NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|8569414]
View 

Protein Classification

PRK11423 family protein (domain architecture ID 10793571)

PRK11423 family protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
PRK11423 PRK11423
methylmalonyl-CoA decarboxylase; Provisional
1-261 0e+00

methylmalonyl-CoA decarboxylase; Provisional


:

Pssm-ID: 236908  Cd Length: 261  Bit Score: 496.86  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414     1 MSYQYVNVVTINKVAVIEFNYGRKLNALSKVFIDDLMQALSDLNRPEIRCIILRAPSGSKVFSAGHDIHELPSGGRDPLS 80
Cdd:PRK11423   1 MSMQYVNVVTINKIATITFNNPAKRNALSKVLIDDLMQALSDLNRPEIRVVILRAPSGSKVWSAGHDIHELPSGGRDPLS 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    81 YDDPLRQITRMIQKFPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGVPYNLVGIHNLTRDAGFHIVKEL 160
Cdd:PRK11423  81 YDDPLRQILRMIQKFPKPVIAMVEGSVWGGAFELIMSCDLIIAASTSTFAMTPANLGVPYNLSGILNFTNDAGFHIVKEM 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414   161 IFTASPITAQRALAVGILNHVVEVEELEDFTLQMAHHISEKAPLAIAVIKEELRVLGEAHTMNSDEFERIQGMRRAVYDS 240
Cdd:PRK11423 161 FFTASPITAQRALAVGILNHVVEVEELEDFTLQMAHHISEKAPLAIAVIKEQLRVLGEAHPMNPDEFERIQGLRRAVYDS 240
                        250       260
                 ....*....|....*....|.
gi 8569414   241 EDYQEGMNAFLEKRKPNFVGH 261
Cdd:PRK11423 241 EDYQEGMNAFLEKRKPVFVGH 261
 
Name Accession Description Interval E-value
PRK11423 PRK11423
methylmalonyl-CoA decarboxylase; Provisional
1-261 0e+00

methylmalonyl-CoA decarboxylase; Provisional


Pssm-ID: 236908  Cd Length: 261  Bit Score: 496.86  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414     1 MSYQYVNVVTINKVAVIEFNYGRKLNALSKVFIDDLMQALSDLNRPEIRCIILRAPSGSKVFSAGHDIHELPSGGRDPLS 80
Cdd:PRK11423   1 MSMQYVNVVTINKIATITFNNPAKRNALSKVLIDDLMQALSDLNRPEIRVVILRAPSGSKVWSAGHDIHELPSGGRDPLS 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    81 YDDPLRQITRMIQKFPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGVPYNLVGIHNLTRDAGFHIVKEL 160
Cdd:PRK11423  81 YDDPLRQILRMIQKFPKPVIAMVEGSVWGGAFELIMSCDLIIAASTSTFAMTPANLGVPYNLSGILNFTNDAGFHIVKEM 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414   161 IFTASPITAQRALAVGILNHVVEVEELEDFTLQMAHHISEKAPLAIAVIKEELRVLGEAHTMNSDEFERIQGMRRAVYDS 240
Cdd:PRK11423 161 FFTASPITAQRALAVGILNHVVEVEELEDFTLQMAHHISEKAPLAIAVIKEQLRVLGEAHPMNPDEFERIQGLRRAVYDS 240
                        250       260
                 ....*....|....*....|.
gi 8569414   241 EDYQEGMNAFLEKRKPNFVGH 261
Cdd:PRK11423 241 EDYQEGMNAFLEKRKPVFVGH 261
CaiD COG1024
Enoyl-CoA hydratase/carnithine racemase [Lipid transport and metabolism];
1-258 2.66e-63

Enoyl-CoA hydratase/carnithine racemase [Lipid transport and metabolism];


Pssm-ID: 223955  Cd Length: 257  Bit Score: 198.78  E-value: 2.66e-63
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    1 MSYQYVNVVTINKVAVIEFNYGRKLNALSKVFIDDLMQALSDLNR-PEIRCIILRapSGSKVFSAGHDIHEL--PSGGRD 77
Cdd:COG1024   2 TTYETILVEREDGIAVITLNRPEKLNALNLEMLDELAEALDEAEAdPDVRVVVLT--GAGKAFSAGADLKELlsPEDGNA 79
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414   78 PLSYDDPLRQITRMIQKFPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGVPYNLVGIHNLTRDAGFHIV 157
Cdd:COG1024  80 AENLMQPGQDLLRALADLPKPVIAAVNGYALGGGLELALACDIRIAAEDAKFGLPEVNLGLLPGDGGTQRLPRLLGRGRA 159
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414  158 KELIFTASPITAQRALAVGILNHVVE-VEELEDFTLQMAHHISeKAPLAIAVIKEELRVLGEAHTMNSDEFERIQGMRRA 236
Cdd:COG1024 160 KELLLTGEPISAAEALELGLVDEVVPdAEELLERALELARRLA-APPLALAATKRLVRAALEADLAEALEAEALAFARLF 238
                       250       260
                ....*....|....*....|..
gi 8569414  237 vyDSEDYQEGMNAFLEkRKPNF 258
Cdd:COG1024 239 --SSEDFREGVRAFLE-RKPVF 257
crotonase-like cd06558
Crotonase/Enoyl-Coenzyme A (CoA) hydratase superfamily. This superfamily contains a diverse ...
6-198 2.40e-54

Crotonase/Enoyl-Coenzyme A (CoA) hydratase superfamily. This superfamily contains a diverse set of enzymes including enoyl-CoA hydratase, napthoate synthase, methylmalonyl-CoA decarboxylase, 3-hydoxybutyryl-CoA dehydratase, and dienoyl-CoA isomerase. Many of these play important roles in fatty acid metabolism. In addition to a conserved structural core and the formation of trimers (or dimers of trimers), a common feature in this superfamily is the stabilization of an enolate anion intermediate derived from an acyl-CoA substrate. This is accomplished by two conserved backbone NH groups in active sites that form an oxyanion hole.


Pssm-ID: 119339 [Multi-domain]  Cd Length: 195  Bit Score: 173.52  E-value: 2.40e-54
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    6 VNVVTINKVAVIEFNYGRKLNALSKVFIDDLMQALSDLNR-PEIRCIILRapSGSKVFSAGHDIHELPSGGRDPLSYD-- 82
Cdd:cd06558   1 VLVERDGGVATITLNRPEKRNALSLEMLDELAAALDEAEAdPDVRVVVLT--GAGKAFCAGADLKELAALSDAGEEARaf 78
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414   83 -DPLRQITRMIQKFPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGVPYNLVGIHNLTRDAGFHIVKELI 161
Cdd:cd06558  79 iRELQELLRALLRLPKPVIAAVNGAALGGGLELALACDIRIAAEDAKFGLPEVKLGLVPGGGGTQRLPRLVGPARARELL 158
                       170       180       190
                ....*....|....*....|....*....|....*..
gi 8569414  162 FTASPITAQRALAVGILNHVVEVEELEDFTLQMAHHI 198
Cdd:cd06558 159 LTGRRISAEEALELGLVDEVVPDEELLAAALELARRL 195
ECH_1 pfam00378
Enoyl-CoA hydratase/isomerase; This family contains a diverse set of enzymes including: ...
12-260 9.62e-45

Enoyl-CoA hydratase/isomerase; This family contains a diverse set of enzymes including: enoyl-CoA hydratase, napthoate synthase, carnitate racemase, 3-hydroxybutyryl-CoA dehydratase and dodecanoyl-CoA delta-isomerase.


Pssm-ID: 334046  Cd Length: 251  Bit Score: 150.98  E-value: 9.62e-45
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414     12 NKVAVIEFNYGRKLNALSKVFIDDLMQALSDL-NRPEIRCIILRapSGSKVFSAGHDIHEL-PSGGRDPLSYDDPLRQIT 89
Cdd:pfam00378   4 AGVAVITLNRPEALNALSAELITELIQALEKLrTDPSVRAVVLT--GGDKAFCAGADLKEMyNEGLAFQASYRENVLDLW 81
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414     90 RMIQKFPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGVPYNLVGIHNLTRDAGFHIVKELIFTASPITA 169
Cdd:pfam00378  82 TLLYTCPKPVIAAVNGYAIGGGCELALACDIIIAADNASFGLNEILIGIIPGAGGTQRLPRIIGHSKAMEMLLTGRRISA 161
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    170 QRALAVGILNHVVEVEELEDFTLQMAHHISEKAPLAIAVIKEEL-----RVLGEAHTMNSDEFERIQgmrravyDSEDYQ 244
Cdd:pfam00378 162 QEALEWGLVDKVVPEEQVLDEARELAEKLAEKSPAHLAQLKEALnaaleDALPTQLEAEARLFYSTF-------STDDRI 234
                         250
                  ....*....|....*.
gi 8569414    245 EGMNAFLEKRKPNFVG 260
Cdd:pfam00378 235 EGLTAFLEKRKPPWED 250
menB TIGR01929
naphthoate synthase (dihydroxynaphthoic acid synthetase); This model represents an enzyme, ...
14-258 3.82e-31

naphthoate synthase (dihydroxynaphthoic acid synthetase); This model represents an enzyme, naphthoate synthase (dihydroxynaphthoic acid synthetase), which is involved in the fifth step of the menaquinone biosynthesis pathway. Together with o-succinylbenzoate-CoA ligase (menE: TIGR01923), this enzyme takes 2-succinylbenzoate and converts it into 1,4-di-hydroxy-2-naphthoate. Included above the trusted cutoff are two enzymes from Arabadopsis thaliana and one from Staphylococcus aureus which are identified as putative enoyl-CoA hydratase/isomerases. These enzymes group with the naphthoate synthases when building a tree and when doing BLAST searches. [Biosynthesis of cofactors, prosthetic groups, and carriers, Menaquinone and ubiquinone]


Pssm-ID: 200143  Cd Length: 259  Bit Score: 115.72  E-value: 3.82e-31
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414     14 VAVIEFNYGRKLNALSKVFIDDLMQALSDLN-RPEIRCIILRApSGSKVFSAGHDIHELPSGGRDPLSYDDPLR--QITR 90
Cdd:TIGR01929  13 IAKITINRPQVRNAFRPLTVKEIIQALDDAReDPDIGVVILTG-AGDKAFCSGGDQKVRGDYGYIDDSGVHRLNvlDVQR 91
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414     91 MIQKFPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGVPYNLVGIHNLTRDAGFHIVKELIFTASPITAQ 170
Cdd:TIGR01929  92 QIRTCPKPVIAMVNGYAIGGGHVLHMMCDLTIAAENARFGQTGPKVGSFDGGYGSSYMARIVGQKKAREIWFLCRQYDAK 171
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    171 RALAVGILNHVVEVEELEDFTLQMAHHISEKAPLAIAVIKEELRVL--GEAHTMnsdefERIQGMRRAVYDSEDYQEGMN 248
Cdd:TIGR01929 172 QALDMGLVNTVVPLADLEKETVRWCREILQKSPMAIRMLKAALNADcdGQAGLQ-----ELAGNATMLFYMTEEGQEGRN 246
                         250
                  ....*....|
gi 8569414    249 AFLEKRKPNF 258
Cdd:TIGR01929 247 AFLEKRQPDF 256
 
Name Accession Description Interval E-value
PRK11423 PRK11423
methylmalonyl-CoA decarboxylase; Provisional
1-261 0e+00

methylmalonyl-CoA decarboxylase; Provisional


Pssm-ID: 236908  Cd Length: 261  Bit Score: 496.86  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414     1 MSYQYVNVVTINKVAVIEFNYGRKLNALSKVFIDDLMQALSDLNRPEIRCIILRAPSGSKVFSAGHDIHELPSGGRDPLS 80
Cdd:PRK11423   1 MSMQYVNVVTINKIATITFNNPAKRNALSKVLIDDLMQALSDLNRPEIRVVILRAPSGSKVWSAGHDIHELPSGGRDPLS 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    81 YDDPLRQITRMIQKFPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGVPYNLVGIHNLTRDAGFHIVKEL 160
Cdd:PRK11423  81 YDDPLRQILRMIQKFPKPVIAMVEGSVWGGAFELIMSCDLIIAASTSTFAMTPANLGVPYNLSGILNFTNDAGFHIVKEM 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414   161 IFTASPITAQRALAVGILNHVVEVEELEDFTLQMAHHISEKAPLAIAVIKEELRVLGEAHTMNSDEFERIQGMRRAVYDS 240
Cdd:PRK11423 161 FFTASPITAQRALAVGILNHVVEVEELEDFTLQMAHHISEKAPLAIAVIKEQLRVLGEAHPMNPDEFERIQGLRRAVYDS 240
                        250       260
                 ....*....|....*....|.
gi 8569414   241 EDYQEGMNAFLEKRKPNFVGH 261
Cdd:PRK11423 241 EDYQEGMNAFLEKRKPVFVGH 261
CaiD COG1024
Enoyl-CoA hydratase/carnithine racemase [Lipid transport and metabolism];
1-258 2.66e-63

Enoyl-CoA hydratase/carnithine racemase [Lipid transport and metabolism];


Pssm-ID: 223955  Cd Length: 257  Bit Score: 198.78  E-value: 2.66e-63
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    1 MSYQYVNVVTINKVAVIEFNYGRKLNALSKVFIDDLMQALSDLNR-PEIRCIILRapSGSKVFSAGHDIHEL--PSGGRD 77
Cdd:COG1024   2 TTYETILVEREDGIAVITLNRPEKLNALNLEMLDELAEALDEAEAdPDVRVVVLT--GAGKAFSAGADLKELlsPEDGNA 79
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414   78 PLSYDDPLRQITRMIQKFPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGVPYNLVGIHNLTRDAGFHIV 157
Cdd:COG1024  80 AENLMQPGQDLLRALADLPKPVIAAVNGYALGGGLELALACDIRIAAEDAKFGLPEVNLGLLPGDGGTQRLPRLLGRGRA 159
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414  158 KELIFTASPITAQRALAVGILNHVVE-VEELEDFTLQMAHHISeKAPLAIAVIKEELRVLGEAHTMNSDEFERIQGMRRA 236
Cdd:COG1024 160 KELLLTGEPISAAEALELGLVDEVVPdAEELLERALELARRLA-APPLALAATKRLVRAALEADLAEALEAEALAFARLF 238
                       250       260
                ....*....|....*....|..
gi 8569414  237 vyDSEDYQEGMNAFLEkRKPNF 258
Cdd:COG1024 239 --SSEDFREGVRAFLE-RKPVF 257
crotonase-like cd06558
Crotonase/Enoyl-Coenzyme A (CoA) hydratase superfamily. This superfamily contains a diverse ...
6-198 2.40e-54

Crotonase/Enoyl-Coenzyme A (CoA) hydratase superfamily. This superfamily contains a diverse set of enzymes including enoyl-CoA hydratase, napthoate synthase, methylmalonyl-CoA decarboxylase, 3-hydoxybutyryl-CoA dehydratase, and dienoyl-CoA isomerase. Many of these play important roles in fatty acid metabolism. In addition to a conserved structural core and the formation of trimers (or dimers of trimers), a common feature in this superfamily is the stabilization of an enolate anion intermediate derived from an acyl-CoA substrate. This is accomplished by two conserved backbone NH groups in active sites that form an oxyanion hole.


Pssm-ID: 119339 [Multi-domain]  Cd Length: 195  Bit Score: 173.52  E-value: 2.40e-54
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    6 VNVVTINKVAVIEFNYGRKLNALSKVFIDDLMQALSDLNR-PEIRCIILRapSGSKVFSAGHDIHELPSGGRDPLSYD-- 82
Cdd:cd06558   1 VLVERDGGVATITLNRPEKRNALSLEMLDELAAALDEAEAdPDVRVVVLT--GAGKAFCAGADLKELAALSDAGEEARaf 78
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414   83 -DPLRQITRMIQKFPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGVPYNLVGIHNLTRDAGFHIVKELI 161
Cdd:cd06558  79 iRELQELLRALLRLPKPVIAAVNGAALGGGLELALACDIRIAAEDAKFGLPEVKLGLVPGGGGTQRLPRLVGPARARELL 158
                       170       180       190
                ....*....|....*....|....*....|....*..
gi 8569414  162 FTASPITAQRALAVGILNHVVEVEELEDFTLQMAHHI 198
Cdd:cd06558 159 LTGRRISAEEALELGLVDEVVPDEELLAAALELARRL 195
PRK06127 PRK06127
enoyl-CoA hydratase; Provisional
14-261 1.13e-47

enoyl-CoA hydratase; Provisional


Pssm-ID: 235705  Cd Length: 269  Bit Score: 159.10  E-value: 1.13e-47
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    14 VAVIEFNYGRKLNALSKVFIDDLMQALSDL-NRPEIRCIILRApSGSKVFSAGHDIHELPSGGRDP---LSYDDPLRQIT 89
Cdd:PRK06127  21 LGRITFNNPARHNAMSLDMWEALPQALAAAeDDDAIRVVVLTG-AGEKAFVSGADISQFEESRSDAeavAAYEQAVEAAQ 99
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    90 RMIQKFPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGVPYNLVGIHNLTRDAGFHIVKELIFTASPITA 169
Cdd:PRK06127 100 AALADYAKPTIACIRGYCIGGGMGIALACDIRIAAEDSRFGIPAARLGLGYGYDGVKNLVDLVGPSAAKDLFYTARRFDA 179
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414   170 QRALAVGILNHVVEVEELEDFTLQMAHHISEKAPLAIAVIKEELR-VLGEAHTMNSDefeRIQGMRRAVYDSEDYQEGMN 248
Cdd:PRK06127 180 AEALRIGLVHRVTAADDLETALADYAATIAGNAPLTLRAAKRAIAeLLKDEPERDMA---ACQALVAACFDSEDYREGRA 256
                        250
                 ....*....|...
gi 8569414   249 AFLEKRKPNFVGH 261
Cdd:PRK06127 257 AFMEKRKPVFKGR 269
PRK06688 PRK06688
enoyl-CoA hydratase; Provisional
6-261 1.02e-45

enoyl-CoA hydratase; Provisional


Pssm-ID: 235852  Cd Length: 259  Bit Score: 153.49  E-value: 1.02e-45
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414     6 VNVVTINKVAVIEFNYGRKLNALSkvfiDDLMQALSD-LNR----PEIRCIILRapsGS-KVFSAGHDIHELPSGGRDPL 79
Cdd:PRK06688   7 LLVELEDGVLTITINRPDKKNALT----AAMYQALADaLEAaatdPAVRVVVLT---GAgRAFSAGGDIKDFPKAPPKPP 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    80 SYDDPLRQITRMIQKFPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGVPYNLVGIHNLTRDAGFHIVKE 159
Cdd:PRK06688  80 DELAPVNRFLRAIAALPKPVVAAVNGPAVGVGVSLALACDLVYASESAKFSLPFAKLGLCPDAGGSALLPRLIGRARAAE 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414   160 LIFTASPITAQRALAVGILNHVVEVEELEDFTLQMAHHISEKAPLAIAVIKeelRVLGEAHTMNSDE-FER-IQGMRRaV 237
Cdd:PRK06688 160 MLLLGEPLSAEEALRIGLVNRVVPAAELDAEADAQAAKLAAGPASALRYTK---RAINAATLTELEEaLAReAAGFGR-L 235
                        250       260
                 ....*....|....*....|....
gi 8569414   238 YDSEDYQEGMNAFLEKRKPNFVGH 261
Cdd:PRK06688 236 LRTPDFREGATAFIEKRKPDFTGF 259
ECH_1 pfam00378
Enoyl-CoA hydratase/isomerase; This family contains a diverse set of enzymes including: ...
12-260 9.62e-45

Enoyl-CoA hydratase/isomerase; This family contains a diverse set of enzymes including: enoyl-CoA hydratase, napthoate synthase, carnitate racemase, 3-hydroxybutyryl-CoA dehydratase and dodecanoyl-CoA delta-isomerase.


Pssm-ID: 334046  Cd Length: 251  Bit Score: 150.98  E-value: 9.62e-45
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414     12 NKVAVIEFNYGRKLNALSKVFIDDLMQALSDL-NRPEIRCIILRapSGSKVFSAGHDIHEL-PSGGRDPLSYDDPLRQIT 89
Cdd:pfam00378   4 AGVAVITLNRPEALNALSAELITELIQALEKLrTDPSVRAVVLT--GGDKAFCAGADLKEMyNEGLAFQASYRENVLDLW 81
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414     90 RMIQKFPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGVPYNLVGIHNLTRDAGFHIVKELIFTASPITA 169
Cdd:pfam00378  82 TLLYTCPKPVIAAVNGYAIGGGCELALACDIIIAADNASFGLNEILIGIIPGAGGTQRLPRIIGHSKAMEMLLTGRRISA 161
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    170 QRALAVGILNHVVEVEELEDFTLQMAHHISEKAPLAIAVIKEEL-----RVLGEAHTMNSDEFERIQgmrravyDSEDYQ 244
Cdd:pfam00378 162 QEALEWGLVDKVVPEEQVLDEARELAEKLAEKSPAHLAQLKEALnaaleDALPTQLEAEARLFYSTF-------STDDRI 234
                         250
                  ....*....|....*.
gi 8569414    245 EGMNAFLEKRKPNFVG 260
Cdd:pfam00378 235 EGLTAFLEKRKPPWED 250
PRK08138 PRK08138
enoyl-CoA hydratase; Provisional
11-260 9.66e-45

enoyl-CoA hydratase; Provisional


Pssm-ID: 236162  Cd Length: 261  Bit Score: 151.36  E-value: 9.66e-45
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    11 INKVAVIEFNYGRKLNALSkvfiDDLMQALSDL-----NRPEIRCIILRApsGSKVFSAGHDIHELPSGGrdplSYDDPL 85
Cdd:PRK08138  15 ADGVALLRLNRPEARNALN----MEVRQQLAEHftelsEDPDIRAIVLTG--GEKVFAAGADIKEFATAG----AIEMYL 84
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    86 RQITRM---IQKFPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGVPYNLVGIHNLTRDAGFHIVKELIF 162
Cdd:PRK08138  85 RHTERYweaIAQCPKPVIAAVNGYALGGGCELAMHADIIVAGESASFGQPEIKVGLMPGAGGTQRLVRAVGKFKAMRMAL 164
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414   163 TASPITAQRALAVGILNHVVEVEELEDFTLQMAHHISEKAPLAIAVIKEELrVLGEAHTMNSdeferiqGM---RRA--- 236
Cdd:PRK08138 165 TGCMVPAPEALAIGLVSEVVEDEQTLPRALELAREIARMPPLALAQIKEVV-LAGADAPLDA-------ALaleRKAfql 236
                        250       260
                 ....*....|....*....|....
gi 8569414   237 VYDSEDYQEGMNAFLEKRKPNFVG 260
Cdd:PRK08138 237 LFDSEDQKEGMDAFLEKRKPAYKG 260
PRK05980 PRK05980
enoyl-CoA hydratase; Provisional
14-258 5.13e-44

enoyl-CoA hydratase; Provisional


Pssm-ID: 180335  Cd Length: 260  Bit Score: 149.14  E-value: 5.13e-44
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    14 VAVIEFNYGRKLNALSKVFIDDLMQALSDLNR-PEIRCIILRApSGSKVFSAGHDIHELP---SGGRDPLSYDDPLR--Q 87
Cdd:PRK05980  13 IALLTLNRPEKLNALNYALIDRLLARLDAIEVdESVRAVILTG-AGDRAFSAGADIHEFSasvAAGADVALRDFVRRgqA 91
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    88 ITRMIQKFPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGVPYNLVGIHNLTRDAGFHIVKELIFTASPI 167
Cdd:PRK05980  92 MTARLEAFPKPVIAAVNGLAFGGGCEITEAVHLAIASERALFAKPEIRLGMPPTFGGTQRLPRLAGRKRALELLLTGDAF 171
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414   168 TAQRALAVGILNHVVEVEELEDFTLQMAHHISEKAPLAI-AVIKEELRVL----GEAHTMNSDEFERIQGmrravydSED 242
Cdd:PRK05980 172 SAERALEIGLVNAVVPHEELLPAARALARRIIRHSPVAVaAILTAVTRGLnlsiAEGLLIESEQFARMAG-------SAD 244
                        250
                 ....*....|....*.
gi 8569414   243 YQEGMNAFLEKRKPNF 258
Cdd:PRK05980 245 LREGLAAWIERRRPAY 260
PRK07658 PRK07658
enoyl-CoA hydratase; Provisional
14-260 3.96e-41

enoyl-CoA hydratase; Provisional


Pssm-ID: 181070  Cd Length: 257  Bit Score: 141.70  E-value: 3.96e-41
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    14 VAVIEFNYgRKLNALSKVFIDDLMQALSDL-NRPEIRCIILRAPSgsKVFSAGHDIHELPS--GGRDPLSYDDPLRQITR 90
Cdd:PRK07658  12 VAVITLNH-PPANALSSQVLHELSELLDQVeKDDNVRVVVIHGEG--RFFSAGADIKEFTSvtEAEQATELAQLGQVTFE 88
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    91 MIQKFPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGVPYNLVGIHNLTRDAGFHIVKELIFTASPITAQ 170
Cdd:PRK07658  89 RVEKFSKPVIAAIHGAALGGGLELAMSCHIRFATESAKLGLPELNLGLIPGFAGTQRLPRYVGKAKALEMMLTSEPITGA 168
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414   171 RALAVGILNHVVEVEELEDFTLQMAHHISEKAPLAIAVIKEELrvlgeaHTMNSDEFEriQGMRR------AVYDSEDYQ 244
Cdd:PRK07658 169 EALKWGLVNGVFPEETLLDDAKKLAKKIAGKSPATTRAVLELL------QTTKSSSYY--EGVKReakifgEVFTSEDAK 240
                        250
                 ....*....|....*.
gi 8569414   245 EGMNAFLEKRKPNFVG 260
Cdd:PRK07658 241 EGVQAFLEKRKPSFSG 256
PRK07657 PRK07657
enoyl-CoA hydratase; Provisional
2-260 7.75e-39

enoyl-CoA hydratase; Provisional


Pssm-ID: 181069  Cd Length: 260  Bit Score: 136.02  E-value: 7.75e-39
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414     2 SYQYVNvvtiNKVAVIEFNYGRKLNALSKVFIDDLMQALSDLN-RPEIRCIILRApSGSKVFSAGHDIHElpsggRDPLS 80
Cdd:PRK07657   6 SVDYVT----PHVVKITLNRPRAANALSLALLEELQNILTQINeEANVRVVILTG-AGEKAFCAGADLKE-----RAGMN 75
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    81 yDDPLRQITRMIQ-------KFPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGVPYNLVGIHNLTRDAG 153
Cdd:PRK07657  76 -EEQVRHAVSLIRttmemveQLPQPVIAAINGIALGGGLELALACDFRIAAESASLGLTETTLAIIPGAGGTQRLPRLIG 154
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414   154 FHIVKELIFTASPITAQRALAVGILNHVVEVEELEDFTLQMAHHISEKAPLAIAVIKEELRvlgeaHTMNSDEFERIQgM 233
Cdd:PRK07657 155 VGRAKELIYTGRRISAQEAKEIGLVEFVVPAHLLEEKAIEIAEKIASNGPIAVRQAKEAIS-----NGIQVDLHTGLQ-I 228
                        250       260       270
                 ....*....|....*....|....*....|.
gi 8569414   234 RRAVYD----SEDYQEGMNAFLEKRKPNFVG 260
Cdd:PRK07657 229 EKQAYEgtipTKDRLEGLQAFKEKRKPMYKG 259
PRK08139 PRK08139
enoyl-CoA hydratase; Validated
14-260 2.49e-38

enoyl-CoA hydratase; Validated


Pssm-ID: 181249  Cd Length: 266  Bit Score: 134.68  E-value: 2.49e-38
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    14 VAVIEFNYGRKLNALSKVFIDDLMQALSDLNR-PEIRCIILRApSGsKVFSAGHDIHELpSGGRDPLSYDDPLRQITRM- 91
Cdd:PRK08139  21 VATLTLNRPQAFNALSEAMLAALQAALDAIAAdPSVRVVVLAA-AG-KAFCAGHDLKEM-RAARGLAYFRALFARCSRVm 97
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    92 --IQKFPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGV----PynLVGI-HNLTRDAGFhivkELIFTA 164
Cdd:PRK08139  98 qaIVALPQPVIARVHGIATAAGCQLVASCDLAVAADTARFAVPGVNIGLfcstP--MVALsRNVPRKQAM----EMLLTG 171
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414   165 SPITAQRALAVGILNHVVEVEELEDFTLQMAHHISEKAPLAIAVIKE------ELRvLGEAHTMNSDEferiqgMRRAVY 238
Cdd:PRK08139 172 EFIDAATAREWGLVNRVVPADALDAAVARLAAVIAAKSPAAVRIGKEafyrqaEMP-LADAYAYAGDV------MAENMM 244
                        250       260
                 ....*....|....*....|..
gi 8569414   239 DsEDYQEGMNAFLEKRKPNFVG 260
Cdd:PRK08139 245 A-EDAEEGIDAFLEKRPPEWRG 265
PRK09674 PRK09674
enoyl-CoA hydratase-isomerase; Provisional
3-260 2.16e-37

enoyl-CoA hydratase-isomerase; Provisional


Pssm-ID: 182026  Cd Length: 255  Bit Score: 131.81  E-value: 2.16e-37
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414     3 YQYVNVVTINKVAViefnygrkLNALSKVFIDDLMQALSDLNR-PEIRCIILRApsGSKVFSAGHDIHELPSggRD-PLS 80
Cdd:PRK09674   9 QQRVLLLTLNRPEA--------RNALNNALLTQLVNELEAAATdTSIGVCVITG--NARFFAAGADLNEMAE--KDlAAT 76
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    81 YDDPLRQITRMIQKFPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGVPYNLVGIHNLTRDAGFHIVKEL 160
Cdd:PRK09674  77 LNDPRPQLWQRLQAFNKPLIAAVNGYALGAGCELALLCDIVIAGENARFGLPEITLGIMPGAGGTQRLIRSVGKSLASQM 156
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414   161 IFTASPITAQRALAVGILNHVVEVEELEDFTLQMAHHISEKAPLAIAVIKEELRVLGEAHTMNSDEFERIQGMRRAvyDS 240
Cdd:PRK09674 157 VLTGESITAQQAQQAGLVSEVFPPELTLERALQLASKIARHSPLALRAAKQALRQSQEVDLQAGLAQERQLFTLLA--AT 234
                        250       260
                 ....*....|....*....|
gi 8569414   241 EDYQEGMNAFLEKRKPNFVG 260
Cdd:PRK09674 235 EDRHEGISAFLEKRTPDFKG 254
PRK06144 PRK06144
enoyl-CoA hydratase; Provisional
12-260 3.83e-37

enoyl-CoA hydratase; Provisional


Pssm-ID: 180424  Cd Length: 262  Bit Score: 131.65  E-value: 3.83e-37
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    12 NKVAVIEFNYGRKLNALSKVFIDDLMQALSDLNR-PEIRCIILRApSGSKVFSAGHDIHELP--SGGRDPLSYDDPLRQI 88
Cdd:PRK06144  16 GGIARITFNRPAARNAMTWAMYEGLAEICEAIAAdPSIRAVVLRG-AGDKAFVAGTDIAQFRafSTAEDAVAYERRIDRV 94
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    89 TRMIQKFPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFsmtpvnlGVPY-----NLVGIHNLTRDAGfHI----VKE 159
Cdd:PRK06144  95 LGALEQLRVPTIAAIAGACVGGGAAIAAACDLRIATPSARF-------GFPIartlgNCLSMSNLARLVA-LLgaarVKD 166
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414   160 LIFTASPITAQRALAVGILNHVVEVEELEDFTLQMAHHISEKAPLAIAVIKEEL-RVLGEAHTMNSDeferiqgMRRAVY 238
Cdd:PRK06144 167 MLFTARLLEAEEALAAGLVNEVVEDAALDARADALAELLAAHAPLTLRATKEALrRLRREGLPDGDD-------LIRMCY 239
                        250       260
                 ....*....|....*....|..
gi 8569414   239 DSEDYQEGMNAFLEKRKPNFVG 260
Cdd:PRK06144 240 MSEDFREGVEAFLEKRPPKWKG 261
PRK03580 PRK03580
carnitinyl-CoA dehydratase; Provisional
9-261 1.75e-36

carnitinyl-CoA dehydratase; Provisional


Pssm-ID: 179599  Cd Length: 261  Bit Score: 129.81  E-value: 1.75e-36
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414     9 VTIN--KVAVIEFNYGRKLNALSKVFIDDlmqalsdlnrPEIRCIILRApSGSKVFSAGHDIHELPSGgrDPLSYDDPLR 86
Cdd:PRK03580  16 ITLDrpKANAIDAKTSFAMGEVFLNFRDD----------PELRVAIITG-AGEKFFSAGWDLKAAAEG--EAPDADFGPG 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    87 QITRMIQKFP--KPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGVPYNLVGIHNLTRDAGFHIVKELIFTA 164
Cdd:PRK03580  83 GFAGLTEIFDldKPVIAAVNGYAFGGGFELALAADFIVCADNASFALPEAKLGIVPDSGGVLRLPKRLPPAIANEMVMTG 162
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414   165 SPITAQRALAVGILNHVVEVEELEDFTLQMAHHISEKAPLAIAVIKEELRVLGEA------HTMNSDEFERIqgmrRAVY 238
Cdd:PRK03580 163 RRMDAEEALRWGIVNRVVPQAELMDRARELAQQLVNSAPLAIAALKEIYRETSEMpveeayRYIRSGVLKHY----PSVL 238
                        250       260
                 ....*....|....*....|...
gi 8569414   239 DSEDYQEGMNAFLEKRKPNFVGH 261
Cdd:PRK03580 239 HSEDALEGPRAFAEKRDPVWKGR 261
PRK08252 PRK08252
enoyl-CoA hydratase; Provisional
6-260 9.29e-36

enoyl-CoA hydratase; Provisional


Pssm-ID: 181325  Cd Length: 254  Bit Score: 127.80  E-value: 9.29e-36
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414     6 VNVVTINKVAVIEFNYGRKLNALSKVFIDDLMQALSDL-NRPEIRCIILRAPSGSkvFSAGHDIHELPSGGRDPLsyddP 84
Cdd:PRK08252   5 VLVERRGRVLIITINRPEARNAVNAAVAQGLAAALDELdADPDLSVGILTGAGGT--FCAGMDLKAFARGERPSI----P 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    85 LRQITRMIQKFP-KPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGvpynLV----GIHNLTRDAGFHIVKE 159
Cdd:PRK08252  79 GRGFGGLTERPPrKPLIAAVEGYALAGGFELALACDLIVAARDAKFGLPEVKRG----LVaaggGLLRLPRRIPYHIAME 154
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414   160 LIFTASPITAQRALAVGILNHVVEVEELEDFTLQMAHHISEKAPLAIAVIKeelRVLGEAHTMNSDE-FERIQGMRRAVY 238
Cdd:PRK08252 155 LALTGDMLTAERAHELGLVNRLTEPGQALDAALELAERIAANGPLAVAASK---RIVVESGDWSEDEmFARQRELIAPVF 231
                        250       260
                 ....*....|....*....|..
gi 8569414   239 DSEDYQEGMNAFLEKRKPNFVG 260
Cdd:PRK08252 232 TSADAKEGATAFAEKRAPVWTG 253
PRK06494 PRK06494
enoyl-CoA hydratase; Provisional
1-260 1.28e-35

enoyl-CoA hydratase; Provisional


Pssm-ID: 180591  Cd Length: 259  Bit Score: 127.46  E-value: 1.28e-35
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414     1 MSYQYVNVVTINKVAVIEFNYGRKLNALSKVFIDDLMQALSDLNR-PEIRCIILRApSGSKVFSAGHDIHELPSGGR--- 76
Cdd:PRK06494   1 MALPFSTVERKGHVTIVTLNRPEVMNALHLDAHFELEEVFDDFAAdPEQWVAIVTG-AGDKAFSAGNDLKEQAAGGKrgw 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    77 DPLSYDDplrqITRMiQKFPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGVPYNLVGIHNLTRDAGFHI 156
Cdd:PRK06494  80 PESGFGG----LTSR-FDLDKPIIAAVNGVAMGGGFELALACDLIVAAENATFALPEPRVGLAALAGGLHRLPRQIGLKR 154
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414   157 VKELIFTASPITAQRALAVGILNHVVEVEELEDFTLQMAHHISEKAPLAIAVIKEEL-----RVLGEAHTMNSDeFERIQ 231
Cdd:PRK06494 155 AMGMILTGRRVTAREGLELGFVNEVVPAGELLAAAERWADDILACSPLSIRASKQAVyrgleVSLEEAITAQRD-YPAVE 233
                        250       260
                 ....*....|....*....|....*....
gi 8569414   232 GMRRavydSEDYQEGMNAFLEKRKPNFVG 260
Cdd:PRK06494 234 ARRA----SQDYIEGPKAFAEKRPPRWKG 258
PRK05809 PRK05809
3-hydroxybutyryl-CoA dehydratase; Validated
1-258 2.09e-35

3-hydroxybutyryl-CoA dehydratase; Validated


Pssm-ID: 180270  Cd Length: 260  Bit Score: 126.79  E-value: 2.09e-35
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414     1 MSYQYVNVVTINKVAVIEFNYGRKLNALSKVFIDDLMQALSDL-NRPEIRCIILRApSGSKVFSAGHDIHEL----PSGG 75
Cdd:PRK05809   1 MELKNVILEKEGHIAVVTINRPKALNALNSETLKELDTVLDDIeNDDNVYAVILTG-AGEKAFVAGADISEMkdlnEEEG 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    76 RDPLSYDDplrQITRMIQKFPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGVPYNLVGIHNLTRDAGFH 155
Cdd:PRK05809  80 RKFGLLGN---KVFRKLENLDKPVIAAINGFALGGGCELSMACDIRIASEKAKFGQPEVGLGITPGFGGTQRLARIVGPG 156
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414   156 IVKELIFTASPITAQRALAVGILNHVVEVEELEDFTLQMAHHISEKAPLAIAVIKEELRVLGEAHTMNSDEFE-RIQGMr 234
Cdd:PRK05809 157 KAKELIYTGDMINAEEALRIGLVNKVVEPEKLMEEAKALANKIAANAPIAVKLCKDAINRGMQVDIDTAVAIEaEDFGE- 235
                        250       260
                 ....*....|....*....|....
gi 8569414   235 raVYDSEDYQEGMNAFLEKRKPNF 258
Cdd:PRK05809 236 --CFSTEDQTEGMTAFVEKREKNF 257
PRK06563 PRK06563
enoyl-CoA hydratase; Provisional
14-260 5.32e-35

enoyl-CoA hydratase; Provisional


Pssm-ID: 180625  Cd Length: 255  Bit Score: 125.84  E-value: 5.32e-35
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    14 VAVIEFNYGRKLNALSKVFIDDLMQALSDLNR-PEIRCIILRAPSgsKVFSAGHDIHEL-----------PSGGRDPLSY 81
Cdd:PRK06563   9 VLLIGLDRPAKRNAFDSAMLDDLALALGEYEAdDELRVAVLFAHG--EHFTAGLDLADVapklaaggfpfPEGGIDPWGT 86
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    82 DDPLRQitrmiqkfpKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGVpYNLVGIH-NLTRDAGFHIVKEL 160
Cdd:PRK06563  87 VGRRLS---------KPLVVAVQGYCLTLGIELMLAADIVVAADNTRFAQLEVQRGI-LPFGGATlRFPQAAGWGNAMRY 156
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414   161 IFTASPITAQRALAVGILNHVVEVEELEDFTLQMAHHISEKAPLAI-AVIKEELRVLGEAHTMnsdEFERIQGMRRAVYD 239
Cdd:PRK06563 157 LLTGDEFDAQEALRLGLVQEVVPPGEQLERAIELAERIARAAPLGVqATLASARAAVREGEAA---AAAQLPPELRPLFT 233
                        250       260
                 ....*....|....*....|.
gi 8569414   240 SEDYQEGMNAFLEKRKPNFVG 260
Cdd:PRK06563 234 SEDAKEGVQAFLERRPARFKG 254
PRK06495 PRK06495
enoyl-CoA hydratase; Provisional
4-260 9.83e-35

enoyl-CoA hydratase; Provisional


Pssm-ID: 168580  Cd Length: 257  Bit Score: 125.19  E-value: 9.83e-35
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414     4 QYVNVVTINKVAViefnygrklNALSKVFIDDLMQALSDLN-RPEIRCIILRApsGSKVFSAGHDIHELPSGGRDPLSYD 82
Cdd:PRK06495  12 DHVAVVTLDNPPV---------NALSRELRDELIAVFDEISeRPDVRVVVLTG--AGKVFCAGADLKGRPDVIKGPGDLR 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    83 DPLRqITR----MIQKFPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGVpynLVGIHNLTRDAGFHIVK 158
Cdd:PRK06495  81 AHNR-RTRecfhAIRECAKPVIAAVNGPALGAGLGLVASCDIIVASENAVFGLPEIDVGL---AGGGKHAMRLFGHSLTR 156
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414   159 ELIFTASPITAQRALAVGILNHVVEVEELEDFTLQMAHHISEKAPLAIAVIKEELRVLGEAHTMNSDEFEriQGMRRAVY 238
Cdd:PRK06495 157 RMMLTGYRVPAAELYRRGVIEACLPPEELMPEAMEIAREIASKSPLATRLAKDALNTIENMSLRDGYRYE--QDITAKLA 234
                        250       260
                 ....*....|....*....|..
gi 8569414   239 DSEDYQEGMNAFLEKRKPNFVG 260
Cdd:PRK06495 235 KTEDAKEAQRAFLEKRPPVFKG 256
PRK05862 PRK05862
enoyl-CoA hydratase; Provisional
1-258 3.27e-33

enoyl-CoA hydratase; Provisional


Pssm-ID: 180295  Cd Length: 257  Bit Score: 120.92  E-value: 3.27e-33
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414     1 MSYQYVNVVTINKVAVIEFNYGRKLNALSKVFIDDLMQALSDLNR-PEIRCIILrapSGS-KVFSAGHDIHELPsggrdP 78
Cdd:PRK05862   1 MAYETILVETRGRVGLITLNRPKALNALNDALMDELGAALAAFDAdEGIGAIVI---TGSeKAFAAGADIKEMA-----D 72
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    79 LSYDDPLRQ--IT--RMIQKFPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGVPYNLVGIHNLTRDAGF 154
Cdd:PRK05862  73 LSFMDVYKGdyITnwEKVARIRKPVIAAVAGYALGGGCELAMMCDIIIAADTAKFGQPEIKLGVLPGMGGSQRLTRAVGK 152
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414   155 HIVKELIFTASPITAQRALAVGILNHVVEVEELEDFTLQMAHHISEKAPLAIAVIKEELRVLGEAHTMNSDEFERiqGMR 234
Cdd:PRK05862 153 AKAMDLCLTGRMMDAAEAERAGLVSRVVPADKLLDEALAAATTIASFSLPAVMMAKEAVNRAYETTLAEGLLFER--RLF 230
                        250       260
                 ....*....|....*....|....
gi 8569414   235 RAVYDSEDYQEGMNAFLEKRKPNF 258
Cdd:PRK05862 231 HSLFATEDQKEGMAAFVEKRKPVF 254
PRK08290 PRK08290
enoyl-CoA hydratase; Provisional
1-211 3.86e-33

enoyl-CoA hydratase; Provisional


Pssm-ID: 236220  Cd Length: 288  Bit Score: 121.61  E-value: 3.86e-33
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414     1 MSYQYVNVVTINKVAVIEFNYGRKLNALSKVFIDDLMQALSD-LNRPEIRCIILRApSGsKVFSAGHDIHE-------LP 72
Cdd:PRK08290   1 MEYEYVRYEVAGRIARITLNRPEARNAQNRQMLYELDAAFRRaEADDAVRVIVLAG-AG-KHFSAGHDLGSgtpgrdrDP 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    73 SGGRDPLSYDDPLR----------------QITRMIQKFPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNL 136
Cdd:PRK08290  79 GPDQHPTLWWDGATkpgveqryarewevylGMCRRWRDLPKPTIAQVQGACIAGGLMLAWVCDLIVASDDAFFSDPVVRM 158
                        170       180       190       200       210       220       230
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 8569414   137 GVPYNLVGIHnlTRDAGFHIVKELIFTASPITAQRALAVGILNHVVEVEELEDFTLQMAHHISEKAPLAIAVIKE 211
Cdd:PRK08290 159 GIPGVEYFAH--PWELGPRKAKELLFTGDRLTADEAHRLGMVNRVVPRDELEAETLELARRIAAMPPFGLRLTKR 231
PRK05995 PRK05995
enoyl-CoA hydratase; Provisional
1-260 4.38e-33

enoyl-CoA hydratase; Provisional


Pssm-ID: 235664  Cd Length: 262  Bit Score: 120.80  E-value: 4.38e-33
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414     1 MSYQYVNVVTINKVAVIEFNYGRKLNALSKVFIDDLMQALSDLN-RPEIRCIILrAPSGsKVFSAGHDiheLPSGGR--- 76
Cdd:PRK05995   1 MMYETLEIEQRGQVATVTLNRPDVRNAFNETVIAELTAAFRALDaDDSVRAVVL-AGAG-KAFCAGAD---LNWMKKmag 75
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    77 --------DPLSYDDPLRQITRMiqkfPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGV------PYnl 142
Cdd:PRK05995  76 ysddenraDARRLADMLRAIYRC----PKPVIARVHGDAYAGGMGLVAACDIAVAADHAVFCLSEVRLGLipatisPY-- 149
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414   143 vgihnLTRDAGFHIVKELIFTASPITAQRALAVGILNHVVEVEELEDFTLQMAHHISEKAPLAIAVIKEELR-VLGEAHT 221
Cdd:PRK05995 150 -----VIRAMGERAARRYFLTAERFDAAEALRLGLVHEVVPAEALDAKVDELLAALVANSPQAVRAGKRLVRdVAGRPID 224
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|.
gi 8569414   222 MNSDEF--ERIqGMRRAvydSEDYQEGMNAFLEKRKPNFVG 260
Cdd:PRK05995 225 AALIADtaSRI-ALIRA---TEEAREGVAAFLEKRKPAWRG 261
PRK07511 PRK07511
enoyl-CoA hydratase; Provisional
8-260 1.28e-32

enoyl-CoA hydratase; Provisional


Pssm-ID: 181009  Cd Length: 260  Bit Score: 119.72  E-value: 1.28e-32
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414     8 VVTINkvaviefNYGRKlNALSKVFIDDLMQALSDLNR-PEIRCIILRAPSGskVFSAGHDIHEL-------PSGGRDPL 79
Cdd:PRK07511  15 VLTLS-------NPGAR-NALHPDMYAAGIEALNTAERdPSIRAVVLTGAGG--FFCAGGNLNRLlenrakpPSVQAASI 84
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    80 sydDPLRQITRMIQKFPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGvpynlvgihnLTRDAGF----- 154
Cdd:PRK07511  85 ---DGLHDWIRAIRAFPKPVIAAVEGAAAGAGFSLALACDLLVAARDAKFVMAYVKVG----------LTPDGGGswfla 151
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414   155 -----HIVKELIFTASPITAQRALAVGILNHVVEVEELEDFTLQMAHHISEKAPLAIAVIKEELRVLGEAHTMNSDEFER 229
Cdd:PRK07511 152 ralprQLATELLLEGKPISAERLHALGVVNRLAEPGQALAEALALADQLAAGSPNALARIKSLIADAPEATLAAQLEAER 231
                        250       260       270
                 ....*....|....*....|....*....|.
gi 8569414   230 iQGMRRAVYDsEDYQEGMNAFLEKRKPNFVG 260
Cdd:PRK07511 232 -DHFVASLHH-ADALEGIAAFLEKRAPDYKR 260
menB TIGR01929
naphthoate synthase (dihydroxynaphthoic acid synthetase); This model represents an enzyme, ...
14-258 3.82e-31

naphthoate synthase (dihydroxynaphthoic acid synthetase); This model represents an enzyme, naphthoate synthase (dihydroxynaphthoic acid synthetase), which is involved in the fifth step of the menaquinone biosynthesis pathway. Together with o-succinylbenzoate-CoA ligase (menE: TIGR01923), this enzyme takes 2-succinylbenzoate and converts it into 1,4-di-hydroxy-2-naphthoate. Included above the trusted cutoff are two enzymes from Arabadopsis thaliana and one from Staphylococcus aureus which are identified as putative enoyl-CoA hydratase/isomerases. These enzymes group with the naphthoate synthases when building a tree and when doing BLAST searches. [Biosynthesis of cofactors, prosthetic groups, and carriers, Menaquinone and ubiquinone]


Pssm-ID: 200143  Cd Length: 259  Bit Score: 115.72  E-value: 3.82e-31
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414     14 VAVIEFNYGRKLNALSKVFIDDLMQALSDLN-RPEIRCIILRApSGSKVFSAGHDIHELPSGGRDPLSYDDPLR--QITR 90
Cdd:TIGR01929  13 IAKITINRPQVRNAFRPLTVKEIIQALDDAReDPDIGVVILTG-AGDKAFCSGGDQKVRGDYGYIDDSGVHRLNvlDVQR 91
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414     91 MIQKFPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGVPYNLVGIHNLTRDAGFHIVKELIFTASPITAQ 170
Cdd:TIGR01929  92 QIRTCPKPVIAMVNGYAIGGGHVLHMMCDLTIAAENARFGQTGPKVGSFDGGYGSSYMARIVGQKKAREIWFLCRQYDAK 171
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    171 RALAVGILNHVVEVEELEDFTLQMAHHISEKAPLAIAVIKEELRVL--GEAHTMnsdefERIQGMRRAVYDSEDYQEGMN 248
Cdd:TIGR01929 172 QALDMGLVNTVVPLADLEKETVRWCREILQKSPMAIRMLKAALNADcdGQAGLQ-----ELAGNATMLFYMTEEGQEGRN 246
                         250
                  ....*....|
gi 8569414    249 AFLEKRKPNF 258
Cdd:TIGR01929 247 AFLEKRQPDF 256
PRK08140 PRK08140
enoyl-CoA hydratase; Provisional
1-260 8.00e-30

enoyl-CoA hydratase; Provisional


Pssm-ID: 236163  Cd Length: 262  Bit Score: 112.31  E-value: 8.00e-30
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414     1 MSYQYVNVVTINKVAVIEFNYGRKLNALSKVFIDDLMQALSDLNRPEIRCIILrapSGS-KVFSAGHDIHEL---PSGGR 76
Cdd:PRK08140   1 MMYETILLAIEAGVATLTLNRPDKLNSFTREMHRELREALDQVEDDGARALLL---TGAgRGFCAGQDLADRdvtPGGAM 77
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    77 DPLSYD-----DPLrqiTRMIQKFPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGvpynLV----GIHN 147
Cdd:PRK08140  78 PDLGESietfyNPL---VRRLRALPLPVIAAVNGVAAGAGANLALACDIVLAARSASFIQAFVKIG----LVpdsgGTWF 150
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414   148 LTRDAGFHIVKELIFTASPITAQRALAVGILNHVVEVEELEDFTLQMAHHISEKAPLAIAVIKEELRVlGEAHTMNSD-E 226
Cdd:PRK08140 151 LPRLVGMARALGLALLGEKLSAEQAEQWGLIWRVVDDAALADEAQQLAAHLATQPTRGLALIKQAMNA-SATNTLDAQlD 229
                        250       260       270
                 ....*....|....*....|....*....|....
gi 8569414   227 FERiqGMRRAVYDSEDYQEGMNAFLEKRKPNFVG 260
Cdd:PRK08140 230 LER--DLQREAGRSADYAEGVSAFLEKRAPRFTG 261
MenB COG0447
1,4-Dihydroxy-2-naphthoyl-CoA synthase [Coenzyme transport and metabolism];
11-258 1.22e-29

1,4-Dihydroxy-2-naphthoyl-CoA synthase [Coenzyme transport and metabolism];


Pssm-ID: 223524  Cd Length: 282  Bit Score: 112.51  E-value: 1.22e-29
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414   11 INKVAVIEFNYGRKLNALSKVFIDDLMQALSDLNR-PEIRCIILR-APSGSKVFSAGHD--IHELPSG-----GRDPLSY 81
Cdd:COG0447  26 VDGIAKITINRPEVRNAFRPKTVDEMIDAFADARDdPNVGVILLTgNGDGDKAFCSGGDqkVRGDSGGyvdddGIPRLNV 105
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414   82 DDPLRQITRMiqkfPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGVPYNLVGIHNLTRDAGFHIVKELI 161
Cdd:COG0447 106 LDLQRLIRTM----PKPVIAMVAGYAIGGGHVLHVVCDLTIAADNAIFGQTGPKVGSFDGGYGSSYLARIVGQKKAREIW 181
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414  162 FTASPITAQRALAVGILNHVVEVEELEDFTLQMAHHISEKAPLAiavikeeLRVLGEAHTMNSDEFERIQ----GMRRAV 237
Cdd:COG0447 182 FLCRQYDAEEALDMGLVNTVVPHADLEKETVQWAREMLAKSPTA-------LRMLKAAFNADCDGLAGLQelagNATLLY 254
                       250       260
                ....*....|....*....|.
gi 8569414  238 YDSEDYQEGMNAFLEKRKPNF 258
Cdd:COG0447 255 YMTDEAQEGRDAFLEKRKPDF 275
PLN02600 PLN02600
enoyl-CoA hydratase
26-260 2.26e-29

enoyl-CoA hydratase


Pssm-ID: 178210  Cd Length: 251  Bit Score: 111.05  E-value: 2.26e-29
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    26 NALSKVFIDDLMQALSDLNRPEIRCIILRAPSGSKVFSAGHDIHEL----PSGGRDplsYDDPLRQITRMIQKFPKPIIS 101
Cdd:PLN02600  17 NAIGKEMLRGLRSAFEKIQADASARVVMLRSSVPGVFCAGADLKERrkmsPSEVQK---FVNSLRSTFSSLEALSIPTIA 93
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414   102 MVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGVPYNLVGIHNLTRDAGFHIVKELIFTASPITAQRALAVGILNHV 181
Cdd:PLN02600  94 VVEGAALGGGLELALSCDLRICGEEAVFGLPETGLAIIPGAGGTQRLPRLVGRSRAKELIFTGRRIGAREAASMGLVNYC 173
                        170       180       190       200       210       220       230
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 8569414   182 VEVEELEDFTLQMAHHISEKAPLAIAVIKEELRVLGEAHTMNSDEFEriQGMRRAVYDSEDYQEGMNAFLEKRKPNFVG 260
Cdd:PLN02600 174 VPAGEAYEKALELAQEINQKGPLAIKMAKKAINEGSEVDMASGLEIE--EECYEQVLKTKDRLEGLAAFAEKRKPVYTG 250
PLN02921 PLN02921
naphthoate synthase
14-258 2.78e-28

naphthoate synthase


Pssm-ID: 178509  Cd Length: 327  Bit Score: 109.88  E-value: 2.78e-28
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    14 VAVIEFNYGRKLNALSKVFIDDLMQALSDL-NRPEIRCIILRApSGSKVFSAGHDIHELPSGGrdplsYDDP-----LRQ 87
Cdd:PLN02921  77 IAKITINRPERRNAFRPRTVKELQRAFNDArDDSSVGVIILTG-KGTKAFCSGGDQAVRGKDG-----YVGPddagrLNV 150
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    88 ITRMIQ--KFPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGVPYNLVGIHNLTRDAGFHIVKELIFTAS 165
Cdd:PLN02921 151 LDLQIQirRLPKPVIAMVAGYAVGGGHILHMVCDLTIAADNAVFGQTGPKVGSFDAGYGSSIMARLVGQKKAREMWFLAR 230
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414   166 PITAQRALAVGILNHVVEVEELEDFTLQMAHHISEKAPLAIAVIKEELRVLGEAHTmnsdefeRIQGM----RRAVYDSE 241
Cdd:PLN02921 231 FYTASEALKMGLVNTVVPLDELEGETVKWCREILRNSPTAIRVLKSALNAADDGHA-------GLQELggnaTLLFYGSE 303
                        250
                 ....*....|....*..
gi 8569414   242 DYQEGMNAFLEKRKPNF 258
Cdd:PLN02921 304 EGNEGRTAYLEGRAPDF 320
PRK06142 PRK06142
enoyl-CoA hydratase; Provisional
1-260 8.00e-28

enoyl-CoA hydratase; Provisional


Pssm-ID: 235714  Cd Length: 272  Bit Score: 107.37  E-value: 8.00e-28
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414     1 MSYQYVNVVTINKVAVIEFNYGRKLNALSKVFIDDLMQALSDLNR-PEIRCIILrapSGS-KVFSAGHDIHELpSGGRDP 78
Cdd:PRK06142   3 TTYESFTVELADHVAQVTLNRPGKGNAMNPAFWSELPEIFRWLDAdPEVRAVVL---SGSgKHFSYGIDLPAM-AGVFGQ 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    79 LSYDDP-------LRQITRMIQKFP------KPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGVPYNLVGI 145
Cdd:PRK06142  79 LGKDGLarprtdlRREILRLQAAINavadcrKPVIAAVQGWCIGGGVDLISACDMRYASADAKFSVREVDLGMVADVGSL 158
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414   146 HNLTRDAGFHIVKELIFTASPITAQRALAVGILNHVVEVEE-LEDFTLQMAHHISEKAPLAIAVIKEELRVLGEAHTmnS 224
Cdd:PRK06142 159 QRLPRIIGDGHLRELALTGRDIDAAEAEKIGLVNRVYDDADaLLAAAHATAREIAAKSPLAVRGTKEVLDYMRDHRV--A 236
                        250       260       270
                 ....*....|....*....|....*....|....*.
gi 8569414   225 DEFERIQGMRRAVYDSEDYQEGMNAFLEKRKPNFVG 260
Cdd:PRK06142 237 DGLRYVATWNAAMLPSKDLTEAIAAHMEKRPPEFTG 272
PRK07799 PRK07799
enoyl-CoA hydratase; Provisional
16-260 1.84e-27

enoyl-CoA hydratase; Provisional


Pssm-ID: 181122  Cd Length: 263  Bit Score: 105.95  E-value: 1.84e-27
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    16 VIEFNYGRKLNALSKvfidDLMQALSDL-----NRPEIRCIILRAPSGSkvFSAGHDIHEL----PSGGRDPLSYDDPlr 86
Cdd:PRK07799  17 IVTMNRPEARNALST----EMLRIMVDAwdrvdNDPDIRSCILTGAGGA--FCAGMDLKAAtkkpPGDSFKDGSYDPS-- 88
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    87 QITRMIQ--KFPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGVpYNLVGIH-NLTRDAGFHIVKELIFT 163
Cdd:PRK07799  89 RIDALLKgrRLTKPLIAAVEGPAIAGGTEILQGTDIRVAGESAKFGISEAKWSL-FPMGGSAvRLVRQIPYTVACDLLLT 167
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414   164 ASPITAQRALAVGILNHVVEVEELEDFTLQMAHHISEKAPLAIAVIKEELRvlgEAHTMNSDE-FERIQGMRRAVYDSED 242
Cdd:PRK07799 168 GRHITAAEAKEIGLIGHVVPDGQALDKALELAELINANGPLAVQAILRTIR---ETEGMHENEaFKIDTKIGIPVFLSED 244
                        250
                 ....*....|....*...
gi 8569414   243 YQEGMNAFLEKRKPNFVG 260
Cdd:PRK07799 245 AKEGPRAFAEKRAPNFQG 262
PRK07854 PRK07854
enoyl-CoA hydratase; Provisional
14-260 4.71e-27

enoyl-CoA hydratase; Provisional


Pssm-ID: 236115  Cd Length: 243  Bit Score: 104.72  E-value: 4.71e-27
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    14 VAVIEFNYGRKLNALSKVFIDDLMQALSDLNRPEIRCIILRApSGSkVFSAGHDIhelpSGGRDPLSYDDPLRQITRMIQ 93
Cdd:PRK07854  10 VLTIELQRPERRNALNAELCEELREAVRKAVDESARAIVLTG-QGT-VFCAGADL----SGDVYADDFPDALIEMLHAID 83
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    94 KFPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGVPYNLVGIHNLTRDAGFHIVKELIFTASPITAQRAL 173
Cdd:PRK07854  84 AAPVPVIAAINGPAIGAGLQLAMACDLRVVAPEAYFQFPVAKYGIALDNWTIRRLSSLVGGGRARAMLLGAEKLTAEQAL 163
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414   174 AVGILNhvvEVEELEDfTLQMAHHISEKAPLAIAVIKeelRVLGEAHTMnSDEFERIQGMRRAVYDSEDYQEGMNAFLEK 253
Cdd:PRK07854 164 ATGMAN---RIGTLAD-AQAWAAEIAGLAPLALQHAK---RVLNDDGAI-EEAWPAHKELFDKAWASQDAIEAQVARIEK 235

                 ....*..
gi 8569414   254 RKPNFVG 260
Cdd:PRK07854 236 RPPKFQG 242
PRK07659 PRK07659
enoyl-CoA hydratase; Provisional
4-260 7.77e-27

enoyl-CoA hydratase; Provisional


Pssm-ID: 236073  Cd Length: 260  Bit Score: 104.34  E-value: 7.77e-27
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414     4 QYVNVVTINKVAVIEFNYGRKLNALSKVFIDDLMQALSDLNRPEIRCIILRApSGsKVFSAGHDIHELPSGGrDPLSYDD 83
Cdd:PRK07659   6 ESVVVKYEGRVATIMLNRPEALNALDEPMLKELLQALKEVAESSAHIVVLRG-NG-RGFSAGGDIKMMLSSN-DESKFDG 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    84 PLRQITRMIQKF---PKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGVPYNLVGIHNLTRDAGFHIVKEL 160
Cdd:PRK07659  83 VMNTISEIVVTLytmPKLTISAIHGPAAGLGLSIALTADYVIADISAKLAMNFIGIGLIPDGGGHFFLQKRVGENKAKQI 162
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414   161 IFTASPITAQRALAVGILNHVVEveelEDFTLQMAHHISE--KAPLAiAVI--KEELRVLGEAHTMNSDEFERI--QGMR 234
Cdd:PRK07659 163 IWEGKKLSATEALDLGLIDEVIG----GDFQTAAKQKISEwlQKPLK-AMIetKQIYCELNRSQLEQVLQLEKRaqYAMR 237
                        250       260
                 ....*....|....*....|....*.
gi 8569414   235 RavydSEDYQEGMNAFLEKRKPNFVG 260
Cdd:PRK07659 238 Q----TADHKEGIRAFLEKRLPVFKG 259
PRK07396 PRK07396
dihydroxynaphthoic acid synthetase; Validated
12-258 7.81e-27

dihydroxynaphthoic acid synthetase; Validated


Pssm-ID: 180958  Cd Length: 273  Bit Score: 104.59  E-value: 7.81e-27
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    12 NKVAVIEFNYGRKLNALSKVFIDDLMQALSDL-NRPEIRCIILRApSGSKVFSAGHDIHELPSGG-RDP-----LSYDDP 84
Cdd:PRK07396  21 DGIAKITINRPEVRNAFRPKTVKEMIDAFADArDDDNIGVIILTG-AGDKAFCSGGDQKVRGYGGyVDDdgvprLNVLDL 99
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    85 LRQITRMiqkfPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGvpynlvgihnlTRDAGF------HIV- 157
Cdd:PRK07396 100 QRLIRTC----PKPVIAMVAGYAIGGGHVLHLVCDLTIAADNAIFGQTGPKVG-----------SFDGGYgasylaRIVg 164
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414   158 ----KELIFTASPITAQRALAVGILNHVVEVEELEDFTLQMAHHISEKAPLAIAVIKEelrvlgeahTMNSDEfERIQGM 233
Cdd:PRK07396 165 qkkaREIWFLCRQYDAQEALDMGLVNTVVPLADLEKETVRWCREMLQNSPMALRCLKA---------ALNADC-DGQAGL 234
                        250       260       270
                 ....*....|....*....|....*....|..
gi 8569414   234 RRAV-------YDSEDYQEGMNAFLEKRKPNF 258
Cdd:PRK07396 235 QELAgnatmlfYMTEEAQEGRNAFNEKRQPDF 266
PRK06210 PRK06210
enoyl-CoA hydratase; Provisional
1-261 1.81e-26

enoyl-CoA hydratase; Provisional


Pssm-ID: 180472  Cd Length: 272  Bit Score: 103.63  E-value: 1.81e-26
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414     1 MSYQYVNV-VTINKVAVIEFNYGRKLNALSKVFIDDLMQALSDLNR-PEIRCIILrapSGS-KVFSAGHDIHEL----PS 73
Cdd:PRK06210   2 MAYDAVLYeVADSGVAVITLNRPDRLNAWTPVMEAEVYAAMDRAEAdPAVRVIVL---TGAgRGFCAGADMGELqtidPS 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    74 GGRD-----PLSYDDPLRQITRM--IQKFPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGvpynLVGIH 146
Cdd:PRK06210  79 DGRRdtdvrPFVGNRRPDYQTRYhfLTALRKPVIAAINGACAGIGLTHALMCDVRFAADGAKFTTAFARRG----LIAEH 154
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414   147 NLT----RDAGFHIVKELIFTASPITAQRALAVGILNHVVEVEELEDFTLQMAHHISEK-APLAIAVIKEEL-----RVL 216
Cdd:PRK06210 155 GISwilpRLVGHANALDLLLSARTFYAEEALRLGLVNRVVPPDELMERTLAYAEDLARNvSPASMAVIKRQLyedafQTL 234
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*.
gi 8569414   217 GEAHTM-NSDEFERIQgmrravydSEDYQEGMNAFLEKRKPNFVGH 261
Cdd:PRK06210 235 AEATARaNREMHESLQ--------RPDFIEGVASFLEKRPPRFPGL 272
PaaB1 TIGR02280
phenylacetate degradation probable enoyl-CoA hydratase paaB; This family of proteins are found ...
14-260 1.90e-26

phenylacetate degradation probable enoyl-CoA hydratase paaB; This family of proteins are found within apparent operons for the degradation of phenylacetic acid. These proteins contain the enoyl-CoA hydratase domain as detected by pfam00378. This activity is consistent with current hypotheses for the degradation pathway, which involve the ligation of phenylacetate with coenzyme A (paaF), hydroxylation (paaGHIJK), ring-opening (paaN) and degradation of the resulting fatty acid-like compound to a Krebs cycle intermediate (paaABCDE).


Pssm-ID: 274065  Cd Length: 257  Bit Score: 103.39  E-value: 1.90e-26
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414     14 VAVIEFNYGRKLNALSKVFIDDLMQALSDLNRP-EIRCIILRApsGSKVFSAGHDIHEL-------PSGGRDPLSYDDPL 85
Cdd:TIGR02280   9 VATLTLNRPDKLNSFNAEMHAELAEALKRVERDdTARALLLTG--AGRGFCAGQDLSDRnvtpgpaPDLGMTVERFYNPL 86
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414     86 rqiTRMIQKFPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGVPYNLVGIHNLTRDAGFHIVKELIFTAS 165
Cdd:TIGR02280  87 ---VRRLAALPKPVICAVNGVAAGAGANLALAGDIVIAARSAKFIQAFSKLGLIPDSGGTWLLPRLVGRARAMGLALLGN 163
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    166 PITAQRALAVGILNHVVEVEELEDFTLQMAHHISEKAPLAIAVIKEELRVlGEAHTMNSD-EFERiqGMRRAVYDSEDYQ 244
Cdd:TIGR02280 164 KLSAEQAHEWGLIWQVVDDATLMDEAQALARHLATQPTRGLGLIKRAIQA-AETNSLDTQlDLER--DLQREAGRSADYA 240
                         250
                  ....*....|....*.
gi 8569414    245 EGMNAFLEKRKPNFVG 260
Cdd:TIGR02280 241 EGVSAFLDKRSPQFTG 256
badI TIGR03210
2-ketocyclohexanecarboxyl-CoA hydrolase; Members of this protein family are ...
12-258 2.49e-26

2-ketocyclohexanecarboxyl-CoA hydrolase; Members of this protein family are 2-ketocyclohexanecarboxyl-CoA hydrolase, a ring-opening enzyme that acts in catabolism of molecules such as benzoyl-CoA and cyclohexane carboxylate. It converts -ketocyclohexanecarboxyl-CoA to pimelyl-CoA. It is not sensitive to oxygen.


Pssm-ID: 132254  Cd Length: 256  Bit Score: 103.10  E-value: 2.49e-26
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414     12 NKVAVIEFNYGRKLNALSKVFIDDLMQAL--SDLNRpEIRCIILrAPSGSKVFSAGHD--IHELPSGGRDPLSYddPLRQ 87
Cdd:TIGR03210  10 NGIAWIMINRPAKMNAFRGQTCDELIHALkdAGYDR-QIGVIVL-AGAGDKAFCTGGDqsTHDGGYDGRGTIGL--PMEE 85
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414     88 ITRMIQKFPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGVPYNLVGIHNLTRDAGFHIVKELIFTASPI 167
Cdd:TIGR03210  86 LHSAIRDVPKPVIARVQGYAIGGGNVLVTICDLTIASEKAQFGQVGPKVGSVDPGYGTALLARVVGEKKAREIWYLCRRY 165
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    168 TAQRALAVGILNHVVEVEELEDFTLQMAHHISEKAPLAIAVIKEELrvlgeahTMNSDEFERIQGMR----RAVYDSEDY 243
Cdd:TIGR03210 166 TAQEALAMGLVNAVVPHDQLDAEVQKWCDEIVEKSPTAIAIAKRSF-------NMDTAHQRGIAGMGmyalKLYYDTAES 238
                         250
                  ....*....|....*
gi 8569414    244 QEGMNAFLEKRKPNF 258
Cdd:TIGR03210 239 REGVKAFQEKRKPEF 253
PRK06143 PRK06143
enoyl-CoA hydratase; Provisional
14-255 1.30e-25

enoyl-CoA hydratase; Provisional


Pssm-ID: 180423  Cd Length: 256  Bit Score: 100.88  E-value: 1.30e-25
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    14 VAVIEFNYGRKLNALSKVFIDDLMQALSDLN-RPEIRCIILRApSGSKVFSAGHDIHELPSggRDPLS---YDDPLRQIT 89
Cdd:PRK06143  17 VATLTIRNAGSLNILGTPVILALTQALRWLAaDPDVRVLVLRG-AGEKAFIGGADIKEMAT--LDQASaeaFISRLRDLC 93
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    90 RMIQKFPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGVPYNlvgIHN--LTRDAGFHIVKELIFTASPI 167
Cdd:PRK06143  94 DAVRHFPVPVIARIPGWCLGGGLELAAACDLRIAAHDAQFGMPEVRVGIPSV---IHAalLPRLIGWARTRWLLLTGETI 170
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414   168 TAQRALAVGILNHVVEVEELEDftlQMAHHISEKAPLAIAVIKEELRVLGEAHTMNSDE-FERIQGMRRAVYDSEDYQEG 246
Cdd:PRK06143 171 DAAQALAWGLVDRVVPLAELDA---AVERLAASLAGCGPQALRQQKRLLREWEDMPLDVaIDDSVAEFGAAFLTGEPQRH 247

                 ....*....
gi 8569414   247 MNAFLEKRK 255
Cdd:PRK06143 248 MAAFLNRKR 256
PRK07260 PRK07260
enoyl-CoA hydratase; Provisional
3-255 2.48e-25

enoyl-CoA hydratase; Provisional


Pssm-ID: 180910  Cd Length: 255  Bit Score: 100.20  E-value: 2.48e-25
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414     3 YQYVNVVTINKVAVIEFNYGRKLNALSKVFIDDLMQALSDLNR-PEIRCIILRApsGSKVFSAGHDIHELpsggRDPLSY 81
Cdd:PRK07260   1 FEHIIYEVEDDLATLTLNRPEVSNGFNIPMCQEILEALRLAEEdPSVRFLLINA--NGKVFSVGGDLVEM----KRAVDE 74
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    82 DDP---------LRQITRMIQKFPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGVPYNLVGIHNLTRDA 152
Cdd:PRK07260  75 DDVqslvkiaelVNEISFAIKQLPKPVIMCVDGAVAGAAANMAVAADFCIASTKTKFIQAFVGVGLAPDAGGLFLLTRAI 154
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414   153 GFHIVKELIFTASPITAQRALAVGILNHVVEVEELEDFTLQMAHHISEKAPLAIAVIKEelrVLGEAHTMNSDEFERIQ- 231
Cdd:PRK07260 155 GLNRATHLAMTGEALTAEKALEYGFVYRVAESEKLEKTCEQLLKKLRRGSSNSYAAIKS---LVWESFFKGWEDYAKLEl 231
                        250       260
                 ....*....|....*....|....
gi 8569414   232 GMRRAVYDSEDYQEGMNAFLEKRK 255
Cdd:PRK07260 232 ALQESLAFKEDFKEGVRAFSERRR 255
PRK09245 PRK09245
enoyl-CoA hydratase; Provisional
14-260 9.37e-24

enoyl-CoA hydratase; Provisional


Pssm-ID: 181723  Cd Length: 266  Bit Score: 96.19  E-value: 9.37e-24
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    14 VAVIEFNYGRKLNALSK-VFIDDLMQALSDLNR-PEIRCIILrapSGS-KVFSAGHDIHELPS-GGRDPLSYDDpLRQIT 89
Cdd:PRK09245  13 IVTLTMNRPETRNALSDnDAVDALVAACAAINAdRSVRAVIL---TGAgTAFSSGGNVKDMRArVGAFGGSPAD-IRQGY 88
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    90 RM-IQKFPK-------PIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGVPYNLVGIHNLTRDAGFHIVKELI 161
Cdd:PRK09245  89 RHgIQRIPLalynlevPVIAAVNGPAIGAGCDLACMCDIRIASETARFAESFVKLGLIPGDGGAWLLPRIIGMARAAEMA 168
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414   162 FTASPITAQRALAVGILNHVVEVEELEDFTLQMAHHISEKAPLAIAVIKeelRVLGEAHTMNSDE-FERIQGMRRAVYDS 240
Cdd:PRK09245 169 FTGDAIDAATALEWGLVSRVVPADQLLPAARALAERIAANPPHALRLTK---RLLREGQHASLDTlLELSAAYQALAHHT 245
                        250       260
                 ....*....|....*....|
gi 8569414   241 EDYQEGMNAFLEKRKPNFVG 260
Cdd:PRK09245 246 ADHREAVDAFLEKRPPVFTG 265
PRK06190 PRK06190
enoyl-CoA hydratase; Provisional
1-237 2.90e-22

enoyl-CoA hydratase; Provisional


Pssm-ID: 235733  Cd Length: 258  Bit Score: 91.96  E-value: 2.90e-22
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414     1 MSYQYVNVVTINKVAVIEFNYGRKLNALSKVFIDDLMQALSDL-NRPEIRCIILrapSGS-KVFSAGHDIHELpsgGRDP 78
Cdd:PRK06190   1 MTEPILLVETHDRVRTLTLNRPEARNALSAALRRALFAALAEAdADDDVDVVVL---TGAdPAFCAGLDLKEL---GGDG 74
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    79 LSY--DDPLRQITRMIQKFPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTpvnlgvpYNLVGI-------HNLT 149
Cdd:PRK06190  75 SAYgaQDALPNPSPAWPAMRKPVIGAINGAAVTGGLELALACDILIASERARFADT-------HARVGIlpgwglsVRLP 147
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414   150 RDAGFHIVKELIFTASPITAQRALAVGILNHVVEVEELEDFTLQMAHHISEKAPLAIAVIKE----------------EL 213
Cdd:PRK06190 148 QKVGIGRARRMSLTGDFLDAADALRAGLVTEVVPHDELLPRARRLAASIAGNNPAAVRALKAsyddgaaaqtgdalalEA 227
                        250       260
                 ....*....|....*....|....
gi 8569414   214 RVLGEAHTmnSDEFERIQGMRRAV 237
Cdd:PRK06190 228 EAARAHNR--SVSPDGIAARREAV 249
PRK08260 PRK08260
enoyl-CoA hydratase; Provisional
1-260 3.02e-21

enoyl-CoA hydratase; Provisional


Pssm-ID: 236206  Cd Length: 296  Bit Score: 90.07  E-value: 3.02e-21
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414     1 MSYQYVNVVTINKVAVIEFNYGRKLNALSKVFIDDLMQALSDLNR-PEIRCIILrapSGS-KVFSAGHD----------- 67
Cdd:PRK08260   1 MTYETIRYDVADGIATITLNRPDKLNAFTVTMARELIEAFDAADAdDAVRAVIV---TGAgRAFCAGADlsaggntfdld 77
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    68 -----IHELPSGGRDPL--SYDDPLRQITRMIQKFPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFsmtpvnlGVPY 140
Cdd:PRK08260  78 aprtpVEADEEDRADPSddGVRDGGGRVTLRIFDSLKPVIAAVNGPAVGVGATMTLAMDIRLASTAARF-------GFVF 150
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414   141 NLVGIHN-------LTRDAGFHIVKELIFTASPITAQRALAVGILNHVVEVEELEDFTLQMAHHISEK-APLAIAVIKEE 212
Cdd:PRK08260 151 GRRGIVPeaasswfLPRLVGLQTALEWVYSGRVFDAQEALDGGLVRSVHPPDELLPAARALAREIADNtSPVSVALTRQM 230
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|..
gi 8569414   213 L-RVLGEAHTMNSDEFERiqgmrRAVYD---SEDYQEGMNAFLEKRKPNFVG 260
Cdd:PRK08260 231 MwRMAGADHPMEAHRVDS-----RAIYSrgrSGDGKEGVSSFLEKRPAVFPG 277
PRK08321 PRK08321
naphthoate synthase; Validated
17-258 3.67e-21

naphthoate synthase; Validated


Pssm-ID: 181386  Cd Length: 302  Bit Score: 90.08  E-value: 3.67e-21
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    17 IEFNYGRKLNALSKVFIDDLMQALSDLNR-PEIRCIIL--RAPS---GSKVFSAGHD--IHelpsgGRDPLSYD------ 82
Cdd:PRK08321  38 IAFDRPEVRNAFRPHTVDELYRALDHARMsPDVGCVLLtgNGPSpkdGGWAFCSGGDqrIR-----GRDGYQYAegdead 112
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    83 --DPLR-------QITRMIQKFPKPIISMVEGSVWGGAFEMIMSSDLIIAAST-STFSMTPVNLGVPYNLVGIHNLTRDA 152
Cdd:PRK08321 113 tvDPARagrlhilEVQRLIRFMPKVVIAVVPGWAAGGGHSLHVVCDLTLASREhARFKQTDADVGSFDGGYGSAYLARQV 192
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414   153 GFHIVKELIFTASPITAQRALAVGILNHVVEVEELEDFTLQMAHHISEKAPLAIavikeelRVLGEAHTMNSDeferiqG 232
Cdd:PRK08321 193 GQKFAREIFFLGRTYSAEEAHDMGAVNAVVPHAELETEALEWAREINGKSPTAM-------RMLKYAFNLTDD------G 259
                        250       260       270
                 ....*....|....*....|....*....|....*.
gi 8569414   233 M----------RRAVYDSEDYQEGMNAFLEKRKPNF 258
Cdd:PRK08321 260 LvgqqlfageaTRLAYMTDEAQEGRDAFLEKRDPDW 295
PRK07827 PRK07827
enoyl-CoA hydratase; Provisional
14-260 4.08e-21

enoyl-CoA hydratase; Provisional


Pssm-ID: 236109  Cd Length: 260  Bit Score: 88.97  E-value: 4.08e-21
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    14 VAVIEFNYGRKLNALSKVFIDDLMQALSDLNR-PEIRCIILRAPSGSkvFSAGHDIHELPSGGRDPLSY-DDPLRQIT-- 89
Cdd:PRK07827  16 VATLTLDSPHNRNALSARLVAQLHDGLRAAAAdPAVRAVVLTHTGGT--FCAGADLSEAGGGGGDPYDAaVARAREMTal 93
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    90 -RMIQKFPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGV-PynlvGIHNLT-------RDAGFHIVkel 160
Cdd:PRK07827  94 lRAIVELPKPVIAAIDGHVRAGGFGLVGACDIVVAGPESTFALTEARIGVaP----AIISLTllprlspRAAARYYL--- 166
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414   161 ifTASPITAQRALAVGILNhvVEVEELEDFTLQMAHHISEKAPLAIAVIKEEL--RVLgeahtmnsDEFER----IQGMR 234
Cdd:PRK07827 167 --TGEKFGAAEAARIGLVT--AAADDVDAAVAALLADLRRGSPQGLAESKALTtaAVL--------AGFDRdaeeLTEES 234
                        250       260
                 ....*....|....*....|....*.
gi 8569414   235 RAVYDSEDYQEGMNAFLEKRKPNFVG 260
Cdd:PRK07827 235 ARLFVSDEAREGMTAFLQKRPPRWAL 260
PRK09120 PRK09120
p-hydroxycinnamoyl CoA hydratase/lyase; Validated
1-256 4.83e-21

p-hydroxycinnamoyl CoA hydratase/lyase; Validated


Pssm-ID: 236383  Cd Length: 275  Bit Score: 89.30  E-value: 4.83e-21
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414     1 MSYQY----VNVVTINKVAVIEFNYGRKLNALSKVFIDDLMQALSDLN-RPEIRCIILRAPSGSkvFSAGHDIHELpsgG 75
Cdd:PRK09120   1 MSYENrwdtVKVEVEDGIAWVTLNRPEKRNAMSPTLNREMIDVLDALEfDDDAGVLVLTGAGDA--WSAGMDLKEY---F 75
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    76 RDPlsYDDPL---RQITR-------MIQKFPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGV-PYNLVG 144
Cdd:PRK09120  76 RET--DAQPEilqERIRReaygwwrRLRWYQKPTIAMVNGWCFGGGFSPLVACDLAIAADEAQFGLSEINWGIpPGGGVS 153
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414   145 ---IHNLT-RDAGFHIVkelifTASPITAQRALAVGILNHVVEVEELEDFTLQMAHHISEKAPLAIAVIKEELRVLGEAH 220
Cdd:PRK09120 154 kamADTVGhRDALYYIM-----TGETFTGRKAAEMGLVNESVPLAQLRARTRELAAKLLEKNPVVLRAAKDGFKRVRELT 228
                        250       260       270
                 ....*....|....*....|....*....|....*....
gi 8569414   221 TMNSDEFERIQGMRRAVYDSEDY-QEGMNAFLEKR--KP 256
Cdd:PRK09120 229 WDQAEDYLYAKLEQANSLDPEGGrEEGLKQFLDDKsyKP 267
PRK07938 PRK07938
enoyl-CoA hydratase; Provisional
6-256 3.84e-20

enoyl-CoA hydratase; Provisional


Pssm-ID: 181174  Cd Length: 249  Bit Score: 86.18  E-value: 3.84e-20
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414     6 VNVVTINKVAViefnygrklNALSKVFIDDLMQALSDLNR-PEIRCIILRAPSgsKVFSAGHDIHELPSggrdplsYDDP 84
Cdd:PRK07938  12 IAEVTVDYPPV---------NALPSAGWFALADAITAAGAdPDTRVVVLRAEG--RGFNAGVDIKELQA-------TPGF 73
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    85 LRQIT---------RMIQKFPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGVpynLVGIHNLTRDAGFH 155
Cdd:PRK07938  74 TALIDanrgcfaafRAVYECAVPVIAAVHGFCLGGGIGLVGNADVIVASDDATFGLPEVDRGA---LGAATHLQRLVPQH 150
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414   156 IVKELIFTASPITAQRALAVGILNHVVEVEELEDFTLQMAHHISEKAPLAIAVIKEELRVLGEAHTMNSDEFEriQGMRR 235
Cdd:PRK07938 151 LMRALFFTAATITAAELHHFGSVEEVVPRDQLDEAALEVARKIAAKDTRVIRAAKEALNGIDPQDVERSYRWE--QGFTF 228
                        250       260
                 ....*....|....*....|.
gi 8569414   236 AVYDSEDYQEGMNAFLEKRKP 256
Cdd:PRK07938 229 ELNLAGVSDEHRDAFVEKRKA 249
PRK05981 PRK05981
enoyl-CoA hydratase; Provisional
1-260 6.08e-20

enoyl-CoA hydratase; Provisional


Pssm-ID: 235661  Cd Length: 266  Bit Score: 85.94  E-value: 6.08e-20
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414     1 MSYQYVNVVTINKVAVIEFNYGRKLNALSKVFIDDLMQALSDL--NRPEIRCIILrapSGS-KVFSAGHDIHELPSGGRD 77
Cdd:PRK05981   1 MQFKKVTLDFDGGVAILTLDHPEVMNAVSIDMLGGLAEALDAIedGKAEVRCLVL---TGAgRGFCTGANLQGRGSGGRE 77
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    78 PLSYDDP-------LRQITRMIQKFPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGVPYNLVGIHNLTR 150
Cdd:PRK05981  78 SDSGGDAgaaletaYHPFLRRLRNLPCPIVTAVNGPAAGVGMSFALMGDLILCARSAYFLQAFRRIGLVPDGGSTWLLPR 157
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414   151 DAGFHIVKELIFTASPITAQRALAVGILNHVVEVEELEDFTLQMAHHISEKAPLAIAVIKE----------ELRVLGEAH 220
Cdd:PRK05981 158 LVGKARAMELSLLGEKLPAETALQWGLVNRVVDDAELMAEAMKLAHELANGPTVALGLIRKlywdspendfEEQLNLERE 237
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|
gi 8569414   221 TmnsdefERIQGmrravyDSEDYQEGMNAFLEKRKPNFVG 260
Cdd:PRK05981 238 A------QRIAG------KTEDFKEGVGAFLQKRPAQFKG 265
PRK07468 PRK07468
enoyl-CoA hydratase; Provisional
14-260 2.68e-19

enoyl-CoA hydratase; Provisional


Pssm-ID: 180987  Cd Length: 262  Bit Score: 84.34  E-value: 2.68e-19
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    14 VAVIEFNYGRKLNALSKVFIDDLMQALSDLNR-PEIRCIILRAPSGSkvFSAGHDIHELpsggRDPLSYDDPLR------ 86
Cdd:PRK07468  15 VATLTLNRPEKHNALSARMIAELTTAARRLAAdAAVRVVVLTGAGKS--FCAGGDLGWM----RAQMTADRATRieearr 88
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    87 --QITRMIQKFPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLG-VPYNlVGIHNLTRdAGFHIVKELIFT 163
Cdd:PRK07468  89 laMMLKALNDLPKPLIGRIQGQAFGGGVGLISVCDVAIAVSGARFGLTETRLGlIPAT-ISPYVVAR-MGEANARRVFMS 166
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414   164 ASPITAQRALAVGILNHVVEVEELEDFTLQMAHHISEKAPLAIAVIKEELRVLGEahTMNSDEFERIQGMRRAVYDSEDY 243
Cdd:PRK07468 167 ARLFDAEEAVRLGLLSRVVPAERLDAAVEAEVTPYLSCAPGAVAAAKALVRALGA--PIDEAVIDATIEALADTWETEEA 244
                        250
                 ....*....|....*..
gi 8569414   244 QEGMNAFLEKRKPNFVG 260
Cdd:PRK07468 245 REGIAAFFDKRAPAWRG 261
PRK07509 PRK07509
enoyl-CoA hydratase; Provisional
2-222 8.29e-19

enoyl-CoA hydratase; Provisional


Pssm-ID: 181008  Cd Length: 262  Bit Score: 83.01  E-value: 8.29e-19
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414     2 SYQYVNVVTINKVAVIEFNYGRKLNALSKVFIDDLMQALSDL-NRPEIRCIILrapSGS-KVFSAGHDIHELPSGGRDPL 79
Cdd:PRK07509   1 MMDRVSVTIEDGIADVRLNRPDKMNALDFAMFEELIATIKRLkKDRGIRAVIL---SGEgGAFCAGLDVKSVASSPGNAV 77
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    80 SYDDPL--------RQITRMIQKFPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLG-VP--YNLVGIHNL 148
Cdd:PRK07509  78 KLLFKRlpgnanlaQRVSLGWRRLPVPVIAALEGVCFGGGLQIALGADIRIAAPDTKLSIMEAKWGlVPdmAGTVSLRGL 157
                        170       180       190       200       210       220       230
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 8569414   149 TRDagfHIVKELIFTASPITAQRALAVGILNHVVEvEELEDfTLQMAHHISEKAPLAIAVIKeelRVLGEAHTM 222
Cdd:PRK07509 158 VRK---DVARELTYTARVFSAEEALELGLVTHVSD-DPLAA-ALALAREIAQRSPDAIAAAK---RLINRSWTA 223
PRK06072 PRK06072
enoyl-CoA hydratase; Provisional
14-260 1.30e-18

enoyl-CoA hydratase; Provisional


Pssm-ID: 168377  Cd Length: 248  Bit Score: 82.13  E-value: 1.30e-18
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    14 VAVIEFNYGRKLNALSKVFIDDLMQALSDLNR-PEIRCIILrapSGS-KVFSAGHDIHELpsggRDPLSYD--DPLRQIT 89
Cdd:PRK06072  10 YAIVTMSRPDKLNALNLEMRNEFISKLKQINAdPKIRVVIV---TGEgRAFCVGADLSEF----APDFAIDlrETFYPII 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    90 RMIQKFPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGVPYNLVGIHNLTRDAGFHIVKELIfTASPITA 169
Cdd:PRK06072  83 REIRFSDKIYISAINGVTAGACIGIALSTDFKFASRDVKFVTAFQRLGLASDTGVAYFLLKLTGQRFYEILV-LGGEFTA 161
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414   170 QRALAVGILNhvVEVEELEDfTLQMAHHISEKAPLAIAVIKeelRVLGEAHTMNSDEFERIQG-MRRAVYDSEDYQEGMN 248
Cdd:PRK06072 162 EEAERWGLLK--ISEDPLSD-AEEMANRISNGPFQSYIAAK---RMINLVLYNDLEEFLEYESaIQGYLGKTEDFKEGIS 235
                        250
                 ....*....|..
gi 8569414   249 AFLEKRKPNFVG 260
Cdd:PRK06072 236 SFKEKREPKFKG 247
PRK05674 PRK05674
gamma-carboxygeranoyl-CoA hydratase; Validated
14-256 2.04e-18

gamma-carboxygeranoyl-CoA hydratase; Validated


Pssm-ID: 168168  Cd Length: 265  Bit Score: 81.78  E-value: 2.04e-18
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    14 VAVIEFNYGRKLNALSKVFIDDLMQALSDL-NRPEIRCIILRAPSgsKVFSAGHDIHELPSGGRdpLSYD---DPLRQIT 89
Cdd:PRK05674  16 FATLWLSRADKNNAFNAQMIRELILALDQVqSDASLRFLLLRGRG--RHFSAGADLAWMQQSAD--LDYNtnlDDARELA 91
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    90 RMIQ---KFPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGV------PYNLVGIhnltrdaGFHIVKEL 160
Cdd:PRK05674  92 ELMYnlyRLKIPTLAVVQGAAFGGALGLISCCDMAIGADDAQFCLSEVRIGLapavisPFVVKAI-------GERAARRY 164
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414   161 IFTASPITAQRALAVGILNHVVEVEELEDFTLQMAHHISEKAPLAIAVIKEELRVLGEAhtmnsdefERIQGMRR----- 235
Cdd:PRK05674 165 ALTAERFDGRRARELGLLAESYPAAELEAQVEAWIANLLLNSPQALRASKDLLREVGDG--------ELSPALRRycena 236
                        250       260
                 ....*....|....*....|...
gi 8569414   236 --AVYDSEDYQEGMNAFLEKRKP 256
Cdd:PRK05674 237 iaRIRVSAEGQEGLRAFLEKRTP 259
PLN02664 PLN02664
enoyl-CoA hydratase/delta3,5-delta2,4-dienoyl-CoA isomerase
2-258 4.09e-18

enoyl-CoA hydratase/delta3,5-delta2,4-dienoyl-CoA isomerase


Pssm-ID: 178269  Cd Length: 275  Bit Score: 81.10  E-value: 4.09e-18
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414     2 SYQYVNVVTIN-KVAVIEFNYGR--KLNALSKVFIDDLMQALSDLNR-PEIRCIILrapSGS-KVFSAGHDIHELPSGGR 76
Cdd:PLN02664   3 SYKTLEIIQKSpNSSVFHLNLNRpsQRNALSLDFFTEFPKALSSLDQnPNVSVIIL---SGAgDHFCSGIDLKTLNSISE 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    77 DPLSYD-----DPLR-QITRM------IQKFPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGVPYNLVG 144
Cdd:PLN02664  80 QSSSGDrgrsgERLRrKIKFLqdaitaIEQCRKPVIAAIHGACIGGGVDIVTACDIRYCSEDAFFSVKEVDLAITADLGT 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414   145 IHNLTRDAGFHIVKELIFTASPITAQRALAVGILNHVV-EVEELEDFTLQMAHHISEKAPLAIAVIKEelrVLGEAHTMN 223
Cdd:PLN02664 160 LQRLPSIVGYGNAMELALTGRRFSGSEAKELGLVSRVFgSKEDLDEGVRLIAEGIAAKSPLAVTGTKA---VLLRSRELS 236
                        250       260       270
                 ....*....|....*....|....*....|....*.
gi 8569414   224 SDE-FERIQGMRRAVYDSEDYQEGMNAFLEKRKPNF 258
Cdd:PLN02664 237 VEQgLDYVATWNSAMLVSDDLNEAVSAQIQKRKPVF 272
PLN02888 PLN02888
enoyl-CoA hydratase
12-231 6.14e-17

enoyl-CoA hydratase


Pssm-ID: 215480  Cd Length: 265  Bit Score: 77.87  E-value: 6.14e-17
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    12 NKVAVIEFNYGRKLNALSKVFIDDLMQALSDLNR-PEIRCIILrapSGS-KVFSAGHDIhelpSGGRDPLSYD------D 83
Cdd:PLN02888  18 NGIATITINRPKALNALTRPMMVELAAAFKRLDEdDSVKVIIL---TGSgRAFCSGVDL----TAAEEVFKGDvkdvetD 90
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    84 PLRQItrmiQKFPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGVPYNLVGIHNLTRDAGFHIVKELIFT 163
Cdd:PLN02888  91 PVAQM----ERCRKPIIGAINGFAITAGFEIALACDILVASRGAKFIDTHAKFGIFPSWGLSQKLSRIIGANRAREVSLT 166
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414   164 ASPITAQRALAVGILNHVVEVEELEDFTLQMAHHISEKAPLAI----AVIKEELRV-LGEAHT------------MNSDE 226
Cdd:PLN02888 167 AMPLTAETAERWGLVNHVVEESELLKKAREVAEAIIKNNQGMVlrykSVINDGLKLdLGHALQlekerahdyyngMTKEQ 246

                 ....*
gi 8569414   227 FERIQ 231
Cdd:PLN02888 247 FQKMQ 251
PRK08258 PRK08258
enoyl-CoA hydratase; Provisional
12-260 7.40e-17

enoyl-CoA hydratase; Provisional


Pssm-ID: 181329  Cd Length: 277  Bit Score: 77.70  E-value: 7.40e-17
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    12 NKVAVIEFNYGRKLNAL---SKVFIDDLMQALSdlNRPEIRCIILRAPSGSkvFSAGHDIHEL--PSGGRDPlsydDPLR 86
Cdd:PRK08258  25 DGVATITLNRPERKNPLtfeSYAELRDLFRELV--YADDVKAVVLTGAGGN--FCSGGDVHEIigPLTKMDM----PELL 96
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    87 QITRM-------IQKFPKPIISMVEGsVWGGAFEMI-MSSDLIIAASTS--TFSMTPVNL-----GVPYNLVGIHNLTRD 151
Cdd:PRK08258  97 AFTRMtgdlvkaMRACPQPIIAAVDG-VCAGAGAILaMASDLRLGTPSAktAFLFTRVGLagadmGACALLPRIIGQGRA 175
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414   152 AgfhivkELIFTASPITAQRALAVGILNHVVEVEELEDFTLQMAHHISEKAPLAIAVIKeelRVLGEAHTMNSDEFERIQ 231
Cdd:PRK08258 176 S------ELLYTGRSMSAEEGERWGFFNRLVEPEELLAEAQALARRLAAGPTFAHGMTK---TMLHQEWDMGLEEAIEAE 246
                        250       260       270
                 ....*....|....*....|....*....|
gi 8569414   232 GMRRAV-YDSEDYQEGMNAFLEKRKPNFVG 260
Cdd:PRK08258 247 AQAQAIcMQTEDFRRAYEAFVAKRKPVFEG 276
PRK09076 PRK09076
enoyl-CoA hydratase; Provisional
36-257 6.69e-14

enoyl-CoA hydratase; Provisional


Pssm-ID: 236373  Cd Length: 258  Bit Score: 69.18  E-value: 6.69e-14
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    36 LMQALSDLN-RPEIRCIILRApSGSKVFSAGHDIHELPSGGRDPLsyddplRQITRM-------IQKFPKPIISMVEGSV 107
Cdd:PRK09076  34 LKQLVLELNaDKDVYALVITG-DGEKFFSAGADLNLFADGDKAVA------REMARRfgeafeaLSAFRGVSIAAINGYA 106
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414   108 WGGAFEMIMSSDLIIAAststfsmTPVNLGVPYNLVGI-------HNLTRDAGFHIVKELIFTASPITAQRALAVGILNH 180
Cdd:PRK09076 107 MGGGLECALACDIRIAE-------EQAQMALPEASVGLlpcaggtQNLPWLVGEGWAKRMILCGERVDAATALRIGLVEE 179
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414   181 VVEVEELEDFTLQMAHHISEKAPLAIAVIKeelRVLGEAHTMNSD-----EFERIQGMrravYDSEDYQEGMNAFLEKRK 255
Cdd:PRK09076 180 VVEKGEAREAALALAQKVANQSPSAVAACK---TLIQAARNGPRAaalalERELFVDL----FDTEDQREGVNAFLEKRA 252

                 ..
gi 8569414   256 PN 257
Cdd:PRK09076 253 PQ 254
PRK05617 PRK05617
3-hydroxyisobutyryl-CoA hydrolase; Provisional
6-190 1.54e-12

3-hydroxyisobutyryl-CoA hydrolase; Provisional


Pssm-ID: 235533  Cd Length: 342  Bit Score: 66.00  E-value: 1.54e-12
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414     6 VNVVTINKVAVIEFNYGRKLNALSKVFIDDLMQALSD-LNRPEIRCIILRApSGSKVFSAGHDI---HELPSGGrDPLSY 81
Cdd:PRK05617   5 VLAEVEGGVGVITLNRPKALNALSLEMIRAIDAALDAwEDDDAVAAVVIEG-AGERGFCAGGDIralYEAARAG-DPLAA 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    82 DDPLRQITRM---IQKFPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLG-VPYnlVGI-HNLTRDAGfHI 156
Cdd:PRK05617  83 DRFFREEYRLnalIARYPKPYIALMDGIVMGGGVGISAHGSHRIVTERTKMAMPETGIGfFPD--VGGtYFLSRAPG-AL 159
                        170       180       190
                 ....*....|....*....|....*....|....
gi 8569414   157 VKELIFTASPITAQRALAVGILNHVVEVEELEDF 190
Cdd:PRK05617 160 GTYLALTGARISAADALYAGLADHFVPSADLPAL 193
fadB PRK11730
multifunctional fatty acid oxidation complex subunit alpha; Reviewed
12-194 1.91e-12

multifunctional fatty acid oxidation complex subunit alpha; Reviewed


Pssm-ID: 183293 [Multi-domain]  Cd Length: 715  Bit Score: 66.42  E-value: 1.91e-12
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    12 NKVAVIEFNYGRKLNALSKVFIDDLMQALSDLNR-PEIRCIILRapSGSKVFSAGHDIHE-LPSGGRDPLSYDDPLRQIT 89
Cdd:PRK11730  15 DGIAELVFDAPGSVNKLDRATLASLGEALDALEAqSDLKGLLLT--SAKDAFIVGADITEfLSLFAAPEEELSQWLHFAN 92
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    90 RMIQKF---PKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGVPYNLVGIHNLTRDAGFHIVKELIFTASP 166
Cdd:PRK11730  93 SIFNRLedlPVPTVAAINGYALGGGCECVLATDYRVASPDARIGLPETKLGIMPGFGGTVRLPRLIGADNALEWIAAGKD 172
                        170       180
                 ....*....|....*....|....*...
gi 8569414   167 ITAQRALAVGILNHVVEVEELEDFTLQM 194
Cdd:PRK11730 173 VRAEDALKVGAVDAVVAPEKLQEAALAL 200
PRK06023 PRK06023
enoyl-CoA hydratase; Provisional
14-214 2.44e-12

enoyl-CoA hydratase; Provisional


Pssm-ID: 168351  Cd Length: 251  Bit Score: 64.81  E-value: 2.44e-12
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    14 VAVIEFNYGRKLNALSKVFIDDLMQALSDLNR-PEIRCIILRAPSGSkvFSAGHDIHELPSGGRDPLSYDDPLRQITRMI 92
Cdd:PRK06023  16 VQVIRFNRPEKKNAITRAMYATMAKALKAADAdDAIRAHVFLGTEGC--FSAGNDMQDFLAAAMGGTSFGSEILDFLIAL 93
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    93 QKFPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLG-VP---YNLVGIHNLTRDAGFhivkELIFTASPIT 168
Cdd:PRK06023  94 AEAEKPIVSGVDGLAIGIGTTIHLHCDLTFASPRSLFRTPFVDLAlVPeagSSLLAPRLMGHQRAF----ALLALGEGFS 169
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|....*.
gi 8569414   169 AQRALAVGILNHVVEVEELEDFTLQMAHHISEKAPLAIAVIKEELR 214
Cdd:PRK06023 170 AEAAQEAGLIWKIVDEEAVEAETLKAAEELAAKPPQALQIARDLMR 215
PRK12478 PRK12478
enoyl-CoA hydratase; Provisional
1-205 7.92e-12

enoyl-CoA hydratase; Provisional


Pssm-ID: 183548  Cd Length: 298  Bit Score: 63.82  E-value: 7.92e-12
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414     1 MSYQYVNVVTINKVAVIEFNYGRKLNALSKVFIDDLMQALSDLNR-PEIRCIILRApsGSKVFSAGHDI--------HEL 71
Cdd:PRK12478   2 PDFQTLLYTTAGPVATITLNRPEQLNTIVPPMPDEIEAAIGLAERdQDIKVIVLRG--AGRAFSGGYDFgggfqhwgEAM 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    72 PSGGR-DP-LSYDDPLRQITRMIQKF------PKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTfsmtpvnLGVPYN-- 141
Cdd:PRK12478  80 MTDGRwDPgKDFAMVTARETGPTQKFmaiwraSKPVIAQVHGWCVGGASDYALCADIVIASDDAV-------IGTPYSrm 152
                        170       180       190       200       210       220       230
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414   142 ----LVG--IHNLtrdaGFHIVKELIFTASPITAQRALAVGILNHVVEVEELEDFTLQMAHHISeKAPLA 205
Cdd:PRK12478 153 wgayLTGmwLYRL----SLAKVKWHSLTGRPLTGVQAAEAELINEAVPFERLEARVAEVATELA-RIPLS 217
PRK07112 PRK07112
polyketide biosynthesis enoyl-CoA hydratase; Validated
1-237 1.55e-11

polyketide biosynthesis enoyl-CoA hydratase; Validated


Pssm-ID: 235938  Cd Length: 255  Bit Score: 62.39  E-value: 1.55e-11
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414     1 MSYQYVNVVTINKVAVIEFNYGRKLNALSKVFIDDLMQALSDLNRpEIRCIILRA-PsgsKVFSAGHD---IHELPSGGR 76
Cdd:PRK07112   1 MDYQTIRVRQQGDVCFLQLHRPEAQNTINDRLIAECMDVLDRCEH-AATIVVLEGlP---EVFCFGADfsaIAEKPDAGR 76
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    77 DPLSYDDPLRQITRMIQKFPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLG------VPYnlvgihnLTR 150
Cdd:PRK07112  77 ADLIDAEPLYDLWHRLATGPYVTIAHVRGKVNAGGIGFVAASDIVIADETAPFSLSELLFGlipacvLPF-------LIR 149
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414   151 DAGFHIVKELIFTASPITAQRALAVGILNHVVE--------------------VEELEDFTLQMAHHISEKAPLAIAVIK 210
Cdd:PRK07112 150 RIGTQKAHYMTLMTQPVTAQQAFSWGLVDAYGAnsdtllrkhllrlrclnkaaVARYKSYASTLDDTVAAARPAALAANI 229
                        250       260
                 ....*....|....*....|....*..
gi 8569414   211 EelrvlgeahtMNSDEfERIQGMRRAV 237
Cdd:PRK07112 230 E----------MFADP-ENLRKIARYV 245
PRK08272 PRK08272
enoyl-CoA hydratase; Provisional
1-199 2.88e-11

enoyl-CoA hydratase; Provisional


Pssm-ID: 236213  Cd Length: 302  Bit Score: 61.98  E-value: 2.88e-11
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414     1 MSYQYVNVVTINKVAVIEFNYGRKLNALSKVFIDDLMQAL--SDLNrPEIRCIILrapSGS-KVFSAGHDIHELPSGGRD 77
Cdd:PRK08272   7 DNLKTMTYEVTGRIARITLNRPEKGNAITADTPLELRAAVerADLD-PGVHVILV---SGAgKGFCAGYDLSAYAEGSSS 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    78 PLSYDDPLRQIT----------------RMIQKF----------PKPIISMVEGSVWGGAFEMIMSSDLIIAASTST--F 129
Cdd:PRK08272  83 GGGGGAYPGKRQavnhlpddpwdpmidyQMMSRFvrgfmslwhaHKPTVAKVHGYCVAGGTDIALHCDQVIAADDAKigY 162
                        170       180       190       200       210       220       230
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414   130 SMTPVNlGVPYNLVGIHNLtrdaGFHIVKELIFTASPITAQRALAVGILNHVVEVEELEDFTLQMAHHIS 199
Cdd:PRK08272 163 PPTRVW-GVPATGMWAYRL----GPQRAKRLLFTGDCITGAQAAEWGLAVEAVPPEELDERTERLVERIA 227
PRK07327 PRK07327
enoyl-CoA hydratase; Provisional
17-258 3.68e-11

enoyl-CoA hydratase; Provisional


Pssm-ID: 235991  Cd Length: 268  Bit Score: 61.58  E-value: 3.68e-11
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    17 IEFNYGRKLNALSKVFIDDLMQALSDLNR-PEIRCIILRAPSgsKVFSAGHDIHELPSGGRDplsYDDPLR------QIT 89
Cdd:PRK07327  25 IVLNGPGALNAADARMHRELADIWRDVDRdPDVRVVLIRGEG--KAFSAGGDLALVEEMADD---FEVRARvwrearDLV 99
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    90 RMIQKFPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGVPynlvgihnltrdAGFH--IV---------- 157
Cdd:PRK07327 100 YNVINCDKPIVSAIHGPAVGAGLVAALLADISIAAKDARIIDGHTRLGVA------------AGDHaaIVwpllcgmaka 167
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414   158 KELIFTASPITAQRALAVGILNHVVEVEELEDFTLQMAHHISEKAPLAIAVIKEEL----RVLGEAhtmnsdeFERIQGM 233
Cdd:PRK07327 168 KYYLLLCEPVSGEEAERIGLVSLAVDDDELLPKALEVAERLAAGSQTAIRWTKYALnnwlRMAGPT-------FDTSLAL 240
                        250       260
                 ....*....|....*....|....*
gi 8569414   234 RRAVYDSEDYQEGMNAFLEKRKPNF 258
Cdd:PRK07327 241 EFMGFSGPDVREGLASLREKRAPDF 265
FadB TIGR02437
fatty oxidation complex, alpha subunit FadB; Members represent alpha subunit of ...
14-194 5.38e-11

fatty oxidation complex, alpha subunit FadB; Members represent alpha subunit of multifunctional enzyme complex of the fatty acid degradation cycle. Activities include: enoyl-CoA hydratase (EC 4.2.1.17), dodecenoyl-CoA delta-isomerase activity (EC 5.3.3.8), 3-hydroxyacyl-CoA dehydrogenase (EC 1.1.1.35), 3-hydroxybutyryl-CoA epimerase (EC 5.1.2.3). A representative is E. coli FadB (SP:P21177). This model excludes the FadJ family represented by SP:P77399. [Fatty acid and phospholipid metabolism, Degradation]


Pssm-ID: 131490 [Multi-domain]  Cd Length: 714  Bit Score: 62.15  E-value: 5.38e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414     14 VAVIEFNYGRKLNALSKVFIDDLMQALSDLN-RPEIRCIILRapSGSKVFSAGHDIHELPSGGRDP----LSYDDPLRQI 88
Cdd:TIGR02437  17 IAELKFDAPGSVNKFDRATLASLDQALDAIKaQSSLKGVILT--SGKDAFIVGADITEFLGLFALPdaelIQWLLFANSI 94
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414     89 TRMIQKFPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGVPYNLVGIHNLTRDAGFHIVKELIFTASPIT 168
Cdd:TIGR02437  95 FNKLEDLPVPTVAAINGIALGGGCECVLATDFRIADDTAKIGLPETKLGIMPGFGGTVRLPRVIGADNALEWIASGKENR 174
                         170       180
                  ....*....|....*....|....*.
gi 8569414    169 AQRALAVGILNHVVEVEELEDFTLQM 194
Cdd:TIGR02437 175 AEDALKVGAVDAVVTADKLGAAALQL 200
PRK05869 PRK05869
enoyl-CoA hydratase; Validated
26-210 5.84e-11

enoyl-CoA hydratase; Validated


Pssm-ID: 235632  Cd Length: 222  Bit Score: 60.24  E-value: 5.84e-11
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    26 NALSKVFIDDLMQALSDLN-RPEIRCIILRApsGSKVFSAGHDIHELPS-GGRDPLSYDDPLRQITRMIQKFPKPIISMV 103
Cdd:PRK05869  29 NALTRQVYREIVAAANELGrRDDVAAVILYG--GHEIFSAGDDMPELRTlSAQEADTAARVRQQAVDAVAAIPKPTVAAI 106
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414   104 EGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGVPYNLVGIHNLTRDAGFHIVKELIFTASPITAQRALAVGILNHVVE 183
Cdd:PRK05869 107 TGYALGAGLTLALAADWRVSGDNVKFGATEILAGLAPSGDGMARLTRAAGPSRAKELVFSGRFFDAEEALALGLIDEMVA 186
                        170       180
                 ....*....|....*....|....*..
gi 8569414   184 VEELEDFTLQMAHHISEKAPLAIAVIK 210
Cdd:PRK05869 187 PDDVYDAAAAWARRFLDGPPHALAAAK 213
dienoyl_CoA_hyt TIGR03189
cyclohexa-1,5-dienecarbonyl-CoA hydratase; This enzyme, cyclohexa-1,5-dienecarbonyl-CoA ...
24-258 9.91e-11

cyclohexa-1,5-dienecarbonyl-CoA hydratase; This enzyme, cyclohexa-1,5-dienecarbonyl-CoA hydratase, also called dienoyl-CoA hydratase, acts on the product of benzoyl-CoA reductase (EC 1.3.99.15). Benzoyl-CoA is a common intermediate in the degradation of many aromatic compounds, and this enzyme is part of an anaerobic pathway for dearomatization and degradation.


Pssm-ID: 132233  Cd Length: 251  Bit Score: 59.96  E-value: 9.91e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414     24 KLNALSKVFIDDLMQALSD-LNRPEIRCIILRAPSGSKVFSAGHDIHeLPSGGRDPLSyddPLRQITRMIQKFPKPIISM 102
Cdd:TIGR03189  20 KANIVDAAMIAALSAALGEhLEDSALRAVLLDAEGPHFSFGASVAEH-MPDQCAAMLA---SLHKLVIAMLDSPVPILVA 95
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    103 VEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGVpYNLVGIHNLTRDAGFHIVKELIFTASPITAQRALAVGILNHVV 182
Cdd:TIGR03189  96 VRGQCLGGGLEVAAAGNLMFAAPDAKLGQPEIVLGV-FAPAASCLLPERMGRVAAEDLLYSGRSIDGAEGARIGLANAVA 174
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 8569414    183 EVEE---LEDFTLQMAHHisEKAPLAIAVIKEELRVLGEAHTmNSDEFERIqgMRRAVYDSEDYQEGMNAFLEKRKPNF 258
Cdd:TIGR03189 175 EDPEnaaLAWFDEHPAKL--SASSLRFAVRAARLGMNERVKA-KIAEVEAL--YLEELMATHDAVEGLNAFLEKRPALW 248
ECH_2 pfam16113
Enoyl-CoA hydratase/isomerase; This family contains a diverse set of enzymes including: ...
14-190 2.93e-10

Enoyl-CoA hydratase/isomerase; This family contains a diverse set of enzymes including: enoyl-CoA hydratase, napthoate synthase, carnitate racemase, 3-hydroxybutyryl-CoA dehydratase and dodecanoyl-CoA delta-isomerase. This family differs from pfam00378 in the structure of it's C-terminus.


Pssm-ID: 339613  Cd Length: 330  Bit Score: 59.38  E-value: 2.93e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414     14 VAVIEFNYGRKLNALSKVFIDDLMQALSDLNR-PEIRCIILRApSGSKVFSAGHDIHELPSGGR--DPLSYDDPLRQITR 90
Cdd:pfam16113   1 VGVITLNRPKALNALNLEMVRALLAALKAWEDdPAVKLVVLKG-AGERAFCAGGDVRALYEAAKagGGDAARDFFREEYR 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414     91 M---IQKFPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLG-VP-----YNL------VGIHnltrdagfh 155
Cdd:pfam16113  80 LnylIATYPKPYVALMDGIVMGGGVGLSVHGSFRVATERTRFAMPETAIGlFPdvggsYFLsrlpgeLGLY--------- 150
                         170       180       190
                  ....*....|....*....|....*....|....*
gi 8569414    156 ivkeLIFTASPITAQRALAVGILNHVVEVEELEDF 190
Cdd:pfam16113 151 ----LALTGARLNGADALAAGLATHYVPSEDLPAL 181
fa_ox_alpha_mit TIGR02441
fatty acid oxidation complex, alpha subunit, mitochondrial; Members represent alpha subunit of ...
1-201 1.56e-09

fatty acid oxidation complex, alpha subunit, mitochondrial; Members represent alpha subunit of mitochondrial multifunctional fatty acid degradation enzyme complex. Subunit activities include: enoyl-CoA hydratase (EC 4.2.1.17) _ 3-hydroxyacyl-CoA dehydrogenase (EC 1.1.1.35). Some characterization in human (SP:P40939), pig (SP:Q29554), and rat (SP:Q64428). The beta subunit has activity: acetyl-CoA C-acyltransferase (EC 2.3.1.16).


Pssm-ID: 131494 [Multi-domain]  Cd Length: 737  Bit Score: 57.92  E-value: 1.56e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414      1 MSYQYVNVVTINKVAVIEFNY-GRKLNALSKVFIDDLMQALSDL-NRPEIRCIILRApSGSKVFSAGHDIHELPSGGR-- 76
Cdd:TIGR02441  10 MARTHRHYEVKGDVAVVKIDSpNSKVNTLSKELFAEFKEVMNELwTNEAIKSAVLIS-GKPGSFVAGADIQMIAACKTaq 88
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414     77 --DPLSYDDPlRQITRMiQKFPKPIISMVEGSVWGGAFEMIMSSDLIIAA--STSTFSMTPVNLGVPYNLVGIHNLTRDA 152
Cdd:TIGR02441  89 evTQLSQEGQ-EMFERI-EKSQKPIVAAISGSCLGGGLELALACHYRIATkdRKTLLGLPEVMLGLLPGAGGTQRLPKLT 166
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 8569414    153 GFHIVKELIFTASPITAQRALAVGILNHVVE-------------VEELEDFTLQMAHHISEK 201
Cdd:TIGR02441 167 GVPAALDMMLTGKKIRADRAKKMGIVDQLVDplgpglkpaeentIEYLEEVAVKFAQGLANG 228
PRK07110 PRK07110
polyketide biosynthesis enoyl-CoA hydratase; Validated
26-233 1.73e-09

polyketide biosynthesis enoyl-CoA hydratase; Validated


Pssm-ID: 235936  Cd Length: 249  Bit Score: 56.51  E-value: 1.73e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    26 NALSKVFIDDLMQALSDLNR-PEIRCIILRAPSgsKVFSAGHDIHELPSGGRDPLSYDDPLrqITRMIQKFPKPIISMVE 104
Cdd:PRK07110  27 NAFSDELCDQLHEAFDTIAQdPRYKVVILTGYP--NYFATGGTQEGLLSLQTGKGTFTEAN--LYSLALNCPIPVIAAMQ 102
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414   105 GSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGVPYNLVGIHNLTRDAGFHIVKELIFTASPITAQRALAVGILNHVVEV 184
Cdd:PRK07110 103 GHAIGGGLVLGLYADIVVLSRESVYTANFMKYGFTPGMGATAILPEKLGLALGQEMLLTARYYRGAELKKRGVPFPVLPR 182
                        170       180       190       200       210       220
                 ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 8569414   185 EELEDFTLQMAHHISEKAPLAIAVIKEEL-----RVLGEA-------H--TMNSDEFE-RIQGM 233
Cdd:PRK07110 183 AEVLEKALELARSLAEKPRHSLVLLKDHLvadrrRRLPEVieqevamHekTFHQPEVKrRIESL 246
PRK08150 PRK08150
enoyl-CoA hydratase; Provisional
4-254 5.29e-09

enoyl-CoA hydratase; Provisional


Pssm-ID: 181254  Cd Length: 255  Bit Score: 55.02  E-value: 5.29e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414     4 QYVNVVTINKVAVIEFNYGRKLNALSKVFIDDLMQALSDLNRpEIRCIILRApSGSKvFSAGHDIHELpsGGRDPLSYdd 83
Cdd:PRK08150   2 SLVSYELDGGVATIGLNRPAKRNALNDGLIAALRAAFARLPE-GVRAVVLHG-EGDH-FCAGLDLSEL--RERDAGEG-- 74
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    84 plRQITRM-------IQKFPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFsmtpvnlGVPYNLVGIH-------NLT 149
Cdd:PRK08150  75 --MHHSRRwhrvfdkIQYGRVPVIAALHGAVVGGGLELASAAHIRVADESTYF-------ALPEGQRGIFvggggsvRVP 145
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414   150 RDAGFHIVKELIFTASPITAQRALAVGILNHVVEVEELEDFTLQMAHHISEKAPLAIAVIkeeLRVLGEAHTMNSDEFER 229
Cdd:PRK08150 146 RLIGVARMTDMMLTGRVYDAQEGERLGLAQYLVPAGEALDKAMELARRIAQNAPLTNFAV---LNALPRIADMSADDGLF 222
                        250       260
                 ....*....|....*....|....*.
gi 8569414   230 IQGMRRAVYDSE-DYQEGMNAFLEKR 254
Cdd:PRK08150 223 VESLMAAVAQSApEAKERLRAFLEKK 248
PRK06213 PRK06213
enoyl-CoA hydratase; Provisional
12-197 6.04e-09

enoyl-CoA hydratase; Provisional


Pssm-ID: 235744  Cd Length: 229  Bit Score: 54.59  E-value: 6.04e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    12 NKVAVIEFNYGrKLNALSKVFIDDLMQALsdlNRPEIRCIILRAPSGSKVFSAGHDIHELPSGGRDPLSYDDPLRQITRM 91
Cdd:PRK06213  11 DGVATITLDDG-KVNALSPAMIDALNAAL---DQAEDDRAVVVITGQPGIFSGGFDLKVMTSGAQAAIALLTAGSTLARR 86
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    92 IQKFPKPIISMVEG-SVWGGAFeMIMSSDLIIAA-STSTFSMTPVNLGVPYNLVGIHnLTRD----AGFHIVkelIFTAS 165
Cdd:PRK06213  87 LLSHPKPVIVACTGhAIAKGAF-LLLSADYRIGVhGPFKIGLNEVAIGMTMPHAAIE-LARDrltpSAFQRA---VINAE 161
                        170       180       190
                 ....*....|....*....|....*....|..
gi 8569414   166 PITAQRALAVGILNHVVEVEELEDFTLQMAHH 197
Cdd:PRK06213 162 MFDPEEAVAAGFLDEVVPPEQLLARAQAAARE 193
PLN02874 PLN02874
3-hydroxyisobutyryl-CoA hydrolase-like protein
11-189 8.12e-08

3-hydroxyisobutyryl-CoA hydrolase-like protein


Pssm-ID: 178462  Cd Length: 379  Bit Score: 52.11  E-value: 8.12e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    11 INKVAVIEFNYGRKLNALSKVFIDDLMQALSDLNRPE-IRCIILRApsGSKVFSAGHDIHELPSGGRdplSYDDPLRQIT 89
Cdd:PLN02874  18 KGRVRVITLNRPRQLNVISLSVVSLLAEFLEQWEKDDsVELIIIKG--AGRAFSAGGDLKMFYDGRE---SDDSCLEVVY 92
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    90 RM------IQKFPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMtpvnlgvPYNLVGIHNltrDAGF--------- 154
Cdd:PLN02874  93 RMywlcyhIHTYKKTQVALVHGLVMGGGAGLMVPMKFRVVTEKTVFAT-------PEASVGFHT---DCGFsyilsrlpg 162
                        170       180       190
                 ....*....|....*....|....*....|....*
gi 8569414   155 HIVKELIFTASPITAQRALAVGILNHVVEVEELED 189
Cdd:PLN02874 163 HLGEYLALTGARLNGKEMVACGLATHFVPSEKLPE 197
PRK08259 PRK08259
enoyl-CoA hydratase; Provisional
62-199 1.67e-07

enoyl-CoA hydratase; Provisional


Pssm-ID: 236205  Cd Length: 254  Bit Score: 50.67  E-value: 1.67e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    62 FSAGHDIHEL--PSGGRDPLSYDDPLrQITRMIqkFPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGVP 139
Cdd:PRK08259  60 FCAGADLKAVgtGRGNRLHPSGDGPM-GPSRMR--LSKPVIAAVSGYAVAGGLELALWCDLRVAEEDAVFGVFCRRWGVP 136
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 8569414   140 ynLV--GIHNLTRDAGFHIVKELIFTASPITAQRALAVGILNHVVEVEELEDFTLQMAHHIS 199
Cdd:PRK08259 137 --LIdgGTVRLPRLIGHSRAMDLILTGRPVDADEALAIGLANRVVPKGQARAAAEELAAELA 196
PRK05864 PRK05864
enoyl-CoA hydratase; Provisional
14-259 4.42e-07

enoyl-CoA hydratase; Provisional


Pssm-ID: 168278  Cd Length: 276  Bit Score: 49.45  E-value: 4.42e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    14 VAVIEFNYGRKLNALSKVFIDDLMQALSDL-NRPEIRCIILRApsGSKVFSAGHDiHElpSGGRDP-----------LSY 81
Cdd:PRK05864  20 IALITLNRPERMNSMAFDVMVPLKEALAEVsYDNSVRVVVLTG--AGRGFSSGAD-HK--SAGVVPhvegltrptyaLRS 94
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    82 DDPLRQITRMIQKFPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGVPYNLVGI-HNLTRDAGFHIVKEL 160
Cdd:PRK05864  95 MELLDDVILALRRLHQPVIAAVNGPAIGGGLCLALAADIRVASSSAYFRAAGINNGLTASELGLsYLLPRAIGSSRAFEI 174
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414   161 IFTASPITAQRALAVGILNHVVEVEELEDFTLQMAHHISEKAPLAIAVIKEELRVLGEAHTMNSDEFERIQGMRRAVYDS 240
Cdd:PRK05864 175 MLTGRDVDAEEAERIGLVSRQVPDEQLLDTCYAIAARMAGFSRPGIELTKRTLWSGLDAASLEAHMQAEGLGQLFVRLLT 254
                        250
                 ....*....|....*....
gi 8569414   241 EDYQEGMNAFLEKRKPNFV 259
Cdd:PRK05864 255 ANFEEAVAARAEKRPPVFT 273
FadJ TIGR02440
fatty oxidation complex, alpha subunit FadJ; Members represent alpha subunit of ...
12-195 5.16e-07

fatty oxidation complex, alpha subunit FadJ; Members represent alpha subunit of multifunctional enzyme complex of the fatty acid degradation cycle. Plays a minor role in aerobic beta-oxidation of fatty acids. FadJI complex is necessary for anaerobic growth on short-chain acids with nitrate as an electron acceptor. Activities include: enoyl-CoA hydratase (EC 4.2.1.17),3-hydroxyacyl-CoA dehydrogenase (EC 1.1.1.35), 3-hydroxybutyryl-CoA epimerase (EC 5.1.2.3). A representative is E. coli FadJ (aka YfcX) (SP:P77399). This model excludes the FadB of TIGR02437 equivalog model. [Fatty acid and phospholipid metabolism, Degradation]


Pssm-ID: 131493 [Multi-domain]  Cd Length: 699  Bit Score: 50.20  E-value: 5.16e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414     12 NKVAVIEFNY-GRKLNALSKVFIDDLMQALSDLNR-PEIRCIILRapSGSK-VFSAGHDIHELPS--GGRDPLSYDDPLR 86
Cdd:TIGR02440   9 DGIAILTIDVpGEKMNTLKAEFADQVSEILSQLKRdKSIRGLVLV--SGKPdNFIAGADISMLAAcqTAGEAKALAQQGQ 86
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414     87 QITRMIQKFPKPIISMVEGSVWGGAFEMIMS--SDLIIAASTSTFSMTPVNLGVPYNLVGIHNLTRDAGFHIVKELIFTA 164
Cdd:TIGR02440  87 VLFAELEALPIPVVAAIHGACLGGGLELALAchSRVCSDDDKTVLGLPEVQLGLLPGSGGTQRLPRLIGVSTALDMILTG 166
                         170       180       190
                  ....*....|....*....|....*....|.
gi 8569414    165 SPITAQRALAVGILNHVVEVEELEDFTLQMA 195
Cdd:TIGR02440 167 KQLRAKQALKLGLVDDVVPQSILLDTAVEMA 197
PRK05870 PRK05870
enoyl-CoA hydratase; Provisional
12-214 7.64e-07

enoyl-CoA hydratase; Provisional


Pssm-ID: 180298  Cd Length: 249  Bit Score: 48.57  E-value: 7.64e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    12 NKVAVIEFNYGRKLNALSKVFIDDLMQALSDLNR-PEIRCIILRApsGSKVFSAGHDIHELPSGGRDPLsyDDPLRQITR 90
Cdd:PRK05870  11 DGVALITVNDPDRRNAVTAEMSAQLRAAVAAAEAdPDVHALVVTG--AGKAFCAGADLTALGAAPGRPA--EDGLRRIYD 86
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    91 ---MIQKFPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLgvpynlvGIHN-------LTRDAGFHIVKEL 160
Cdd:PRK05870  87 gflAVASCPLPTIAAVNGAAVGAGLNLALAADVRIAGPKALFDARFQKL-------GLHPgggatwmLQRAVGPQVARAA 159
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|....
gi 8569414   161 IFTASPITAQRALAVGILNHVveVEELEDFTLQMAHHISEKAPLAIAVIKEELR 214
Cdd:PRK05870 160 LLFGMRFDAEAAVRHGLALMV--ADDPVAAALELAAGPAAAPRELVLATKASMR 211
PRK08788 PRK08788
enoyl-CoA hydratase; Validated
100-183 4.78e-06

enoyl-CoA hydratase; Validated


Pssm-ID: 236338  Cd Length: 287  Bit Score: 46.44  E-value: 4.78e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414   100 ISMVEGSVWGGAFEMIMSSDLIIAASTSTFsmtpvnlGVP---YNL---VGIHN-LTRDAGFHIVKELIFTASPITAQRA 172
Cdd:PRK08788 125 IALVQGDALGGGFEAALSHHTIIAERGAKM-------GFPeilFNLfpgMGAYSfLARRVGPKLAEELILSGKLYTAEEL 197
                         90
                 ....*....|.
gi 8569414   173 LAVGILNHVVE 183
Cdd:PRK08788 198 HDMGLVDVLVE 208
PLN02988 PLN02988
3-hydroxyisobutyryl-CoA hydrolase
12-187 1.69e-03

3-hydroxyisobutyryl-CoA hydrolase


Pssm-ID: 178568  Cd Length: 381  Bit Score: 38.93  E-value: 1.69e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    12 NKVAVIEFNYGRKLNALSKVFIDDLMQA-LSDLNRPEIRCIILRApsGSKVFSAGHDI----HELPSGG-RDPLSYDDPL 85
Cdd:PLN02988  17 SSVRILTLNRPKQLNALSFHMISRLLQLfLAFEEDPSVKLVILKG--HGRAFCAGGDVaavvRDIEQGNwRLGANFFSDE 94
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    86 RQITRMIQKFPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGVPYNLVGIHNLTRDAGFhIVKELIFTAS 165
Cdd:PLN02988  95 YMLNYVMATYSKAQVSILNGIVMGGGAGVSVHGRFRIATENTVFAMPETALGLFPDVGASYFLSRLPGF-FGEYVGLTGA 173
                        170       180
                 ....*....|....*....|..
gi 8569414   166 PITAQRALAVGILNHVVEVEEL 187
Cdd:PLN02988 174 RLDGAEMLACGLATHFVPSTRL 195
fadJ PRK11154
multifunctional fatty acid oxidation complex subunit alpha; Reviewed
12-195 7.56e-03

multifunctional fatty acid oxidation complex subunit alpha; Reviewed


Pssm-ID: 236864 [Multi-domain]  Cd Length: 708  Bit Score: 37.18  E-value: 7.56e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    12 NKVAVIEFNY-GRKLNALSKVFIDDLMQALSDLNR-PEIRCIILRapSGSK-VFSAGHDIHELpsggrDPLSYDDPLRQI 88
Cdd:PRK11154  14 DNIAVITIDVpGEKMNTLKAEFAEQVRAILKQLREdKELKGVVFI--SGKPdNFIAGADINML-----AACKTAQEAEAL 86
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 8569414    89 TRM-------IQKFPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSM-TP-VNLGVPYNLVGIHNLTRDAGFHIVKE 159
Cdd:PRK11154  87 ARQgqqlfaeIEALPIPVVAAIHGACLGGGLELALACHYRVCTDDPKTVLgLPeVQLGLLPGSGGTQRLPRLIGVSTALD 166
                        170       180       190
                 ....*....|....*....|....*....|....*.
gi 8569414   160 LIFTASPITAQRALAVGILNHVVEVEELEDFTLQMA 195
Cdd:PRK11154 167 MILTGKQLRAKQALKLGLVDDVVPHSILLEVAVELA 202
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.17
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH