236129 [Multi-domain]  Cd Length: 418  Bit Score: 45.49  E-value: 3.29e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   223 DSMAKLRPaFDKegtvtagNASGLNDGAAAALLMSEAE--ASRRGIQPLGRIVSWATVG-----VDPKVMGTGPIPASRK 295
Cdd:PRK07910 223 DPAGACRP-FDK-------DRDGFVFGEGGALMVIETEehAKARGANILARIMGASITSdgfhmVAPDPNGERAGHAMTR 294
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 7766970   296 ALERAGWKIGDLDLVEANEAFA-----AQACAVNKDLGWDPSIVNVNGGaiAIGHPIGASGA 352
Cdd:PRK07910 295 AIELAGLTPGDIDHVNAHATGTsvgdvAEGKAINNALGGHRPAVYAPKS--ALGHSVGAVGA 354
PTZ00455 PTZ00455
3-ketoacyl-CoA thiolase; Provisional
244-363 1.38e-04

3-ketoacyl-CoA thiolase; Provisional


Pssm-ID: 240424 [Multi-domain]  Cd Length: 438  Bit Score: 43.34  E-value: 1.38e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   244 SGLNDGAAAALLMSEAEASRRGIQPL-GRIVSWATVGV----------DPKVMGTGpIPASRKALERAGWKIGDLDLVEA 312
Cdd:PTZ00455 256 SQVSDGGAGLVLASEEGLQKMGLSPNdSRLVEIKSLACasgnlyedppDATRMFTS-RAAAQKALSMAGVKPSDLQVAEV 334
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 7766970   313 NEAFAAQACAVNKDLGW-DPS-----------------IVNVNGGAIAIGHPIGASGARILNTLLFEMK 363
Cdd:PTZ00455 335 HDCFTIAELLMYEALGIaEYGhakdlirngatalegriPVNTGGGLLSFGHPVGATGVKQIMEVYRQMK 403
PRK07516 PRK07516
acetyl-CoA acetyltransferase; Provisional
248-383 3.20e-04

acetyl-CoA acetyltransferase; Provisional


Pssm-ID: 181013 [Multi-domain]  Cd Length: 389  Bit Score: 42.24  E-value: 3.20e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   248 DGAAAALLMSEAEASRrgiqpLGRIVSW-ATVGV---------DPKVMgTGPIPASRKALERAGWKIGDLDLVEANEAF- 316
Cdd:PRK07516 217 DGAAALVLADAETARA-----LQRAVRFrARAHVndflplsrrDPLAF-EGPRRAWQRALAQAGVTLDDLSFVETHDCFt 290
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   317 -----------------AAQACA---VNKDlGWDPsiVNVNGGAIAIGHPIGASG-------ARILNTLLFEMKRRGARk 369
Cdd:PRK07516 291 iaelieyeamglappgqGARAIRegwTAKD-GKLP--VNPSGGLKAKGHPIGATGvsmhvlaAMQLTGEAGGMQIPGAK- 366
                        170
                 ....*....|....
gi 7766970   370 gLATLCIGGGMGVA 383
Cdd:PRK07516 367 -LAGVFNMGGAAVA 379
decarbox_cond_enzymes cd00825
decarboxylating condensing enzymes; Family of enzymes that catalyze the formation of a new ...
248-363 8.10e-04

decarboxylating condensing enzymes; Family of enzymes that catalyze the formation of a new carbon-carbon bond by a decarboxylating Claisen-like condensation reaction. Members are involved in the synthesis of fatty acids and polyketides, a diverse group of natural products. Both pathways are an iterative series of additions of small carbon units, usually acetate, to a nascent acyl group. There are 2 classes of decarboxylating condensing enzymes, which can be distinguished by sequence similarity, type of active site residues and type of primer units (acetyl CoA or acyl carrier protein (ACP) linked units).


Pssm-ID: 238421  Cd Length: 332  Bit Score: 40.70  E-value: 8.10e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970  248 DGAAAALLMSEAEASRRGIQPLGRIVSWA-----TVGVDPKVMGTGPIPASRKALERAGWKIGDLDLVEANEAFAAQACA 322
Cdd:cd00825 161 DGAGALVVEELEHALARGAHIYAEIVGTAatidgAGMGAFAPSAEGLARAAKEALAVAGLTVWDIDYLVAHGTGTPIGDV 240
                        90       100       110       120
                ....*....|....*....|....*....|....*....|....
gi 7766970  323 VNKDLGWD---PSIVNVNGGAIAIGHPIGASGARILNTLLFEMK 363
Cdd:cd00825 241 KELKLLRSefgDKSPAVSATKAMTGNLSSAAVVLAVDEAVLMLE 284
PRK06365 PRK06365
acetyl-CoA acetyltransferase; Provisional
238-351 1.24e-03

acetyl-CoA acetyltransferase; Provisional


Pssm-ID: 235785 [Multi-domain]  Cd Length: 430  Bit Score: 40.66  E-value: 1.24e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   238 VTAGNASGLNDGAAAALLMSEAEASRRGIQPLgrIVSWATVGVD---PKVMGTGPIP----------------------- 291
Cdd:PRK06365 217 LTRLDVCAMSDGAACAILASEDKAFEITDKPV--LIKAIGTGSDtlrLADRPFGEVPllpnespddykdlrypgvhsfra 294
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   292 ---ASRKALERAGWK--IGDLDLVEANEAFAAQACAVNKDLGW-------------DPSI-----VNVNGGAIAIGHPIG 348
Cdd:PRK06365 295 grmAAKEAYEMAGITdpLNDLDLIELHDAYTSSEIQTYEDLGLckygeggqfiesgKPELpgklpVNPSGGLLAAGHAVG 374

                 ...
gi 7766970   349 ASG 351
Cdd:PRK06365 375 ATG 377
PRK07103 PRK07103
polyketide beta-ketoacyl:acyl carrier protein synthase; Validated
249-312 1.43e-03

polyketide beta-ketoacyl:acyl carrier protein synthase; Validated


Pssm-ID: 180839 [Multi-domain]  Cd Length: 410  Bit Score: 40.40  E-value: 1.43e-03
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 7766970   249 GAAAALLMSEAEASRRGIQPLGRIVSW-----ATVGVDPKVmgTGPIPASRKALERAGWKIGDLDLVEA 312
Cdd:PRK07103 240 ACGAVVLESAESARRRGARPYAKLLGWsmrldANRGPDPSL--EGEMRVIRAALRRAGLGPEDIDYVNP 306
elong_cond_enzymes cd00828
"elongating" condensing enzymes are a subclass of decarboxylating condensing enzymes, ...
249-312 3.77e-03

"elongating" condensing enzymes are a subclass of decarboxylating condensing enzymes, including beta-ketoacyl [ACP] synthase, type I and II and polyketide synthases.They are characterized by the utlization of acyl carrier protein (ACP) thioesters as primer substrates, as well as the nature of their active site residues.


Pssm-ID: 238424 [Multi-domain]  Cd Length: 407  Bit Score: 38.96  E-value: 3.77e-03
                        10        20        30        40        50        60
                ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 7766970  249 GAAAALLMSEAEASRRGIQPLGRIVSWATVGVDPKVMGTGPIPASRKALERA----GWKIGDLDLVEA 312
Cdd:cd00828 232 GAGVLVLERAELALARGAPIYGRVAGTASTTDGAGRSVPAGGKGIARAIRTAlakaGLSLDDLDVISA 299
PRK06157 PRK06157
acetyl-CoA acetyltransferase; Validated
244-362 8.66e-03

acetyl-CoA acetyltransferase; Validated


Pssm-ID: 180433 [Multi-domain]  Cd Length: 398  Bit Score: 37.70  E-value: 8.66e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7766970   244 SGLNDGAAAALLMSEAEASRRG------IQPLGRIVS----WATVGVDPKVMGTGPIpASRKALERAGwkIGD----LDL 309
Cdd:PRK06157 214 CGVSDGAAAAIVTTPEIARALGkkdpvyVKALQLAVSngweLQYNGWDGSYFPTTRI-AARKAYREAG--ITDpreeLSM 290
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 7766970   310 VEANEAFAAQACAVNKDLGWDPS------------------IVNVNGGAIAIGHPIGASGARilntLLFEM 362
Cdd:PRK06157 291 AEVHDCFSITELVTMEDLGLSERgqawrdvldgffdadgglPCQIDGGLKCFGHPIGASGLR----MLYEM 357
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.17
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH