NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|929653856|dbj|BAA13404|]
View 

Protein Classification

EFh_SPARC_TICN2 and TY domain-containing protein (domain architecture ID 12199546)

protein containing domains KAZAL_FS, EFh_SPARC_TICN2, and TY

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
EFh_SPARC_TICN2 cd16238
EF-hand, extracellular calcium-binding (EC) motif, found in testican-2 (TICN2); TICN2, also ...
199-310 4.38e-78

EF-hand, extracellular calcium-binding (EC) motif, found in testican-2 (TICN2); TICN2, also termed SPARC/osteonectin, CWCV, and Kazal-like domains proteoglycan 2 (Spock2), is an extracellular heparan sulphate proteoglycan expressed in brain, lung, and testis. It inhibits neurite extension from cultured primary cerebellar neurons and may play regulatory roles in the development of the central nervous system. It also participates in diverse steps of neurogenesis. Moreover, TICN2 may contribute to ECM remodeling by regulating function(s) of other testican family members, which possess membrane-type matrix metalloproteinases (MT-MMPs) inhibitory function. Furthermore, TICN2 corresponding gene SPOCK2 acts as a susceptibility gene for bronchopulmonary dysplasia. TICN2 contains an N-terminal signal peptide, a testican-specific domain followed by a follistatin-like (FS) domain, an extracellular calcium-binding (EC) domain including a pair of EF hands, a thyroglobulin-like domain (TY), and a C-terminal region with two putative glycosaminoglycan attachment sites. The substitution of a ligating Asp residue by Tyr292 in the +Y position of EF-hand 2 in TICN2 could prevent Ca2+ binding to this site and also cause EF-hand 1 to bind one Ca2+ ion with low affinity.


:

Pssm-ID: 320017  Cd Length: 112  Bit Score: 237.14  E-value: 4.38e-78
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 929653856 199 CTGQDLADLGDRLRDWFQLLHENSKQNGSASSVAGPASGLDKSLGASCKDSIGWMFSKLDTSADLFLDQTELAAINLDKY 278
Cdd:cd16238    1 CTGQDLADLGDRLRDWFQLLHENSKQNGSGSPPASPASALDRSLVASCKDSIGWMFSKLDTSGDLFLDQAELAAINLDKY 80
                         90       100       110
                 ....*....|....*....|....*....|..
gi 929653856 279 EVCIRPFFNSCDTYKDGRVSTAEWCFCFWREK 310
Cdd:cd16238   81 EVCIRPFFNSCDTYRDGRVSTAEWCFCFWREK 112
TY cd00191
Thyroglobulin type I repeats.; The N-terminal region of human thyroglobulin contains 11 type-1 ...
312-376 5.37e-22

Thyroglobulin type I repeats.; The N-terminal region of human thyroglobulin contains 11 type-1 repeats TY repeats are proposed to be inhibitors of cysteine proteases


:

Pssm-ID: 238114  Cd Length: 66  Bit Score: 88.67  E-value: 5.37e-22
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 929653856 312 PCLAELERIQIQEAAKKKPGIFIPSCDEDGYYRKMQCDQSSGDCWCVDQLGLELTGTRTH-GSPDC 376
Cdd:cd00191    1 PCERERASALESLAGPKLSGLYVPQCDEDGNYEPVQCHGSTGYCWCVDPDGEEIPGTRTRgGPPNC 66
KAZAL smart00280
Kazal type serine protease inhibitors; Kazal type serine protease inhibitors and ...
147-180 5.93e-09

Kazal type serine protease inhibitors; Kazal type serine protease inhibitors and follistatin-like domains.


:

Pssm-ID: 197624  Cd Length: 46  Bit Score: 51.53  E-value: 5.93e-09
                           10        20        30
                   ....*....|....*....|....*....|....
gi 929653856   147 VCGSDGHTYSSVCKLEQQACLSSKQLAVRCEGPC 180
Cdd:smart00280  13 VCGSDGVTYSNECHLCKAACESGKSIEVKHDGPC 46
 
Name Accession Description Interval E-value
EFh_SPARC_TICN2 cd16238
EF-hand, extracellular calcium-binding (EC) motif, found in testican-2 (TICN2); TICN2, also ...
199-310 4.38e-78

EF-hand, extracellular calcium-binding (EC) motif, found in testican-2 (TICN2); TICN2, also termed SPARC/osteonectin, CWCV, and Kazal-like domains proteoglycan 2 (Spock2), is an extracellular heparan sulphate proteoglycan expressed in brain, lung, and testis. It inhibits neurite extension from cultured primary cerebellar neurons and may play regulatory roles in the development of the central nervous system. It also participates in diverse steps of neurogenesis. Moreover, TICN2 may contribute to ECM remodeling by regulating function(s) of other testican family members, which possess membrane-type matrix metalloproteinases (MT-MMPs) inhibitory function. Furthermore, TICN2 corresponding gene SPOCK2 acts as a susceptibility gene for bronchopulmonary dysplasia. TICN2 contains an N-terminal signal peptide, a testican-specific domain followed by a follistatin-like (FS) domain, an extracellular calcium-binding (EC) domain including a pair of EF hands, a thyroglobulin-like domain (TY), and a C-terminal region with two putative glycosaminoglycan attachment sites. The substitution of a ligating Asp residue by Tyr292 in the +Y position of EF-hand 2 in TICN2 could prevent Ca2+ binding to this site and also cause EF-hand 1 to bind one Ca2+ ion with low affinity.


Pssm-ID: 320017  Cd Length: 112  Bit Score: 237.14  E-value: 4.38e-78
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 929653856 199 CTGQDLADLGDRLRDWFQLLHENSKQNGSASSVAGPASGLDKSLGASCKDSIGWMFSKLDTSADLFLDQTELAAINLDKY 278
Cdd:cd16238    1 CTGQDLADLGDRLRDWFQLLHENSKQNGSGSPPASPASALDRSLVASCKDSIGWMFSKLDTSGDLFLDQAELAAINLDKY 80
                         90       100       110
                 ....*....|....*....|....*....|..
gi 929653856 279 EVCIRPFFNSCDTYKDGRVSTAEWCFCFWREK 310
Cdd:cd16238   81 EVCIRPFFNSCDTYRDGRVSTAEWCFCFWREK 112
SPARC_Ca_bdg pfam10591
Secreted protein acidic and rich in cysteine Ca binding region; The SPARC_Ca_bdg domain of ...
197-303 5.18e-37

Secreted protein acidic and rich in cysteine Ca binding region; The SPARC_Ca_bdg domain of Secreted Protein Acidic and Rich in Cysteine is responsible for the anti-spreading activity of human urothelial cells. It is rich in alpha-helices. This extracellular calcium-binding domain contains two EF-hands that each coordinates one Ca2+ ion, forming a helix-loop-helix structure that not only drives the conformation of the protein but is also necessary for biological activity. The anti-spreading activity was dependent on the coordination of Ca2+ by a Glu residue at the Z position of EF-hand 2.


Pssm-ID: 313749  Cd Length: 110  Bit Score: 130.51  E-value: 5.18e-37
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 929653856  197 ETCTGQDLADLGDRLRDWFQLLHENSKQNGSAS-SVAGPASGLDKSLGASCKDSIGWMFSKLDTSADLFLDQTELAAIN- 274
Cdd:pfam10591   1 PCCTDQELAEFPRRLRDWLKNLHESLKRRREQKdHYVELEKRKEQSPYPMCKEPLGWMFHRLDTNDDLLLDQEELAPIRa 80
                          90       100       110
                  ....*....|....*....|....*....|
gi 929653856  275 -LDKYEVCIRPFFNSCDTYKDGRVSTAEWC 303
Cdd:pfam10591  81 pLVPMEHCIKPFFESCDANKDGLISLEEWC 110
TY cd00191
Thyroglobulin type I repeats.; The N-terminal region of human thyroglobulin contains 11 type-1 ...
312-376 5.37e-22

Thyroglobulin type I repeats.; The N-terminal region of human thyroglobulin contains 11 type-1 repeats TY repeats are proposed to be inhibitors of cysteine proteases


Pssm-ID: 238114  Cd Length: 66  Bit Score: 88.67  E-value: 5.37e-22
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 929653856 312 PCLAELERIQIQEAAKKKPGIFIPSCDEDGYYRKMQCDQSSGDCWCVDQLGLELTGTRTH-GSPDC 376
Cdd:cd00191    1 PCERERASALESLAGPKLSGLYVPQCDEDGNYEPVQCHGSTGYCWCVDPDGEEIPGTRTRgGPPNC 66
Thyroglobulin_1 pfam00086
Thyroglobulin type-1 repeat; Thyroglobulin type 1 repeats are thought to be involved in the ...
313-376 2.38e-21

Thyroglobulin type-1 repeat; Thyroglobulin type 1 repeats are thought to be involved in the control of proteolytic degradation. The domain usually contains six conserved cysteines. These form three disulphide bridges. Cysteines 1 pairs with 2, 3 with 4 and 5 with 6.


Pssm-ID: 333828  Cd Length: 66  Bit Score: 86.97  E-value: 2.38e-21
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 929653856  313 CLAELERIQIQEAAKKKP-GIFIPSCDEDGYYRKMQCDQSSGDCWCVDQLGLELTGTRTH-GSPDC 376
Cdd:pfam00086   1 CQRERARALEQLAGGRPAsGLYIPQCDEDGFYKPVQCHGSTGYCWCVDPEGKEIPGTRTRgGDPNC 66
TY smart00211
Thyroglobulin type I repeats; The N-terminal region of human thyroglobulin contains 11 type-1 ...
334-378 5.59e-15

Thyroglobulin type I repeats; The N-terminal region of human thyroglobulin contains 11 type-1 repeats TY repeats are proposed to be inhibitors of cysteine proteases and binding partners of heparin.


Pssm-ID: 214561  Cd Length: 46  Bit Score: 68.56  E-value: 5.59e-15
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|....*.
gi 929653856   334 IPSCDEDGYYRKMQCDQSSGDCWCVDQLGLELTGTRTHG-SPDCDD 378
Cdd:smart00211   1 IPQCDEDGNYEPVQCDGSSGQCWCVDATGREIPGTRTEGgDPDCPS 46
KAZAL smart00280
Kazal type serine protease inhibitors; Kazal type serine protease inhibitors and ...
147-180 5.93e-09

Kazal type serine protease inhibitors; Kazal type serine protease inhibitors and follistatin-like domains.


Pssm-ID: 197624  Cd Length: 46  Bit Score: 51.53  E-value: 5.93e-09
                           10        20        30
                   ....*....|....*....|....*....|....
gi 929653856   147 VCGSDGHTYSSVCKLEQQACLSSKQLAVRCEGPC 180
Cdd:smart00280  13 VCGSDGVTYSNECHLCKAACESGKSIEVKHDGPC 46
Kazal_2 pfam07648
Kazal-type serine protease inhibitor domain; Usually indicative of serine protease inhibitors. ...
136-180 6.20e-09

Kazal-type serine protease inhibitor domain; Usually indicative of serine protease inhibitors. However, kazal-like domains are also seen in the extracellular part of agrins, which are not known to be protease inhibitors. Kazal domains often occur in tandem arrays. Small alpha+beta fold containing three disulphides.


Pssm-ID: 336754  Cd Length: 49  Bit Score: 51.32  E-value: 6.20e-09
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....*..
gi 929653856  136 CKPCHMAQLASVCGSDGHTYSSVCKLEQQACLSSKQLA--VRCEGPC 180
Cdd:pfam07648   3 CCQCPKTEYEPVCGSDGVTYPSPCALCAAGCKLGKEVGhkVKYDGSC 49
KAZAL_FS cd00104
Kazal type serine protease inhibitors and follistatin-like domains. Kazal inhibitors inhibit ...
147-180 2.88e-08

Kazal type serine protease inhibitors and follistatin-like domains. Kazal inhibitors inhibit serine proteases, such as, trypsin, chyomotrypsin, avian ovomucoids, and elastases. The inhibitory domain has one reactive site peptide bond, which serves the cognate enzyme as substrate. The reactive site peptide bond is a combining loop which has an identical conformation in all Kazal inhibitors and in all enzyme/inhibitor complexes. These Kazal domains (small hydrophobic core of alpha/beta structure with 3 to 4 disulfide bonds) often occur in tandem arrays. Similar domains are also present in follistatin (FS) and follistatin-like family members, which play an important role in tissue specific regulation. The FS domain consists of an N-terminal beta hairpin (FOLN/EGF-like domain) and a Kazal-like domain and has five disulfide bonds. Although the Kazal-like FS substructure is similar to Kazal proteinase inhibitors, no FS domain has yet been shown to be a proteinase inhibitor. Follistatin-like family members include SPARC, also known as, BM-40 or osteonectin, the Gallus gallus Flik protein, as well as, agrin which has a long array of FS domains. The kazal-type inhibitor domain has also been detected in an extracellular loop region of solute carrier 21 (SLC21) family members (organic anion transporters) , which may regulate the specificity of anion uptake. The distant homolog, Ascidian trypsin inhibitor, is included in this CD.


Pssm-ID: 238052  Cd Length: 41  Bit Score: 49.19  E-value: 2.88e-08
                         10        20        30
                 ....*....|....*....|....*....|....
gi 929653856 147 VCGSDGHTYSSVCKLEQQACLSSKQLAVRCEGPC 180
Cdd:cd00104    8 VCGSDGKTYSNECHLGCAACRSGRSITVAHNGPC 41
 
Name Accession Description Interval E-value
EFh_SPARC_TICN2 cd16238
EF-hand, extracellular calcium-binding (EC) motif, found in testican-2 (TICN2); TICN2, also ...
199-310 4.38e-78

EF-hand, extracellular calcium-binding (EC) motif, found in testican-2 (TICN2); TICN2, also termed SPARC/osteonectin, CWCV, and Kazal-like domains proteoglycan 2 (Spock2), is an extracellular heparan sulphate proteoglycan expressed in brain, lung, and testis. It inhibits neurite extension from cultured primary cerebellar neurons and may play regulatory roles in the development of the central nervous system. It also participates in diverse steps of neurogenesis. Moreover, TICN2 may contribute to ECM remodeling by regulating function(s) of other testican family members, which possess membrane-type matrix metalloproteinases (MT-MMPs) inhibitory function. Furthermore, TICN2 corresponding gene SPOCK2 acts as a susceptibility gene for bronchopulmonary dysplasia. TICN2 contains an N-terminal signal peptide, a testican-specific domain followed by a follistatin-like (FS) domain, an extracellular calcium-binding (EC) domain including a pair of EF hands, a thyroglobulin-like domain (TY), and a C-terminal region with two putative glycosaminoglycan attachment sites. The substitution of a ligating Asp residue by Tyr292 in the +Y position of EF-hand 2 in TICN2 could prevent Ca2+ binding to this site and also cause EF-hand 1 to bind one Ca2+ ion with low affinity.


Pssm-ID: 320017  Cd Length: 112  Bit Score: 237.14  E-value: 4.38e-78
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 929653856 199 CTGQDLADLGDRLRDWFQLLHENSKQNGSASSVAGPASGLDKSLGASCKDSIGWMFSKLDTSADLFLDQTELAAINLDKY 278
Cdd:cd16238    1 CTGQDLADLGDRLRDWFQLLHENSKQNGSGSPPASPASALDRSLVASCKDSIGWMFSKLDTSGDLFLDQAELAAINLDKY 80
                         90       100       110
                 ....*....|....*....|....*....|..
gi 929653856 279 EVCIRPFFNSCDTYKDGRVSTAEWCFCFWREK 310
Cdd:cd16238   81 EVCIRPFFNSCDTYRDGRVSTAEWCFCFWREK 112
EFh_SPARC_TICN cd16232
EF-hand, extracellular calcium-binding (EC) motif, found in testicans; Testicans are nervous ...
199-310 5.35e-50

EF-hand, extracellular calcium-binding (EC) motif, found in testicans; Testicans are nervous system-expressed proteoglycans that play important roles in the regulation of protease activity, as well as in the determination of age at menarche. Testican-1 (TICN1, also termed protein SPOCK) is a secreted chimeric proteoglycan that is highly expressed in brain and carries both chondroitin and heparan sulfate glycosaminoglycan side chains. It has been implicated in autoimmune disease. It also acts as a regulator of bone morphogenetic protein (BMP) signaling and show critical functions in the nervous system. Testican-2 (TICN2, also termed protein SPOCK2) is an extracellular heparan sulphate proteoglycan highly expressed in brain. It may play regulatory roles in the development of the central nervous system. It also participates in diverse steps of neurogenesis. TICN1, but not TICN2, inhibits cathepsin L. TICN1 also inhibits attachment and neurite outgrowth in cultures of N2A neuroblastoma cells, While TICN2 is able to inhibit neurite outgrowth from primary cerebellar cells. Testicans contain an N-terminal signal peptide, a testican-specific domain followed by a follistatin-like (FS) domain, an extracellular calcium-binding (EC) domain including a pair of EF hands, a thyroglobulin-like domain (TY), and a C-terminal region with two putative glycosaminoglycan attachment sites. The substitution of a ligating Asp residue by Tyr orTyr in the +Y position of EF hand 2 in testican-2 could prevent Ca2+ binding to this site and also cause EF-hand 1 to bind one Ca2+ with low affinity. The substitution of a ligating Asp residue by Phe or Tyr in the +Y position of EF-hand 2 in testicans could prevent Ca2+ binding to this site and also cause EF-hand 1 to bind one Ca2+ ion with low affinity.


Pssm-ID: 320011  Cd Length: 108  Bit Score: 164.47  E-value: 5.35e-50
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 929653856 199 CTGQDLADLGDRLRDWFQLLHENSKQNGSASSVAGPasglDKSLGASCKDSIGWMFSKLDTSADLFLDQTELAAINLDKY 278
Cdd:cd16232    1 CTESELSEMGDRLLDWFSVLHEQSNKAKKTSSSKRF----DKSHLPECKPSVGWMFNQLDTNNDLHLSQSELYDLELDKY 76
                         90       100       110
                 ....*....|....*....|....*....|..
gi 929653856 279 EVCIRPFFNSCDTYKDGRVSTAEWCFCFWREK 310
Cdd:cd16232   77 EPCIKPFLDSCDRNKDGKISSDEWCDCFQRAD 108
EFh_SPARC_TICN3 cd16239
EF-hand, extracellular calcium-binding (EC) motif, found in testican-3 (TICN3); TICN3, also ...
199-310 4.17e-39

EF-hand, extracellular calcium-binding (EC) motif, found in testican-3 (TICN3); TICN3, also termed SPARC/osteonectin, CWCV, and Kazal-like domains proteoglycan 3 (Spock3), is a brain-specific heparan sulfate proteoglycan that shows a widespread distribution within the extracellular matrix of the brain. It plays an important role in the formation or maintenance of major neuronal structures in the brain. It also functions as a novel regulator to reduce the activity of matrix metalloproteinase (MMP) in adult T-cell leukemia (ATL). It suppresses membrane-type 1 MMP-mediated MMP-2 activation and tumor invasion. Moreover, TICN3 corresponding gene SPOCK3 acts as a risk gene for adult attention-deficit/hyperactivity disorder (ADHD) and personality disorders. TICN3 contains an N-terminal signal peptide, a testican-specific domain followed by the follistatin-like (FS) and extracellular calcium-binding (EC) domains characteristic of the BM-40 family. Towards the C-terminus they contain a thyroglobulin-like domain (TY) and a novel sequence (domain V), which includes two potential glycosaminoglycan attachment sites. The substitution of a ligating Asp residue by Tyr295 in the +Y position of EF-hand 2 in testican-3 could prevent Ca2+ binding to this site and also cause EF-hand 1 to bind one Ca2+ ion with low affinity.


Pssm-ID: 320018  Cd Length: 113  Bit Score: 136.30  E-value: 4.17e-39
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 929653856 199 CTGQDLADLGDRLRDWFQLLHENSKQNGSASSVAGPA-SGLDKSLGASCKDSIGWMFSKLDTSADLFLDQTELAAINLDK 277
Cdd:cd16239    1 CSDLEFREVANRLRDWFKALHESGSQNKKTKIVRRPErSRFDTSILPICKDSLGWMFNRLDTNYDLLLDQSELGSIYLDK 80
                         90       100       110
                 ....*....|....*....|....*....|...
gi 929653856 278 YEVCIRPFFNSCDTYKDGRVSTAEWCFCFWREK 310
Cdd:cd16239   81 NEQCTKAFFNSCDTYKDSLISNNEWCYCFQRQQ 113
EFh_SPARC_TICN1 cd16237
EF-hand, extracellular calcium-binding (EC) motif, found in testican-1 (TICN1); TICN1, also ...
199-311 8.04e-39

EF-hand, extracellular calcium-binding (EC) motif, found in testican-1 (TICN1); TICN1, also termed protein SPOCK, or SPARC/osteonectin, CWCV, and Kazal-like domains proteoglycan 1 (Spock1), is a secreted chimeric proteoglycan that is highly expressed in brain and carries both chondroitin and heparan sulfate glycosaminoglycan side chains. It promotes resistance against Pseudomonas aeruginosa-induced keratitis through regulation of matrix metalloproteinase (MMP)-2 expression and activation. It also acts as a potential cancer prognostic marker that promotes the proliferation and metastasis of gallbladder cancer cells by activating the PI3K/Akt pathway. Moreover, TICN1 corresponding gene SPOCK1 is a novel transforming growth factor-beta target gene that regulates lung cancer cell epithelial-mesenchymal transition. It is also up-regulated by chromodomain helicase/adenosine triphosphatase DNA binding protein 1-like (CHD1L), and promotes human hepatocellular carcinoma (HCC) cell invasiveness and metastasis. Furthermore, TICN1 inhibits the lysosomal cysteine protease cathepsin L in intracellular vesicles and in the extracellular milieu. TICN1 contains an N-terminal signal sequence known to direct nascent polypeptides to the extracellular space, an unique region to the testicans, a follistatin (FS)-like domain generally involving five disulfide bridges, an extracellular calcium-binding (EC) domain including a pair of EF hands, and a thyroglobulin type-1 (TY) domain followed by a C-terminal acidic region with high density of negatively charged amino acids. The substitution of a ligating Asp residue by Phe291 in the +Y position of EF-hand 2 in TICN1 could prevent Ca2+ binding to this site and also cause EF-hand 1 to bind one Ca2+ ion with low affinity.


Pssm-ID: 320016  Cd Length: 112  Bit Score: 135.56  E-value: 8.04e-39
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 929653856 199 CTGQDLADLGDRLRDWFQLLHENSKQNGSASSVAGPASGLDKSLGASCKDSIGWMFSKLDTSADLFLDQTELAAINLDKY 278
Cdd:cd16237    1 CTDKELRNLASRLKDWFGALHEDANRVIKPTSSFTAQGRFDTSILPICKDSLGWMFNKLDMNYDLLLDPSEISAIYLDKY 80
                         90       100       110
                 ....*....|....*....|....*....|...
gi 929653856 279 EVCIRPFFNSCDTYKDGRVSTAEWCFCFwrEKP 311
Cdd:cd16237   81 EPCMKPLFNSCDSFKDGKLSNNEWCYCF--QKP 111
SPARC_Ca_bdg pfam10591
Secreted protein acidic and rich in cysteine Ca binding region; The SPARC_Ca_bdg domain of ...
197-303 5.18e-37

Secreted protein acidic and rich in cysteine Ca binding region; The SPARC_Ca_bdg domain of Secreted Protein Acidic and Rich in Cysteine is responsible for the anti-spreading activity of human urothelial cells. It is rich in alpha-helices. This extracellular calcium-binding domain contains two EF-hands that each coordinates one Ca2+ ion, forming a helix-loop-helix structure that not only drives the conformation of the protein but is also necessary for biological activity. The anti-spreading activity was dependent on the coordination of Ca2+ by a Glu residue at the Z position of EF-hand 2.


Pssm-ID: 313749  Cd Length: 110  Bit Score: 130.51  E-value: 5.18e-37
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 929653856  197 ETCTGQDLADLGDRLRDWFQLLHENSKQNGSAS-SVAGPASGLDKSLGASCKDSIGWMFSKLDTSADLFLDQTELAAIN- 274
Cdd:pfam10591   1 PCCTDQELAEFPRRLRDWLKNLHESLKRRREQKdHYVELEKRKEQSPYPMCKEPLGWMFHRLDTNDDLLLDQEELAPIRa 80
                          90       100       110
                  ....*....|....*....|....*....|
gi 929653856  275 -LDKYEVCIRPFFNSCDTYKDGRVSTAEWC 303
Cdd:pfam10591  81 pLVPMEHCIKPFFESCDANKDGLISLEEWC 110
EFh_SPARC_EC cd00252
EF-hand, extracellular calcium-binding (EC) motif, found in secreted protein acidic and rich ...
199-308 9.58e-37

EF-hand, extracellular calcium-binding (EC) motif, found in secreted protein acidic and rich in cysteine (SPARC)-like proteins; The SPARC protein family represents a diverse group of proteins that share a follistatin-like (FS) domain and an extracellular calcium-binding (EC) domain with two EF-hand motifs. It includes SPARC (for secreted protein acidic and rich in cysteine, also termed osteonectin/ON, or basement-membrane protein 40/BM-40), SPARC-like protein 1 (for secreted protein, acidic and rich in cysteines-like 1/ SPARCL1, also termed high endothelial venule protein/Hevi, or MAST 9, or SC-1, or RAGS-1, or QR1, or ECM 2), testicans 1, 2, and 3 (also termed SPARC/osteonectin, CWCV, and Kazal-like domains proteoglycans, or SPOCK), secreted modular calcium-binding protein SMOC-1 (also termed SPARC-related modular calcium-binding protein 1) and SMOC-2 (also termed SPARC-related modular calcium-binding protein 2, or smooth muscle-associated protein 2/SMAP-2), follistatin-related protein 1 (FRP-1, also termed follistatin-like protein 1/fstl-1, TSC-36/Flik, TGF-beta inducible protein). The SPARC proteins have been implicated in modulating cell interaction with the extracellular milieu, including regulation of extracellular matrix assembly and deposition, counter-adhesion, effects on extracellular protease activity, and modulation of growth factor/cytokine signaling pathways, as well as in development and disease.


Pssm-ID: 320009  Cd Length: 107  Bit Score: 129.80  E-value: 9.58e-37
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 929653856 199 CTGQDLADLGDRLRDWFQLLHENSKQNGSASSVAGPasgldKSLGASCKDSIGWMFSKLDTSADLFLDQTELAAINLD-- 276
Cdd:cd00252    1 CPGSELMQFPDRLLDWLLLLKEQDENRSYDNNKRGH-----DLSGTMRKEIAQWEFDNLDNNKDGKLDKRELAPFRAPlm 75
                         90       100       110
                 ....*....|....*....|....*....|..
gi 929653856 277 KYEVCIRPFFNSCDTYKDGRVSTAEWCFCFWR 308
Cdd:cd00252   76 PLEHCARGFFESCDLNKDKKISLQEWLGCFGV 107
TY cd00191
Thyroglobulin type I repeats.; The N-terminal region of human thyroglobulin contains 11 type-1 ...
312-376 5.37e-22

Thyroglobulin type I repeats.; The N-terminal region of human thyroglobulin contains 11 type-1 repeats TY repeats are proposed to be inhibitors of cysteine proteases


Pssm-ID: 238114  Cd Length: 66  Bit Score: 88.67  E-value: 5.37e-22
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 929653856 312 PCLAELERIQIQEAAKKKPGIFIPSCDEDGYYRKMQCDQSSGDCWCVDQLGLELTGTRTH-GSPDC 376
Cdd:cd00191    1 PCERERASALESLAGPKLSGLYVPQCDEDGNYEPVQCHGSTGYCWCVDPDGEEIPGTRTRgGPPNC 66
Thyroglobulin_1 pfam00086
Thyroglobulin type-1 repeat; Thyroglobulin type 1 repeats are thought to be involved in the ...
313-376 2.38e-21

Thyroglobulin type-1 repeat; Thyroglobulin type 1 repeats are thought to be involved in the control of proteolytic degradation. The domain usually contains six conserved cysteines. These form three disulphide bridges. Cysteines 1 pairs with 2, 3 with 4 and 5 with 6.


Pssm-ID: 333828  Cd Length: 66  Bit Score: 86.97  E-value: 2.38e-21
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 929653856  313 CLAELERIQIQEAAKKKP-GIFIPSCDEDGYYRKMQCDQSSGDCWCVDQLGLELTGTRTH-GSPDC 376
Cdd:pfam00086   1 CQRERARALEQLAGGRPAsGLYIPQCDEDGFYKPVQCHGSTGYCWCVDPEGKEIPGTRTRgGDPNC 66
TY smart00211
Thyroglobulin type I repeats; The N-terminal region of human thyroglobulin contains 11 type-1 ...
334-378 5.59e-15

Thyroglobulin type I repeats; The N-terminal region of human thyroglobulin contains 11 type-1 repeats TY repeats are proposed to be inhibitors of cysteine proteases and binding partners of heparin.


Pssm-ID: 214561  Cd Length: 46  Bit Score: 68.56  E-value: 5.59e-15
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|....*.
gi 929653856   334 IPSCDEDGYYRKMQCDQSSGDCWCVDQLGLELTGTRTHG-SPDCDD 378
Cdd:smart00211   1 IPQCDEDGNYEPVQCDGSSGQCWCVDATGREIPGTRTEGgDPDCPS 46
EFh_SPARC_like cd16231
EF-hand, extracellular calcium-binding (EC) motif, found in secreted protein acidic and rich ...
199-306 1.96e-11

EF-hand, extracellular calcium-binding (EC) motif, found in secreted protein acidic and rich in cysteine (SPARC) and similar proteins; This family includes secreted protein acidic and rich in cysteine (SPARC), secreted protein, acidic and rich in cysteine-like 1 (SPARCL1), and similar proteins. SPARC is a prototypic collagen-binding matricellular protein that is involved in extracellular matrix (ECM) assembly and fibrosis through binding both fibrillar collagen and basal lamina collagen IV. It regulates the activity of matrix metalloproteinases (MMPs), as well as the growth factor signaling mediated by cell surface receptors including vascular endothelial growth factor (VEGF) receptor, basic fibroblast growth factor (bFGF), and transforming growth factor (TGF) beta1. It also shows survival activity in tumor progression. SPARC contains an N-terminal acidic 52-residue segment followed by a follistatin-like (FS) domain, and an alpha-helical EC domain with 2 unusual calcium-binding EF-hands and the collagen-binding site. SPARCL1 is the closest family member to SPARC. It shares the three primary domains contained within SPARC with an expanded N-terminal domain. SPARCL1 may function as both a tumor suppressor and as a regulator of angiogenesis. It can bind to collagens and be counter-adhesive to wild-type dermal fibroblasts, but do not influence rates of cell proliferation. Moreover, SPARCL1 can influence central nervous system (CNS) development and synaptic rearrangement.


Pssm-ID: 320010  Cd Length: 116  Bit Score: 60.44  E-value: 1.96e-11
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 929653856 199 CTGQDLADLGDRLRDWF----QLLHENSKQNGsassvagpasGLDKSLGASCKDS-------IGWMFSKLDTS-ADLFLD 266
Cdd:cd16231    1 CLDEELSEFPLRMRDWLknvmVQLAERDELHE----------GLTEKELEDFQKNykmyvypVHWKFCDLDQHpHDRYLS 70
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|..
gi 929653856 267 QTELAAIN--LDKYEVCIRPFFNSCDTYKDGRVSTAEWCFCF 306
Cdd:cd16231   71 HHELAPLRapLVPMEHCTTPFLETCDADNDKLISLKEWGACL 112
KAZAL smart00280
Kazal type serine protease inhibitors; Kazal type serine protease inhibitors and ...
147-180 5.93e-09

Kazal type serine protease inhibitors; Kazal type serine protease inhibitors and follistatin-like domains.


Pssm-ID: 197624  Cd Length: 46  Bit Score: 51.53  E-value: 5.93e-09
                           10        20        30
                   ....*....|....*....|....*....|....
gi 929653856   147 VCGSDGHTYSSVCKLEQQACLSSKQLAVRCEGPC 180
Cdd:smart00280  13 VCGSDGVTYSNECHLCKAACESGKSIEVKHDGPC 46
Kazal_2 pfam07648
Kazal-type serine protease inhibitor domain; Usually indicative of serine protease inhibitors. ...
136-180 6.20e-09

Kazal-type serine protease inhibitor domain; Usually indicative of serine protease inhibitors. However, kazal-like domains are also seen in the extracellular part of agrins, which are not known to be protease inhibitors. Kazal domains often occur in tandem arrays. Small alpha+beta fold containing three disulphides.


Pssm-ID: 336754  Cd Length: 49  Bit Score: 51.32  E-value: 6.20e-09
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....*..
gi 929653856  136 CKPCHMAQLASVCGSDGHTYSSVCKLEQQACLSSKQLA--VRCEGPC 180
Cdd:pfam07648   3 CCQCPKTEYEPVCGSDGVTYPSPCALCAAGCKLGKEVGhkVKYDGSC 49
KAZAL_FS cd00104
Kazal type serine protease inhibitors and follistatin-like domains. Kazal inhibitors inhibit ...
147-180 2.88e-08

Kazal type serine protease inhibitors and follistatin-like domains. Kazal inhibitors inhibit serine proteases, such as, trypsin, chyomotrypsin, avian ovomucoids, and elastases. The inhibitory domain has one reactive site peptide bond, which serves the cognate enzyme as substrate. The reactive site peptide bond is a combining loop which has an identical conformation in all Kazal inhibitors and in all enzyme/inhibitor complexes. These Kazal domains (small hydrophobic core of alpha/beta structure with 3 to 4 disulfide bonds) often occur in tandem arrays. Similar domains are also present in follistatin (FS) and follistatin-like family members, which play an important role in tissue specific regulation. The FS domain consists of an N-terminal beta hairpin (FOLN/EGF-like domain) and a Kazal-like domain and has five disulfide bonds. Although the Kazal-like FS substructure is similar to Kazal proteinase inhibitors, no FS domain has yet been shown to be a proteinase inhibitor. Follistatin-like family members include SPARC, also known as, BM-40 or osteonectin, the Gallus gallus Flik protein, as well as, agrin which has a long array of FS domains. The kazal-type inhibitor domain has also been detected in an extracellular loop region of solute carrier 21 (SLC21) family members (organic anion transporters) , which may regulate the specificity of anion uptake. The distant homolog, Ascidian trypsin inhibitor, is included in this CD.


Pssm-ID: 238052  Cd Length: 41  Bit Score: 49.19  E-value: 2.88e-08
                         10        20        30
                 ....*....|....*....|....*....|....
gi 929653856 147 VCGSDGHTYSSVCKLEQQACLSSKQLAVRCEGPC 180
Cdd:cd00104    8 VCGSDGKTYSNECHLGCAACRSGRSITVAHNGPC 41
EFh_SPARC_SPARCL1 cd16236
EF-hand, extracellular calcium-binding (EC) motif, found in secreted protein, acidic and rich ...
250-306 3.24e-08

EF-hand, extracellular calcium-binding (EC) motif, found in secreted protein, acidic and rich in cysteine-like 1 (SPARCL1); SPARCL1, also termed SPARC-like protein 1, or high endothelial venule protein (Hevin), or MAST 9, or SC-1, or RAGS-1, or QR1, or ECM 2, is a diversely expressed and developmentally regulated extracellular matrix glycoprotein involved in tissue repair and remodeling via interaction with the surrounding extracellular matrix (ECM) proteins. It plays a pivotal role in the corneal wound healing. SPARCL1 may function as both a tumor suppressor and as a regulator of angiogenesis. It regulates cell migration/invasion and suppresses metastasis in many cancers, including prostate cancer, colorectal cancer, gastric cancer, and breast cancer. It can bind to collagens and be counter-adhesive to wild-type dermal fibroblasts, but do not influence rates of cell proliferation. Moreover, SPARCL1 contributes to neural development and participates in remodeling events associated with neuronal degeneration following neural injury. It can influence central nervous system (CNS) development and synaptic rearrangement. SPARCL1 is the closest family member to secreted protein acidic and rich in cysteine (SPARC), but does not compensate for the absence of SPARC in the CNS. SPARC contains an N-terminal acidic 52-residue segment followed by a follistatin-like (FS) domain, and an alpha-helical EC domain with 2 unusual calcium-binding EF-hands and the collagen-binding site. SPARCL1 shares the three primary domains contained within SPARC with an expanded N-terminal domain.


Pssm-ID: 320015  Cd Length: 93  Bit Score: 50.75  E-value: 3.24e-08
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|
gi 929653856 250 IGWMFSKLDT-SADLFLDQTELAAI--NLDKYEVCIRPFFNSCDTYKDGRVSTAEWCFCF 306
Cdd:cd16236   30 VHWQFAQLDQhPSDRFLTHSELAPLraSLVPMEHCITRFFQECDADKDKLITLKEWCHCF 89
EFh_SPARC_SPARC cd16235
EF-hand, extracellular calcium-binding (EC) motif, found in secreted protein acidic and rich ...
250-306 5.67e-05

EF-hand, extracellular calcium-binding (EC) motif, found in secreted protein acidic and rich in cysteine (SPARC); SPARC, also termed basement-membrane protein 40 (BM-40), or osteonectin (ON), is a prototypic collagen-binding matricellular protein that is essential for embryo development in invertebrates and highly expressed in bone. It participates in normal tissue remodeling as it regulates the deposition of extracellular matrix, as well as in neoplastic transformation. It is involved in extracellular matrix (ECM) assembly and fibrosis through binding both fibrillar collagen and basal lamina collagen IV. It regulates the activity of matrix metalloproteinases (MMPs), as well as the growth factor signaling mediated by cell surface receptors including vascular endothelial growth factor (VEGF) receptor, basic fibroblast growth factor (bFGF), and transforming growth factor (TGF) beta1. SPARC shows survival activity in tumor progression. It plays a role in metastatic process to the lung during melanoma progression. It can suppress prostate cancer cell growth and survival. Moreover, SPARC is a bone- associated protein that has a major role in bone development and mineralisationis. It is involved in the initiation and progression of vascular calcification and upregulated by adiponectin. Furthermore, SPARC may be one of the molecules that govern the uptake and delivery of proteins from blood to the cerebrospinal fluid (CSF) during brain development. SPARC contains an N-terminal acidic 52-residue segment followed by a follistatin-like (FS) domain, and an alpha-helical EC domain with 2 unusual calcium-binding EF-hands and the collagen-binding site. Platelet-derived growth factor (PDGF) also interacts with its EC domain, but in a calcium-independent manner, whereas collagen binding is calcium-dependent.


Pssm-ID: 320014  Cd Length: 96  Bit Score: 41.53  E-value: 5.67e-05
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|
gi 929653856 250 IGWMFSKLDTSA-DLFLDQTELAAIN--LDKYEVCIRPFFNSCDTYKDGRVSTAEWCFCF 306
Cdd:cd16235   33 VHWQFGQLDQHPiDGYLSHTELAPLRapLIPMEHCTTRFFETCDLDNDKYIALDEWAGCF 92
EFh_SPARC_SMOC cd16234
EF-hand, extracellular calcium-binding (EC) motif, found in secreted modular calcium-binding ...
252-306 1.82e-04

EF-hand, extracellular calcium-binding (EC) motif, found in secreted modular calcium-binding protein SMOC-1, SMOC-2, and similar proteins; SMOC proteins corresponds to a group matricellular proteins that are involved in direct or indirect modulation of growth factor signaling pathways and play diverse roles in physiological processes involving extensive tissue remodeling, migration, proliferation, and angiogenesis. They may mediate intercellular signaling and cell type-specific differentiation during gonad and reproductive tract development. SMOC-1 is localized in basement membranes. Its mutations have been found to be associated with individuals with Warrdenburg Anopthalmia Syndrome. SMOC-2 is ubiquitously expressed and is involved in angiogenesis and the regulation of cell cycle progression. It enhances the angiogenic effect of basic fibroblast growth factor (bFGF) and vascular endothelial growth factor (VEGF). It has also been implicated in generalized vitiligo. SMOC proteins consist of a follistatin-like (FS) domain, two thyroglobulin-like (TY) domains, a novel domain conserved only in SMOC proteins, and an extracellular calcium-binding (EC) domain with two EF-hand calcium-binding motifs.


Pssm-ID: 320013  Cd Length: 104  Bit Score: 40.34  E-value: 1.82e-04
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 929653856 252 WMFSKLDTSADLFLDQTEL--------AAINLDKyevCIRPFFNSCDTYKDGRVSTAEWCFCF 306
Cdd:cd16234   43 WKFSQLDKNKNGVLERKEWkpfkrllkKAVKPKK---CARKFPKYCDVNKDKKISLTEWLNCL 102
EFh cd00051
EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal ...
252-303 7.57e-03

EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands. Ca2+ binding induces a conformational change in the EF-hand motif, leading to the activation or inactivation of target proteins. EF-hands tend to occur in pairs or higher copy numbers.


Pssm-ID: 238008 [Multi-domain]  Cd Length: 63  Bit Score: 34.45  E-value: 7.57e-03
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....*...
gi 929653856 252 WMFSKLDTSADLFLDQTELAAI------NLDKYEvcIRPFFNSCDTYKDGRVSTAEWC 303
Cdd:cd00051    4 EAFRLFDKDGDGTISADELKAAlkslgeGLSEEE--IDEMIREVDKDGDGKIDFEEFL 59
MFS_SLCO3_OATP3 cd17402
Solute carrier organic anion transporter 3 family of the Major Facilitator Superfamily of ...
139-188 8.77e-03

Solute carrier organic anion transporter 3 family of the Major Facilitator Superfamily of transporters; The Solute carrier organic anion transporter 3 (SLCO3) or Organic anion transporting polypeptide 3 (OATP3) family contains only one subfamily, OATP3A, which contains only one mammalian member OATP3A1 (encoded by SLCO3A1). It mediates the Na(+)-independent transport of organic anions such as estrone-3-sulfate, prostaglandins (PG) E1 and E2, thyroxine (T4), deltorphin II, BQ-123, and vasopressin. SLCO3A1 has been identified as a Crohn's disease (CD)-associated gene, which mediates inflammatory processes in intestinal epithelial cells through NF-kappaB transcription activation, resulting in a higher incidence of bowel perforation in CD patients. The SLCO3/OATP3 family belongs to the Solute carrier organic anion transporter [SLCO, also called organic anion transporting polypeptides (OATPs) or Solute carrier family 21] family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340960 [Multi-domain]  Cd Length: 444  Bit Score: 37.99  E-value: 8.77e-03
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....*....
gi 929653856 139 CHMAQLASVCGSDGHTYSSVC-------KLEQQACLSS--KQLAVRCEGPCPCPTEQAA 188
Cdd:cd17402  358 CQTDSFSPVCGADGITYLSACfagcsstNLSGCACLSSvpAENATVVPGKCPSPGCQEA 416
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.17
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH