NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|134254446|ref|NP_000255|]
View 

protein patched homolog 1 isoform L [Homo sapiens]

Protein Classification

2A060602 family protein (domain architecture ID 12852140)

2A060602 family protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
2A060602 TIGR00918
The Eukaryotic (Putative) Sterol Transporter (EST) Family;
43-1206 0e+00

The Eukaryotic (Putative) Sterol Transporter (EST) Family;


:

Pssm-ID: 273338  Cd Length: 1145  Bit Score: 2116.48  E-value: 0e+00
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254446    43 AAPDRDYLHRPSYCDAAFALEQISKGKATGRKAPLWLRAKFQRLLFKLGCYIQKNCGKFLVVGLLIFGAFAVGLKAANLE 122
Cdd:TIGR00918    3 AAPDSEYLQRPSYCDAAFALEQIDKGKATGRRAPLWLRAKFQRLLFTLGCYIQKHCGKVLFVGLLVFSAFAVGLRAANIE 82
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254446   123 TNVEELWVEVGGRVSRELNYTRQKIGEEAMFNPQLMIQTPKEEGANVLTTEALLQHLDSALQASRVHVYMYNRQWKLEHL 202
Cdd:TIGR00918   83 TNVEQLWVEVGGRVSQELAYTRQKIGEEAMFTPQLLIQTPHQEGANVLTPEALLQHLDSALKASRVHVYLYNRQWGLEHL 162
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254446   203 CYKSGELITETGYMDQIIEYLYPCLIITPLDCFWEGAKLQSGTAYLLGKPPLRWTNFDPLEFLEELKKINYQVDSWEEML 282
Cdd:TIGR00918  163 CYKSGEPSTEGGYIEQILEKLIPCLIITPLDCFWEGAKLQGGTAYLPGKPPLQWTNLDPASFLEELKQKMSQVESWEEML 242
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254446   283 NKAEVGHGYMDRPCLNPADPDCPATAPNKNSTKPLDMALVLNGGCHGLSRKYMHWQEELIVGGTVKNSTGKLVSAHALQT 362
Cdd:TIGR00918  243 KKAAVGQGYMERPCLNPADPDCPDTAPNKNSTQPPDVAAVLSGGCYGLSAKYMHWQEELIVGGTKRNRSGKLLSAQALQS 322
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254446   363 MFQLMTPKQMYEHFKGYEYVSHINWNEDKAAAILEAWQRTYVEVVHQSVAQNSTQKVLSFTTTTLDDILKSFSDVSVIRV 442
Cdd:TIGR00918  323 MFQLMTPKQMYEHFKGYYKVHHIGWNEEKAAAVLEAWQRNFSEEVQQSLPKNSSQKILVFSSTTLDDILKKFSDVSAIRI 402
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254446   443 ASGYLLMLAYACLTMLRWDCSKSQGAVGLAGVLLVALSVAAGLGLCSLIGISFNAATTQVLPFLALGVGVDDVFLLAHAF 522
Cdd:TIGR00918  403 VSGYLLMLAYACLTMLRWDCAKSQGSVGLAGVLLVALSVAAGLGLCALLGISFNAATTQVLPFLALGVGVDDVFLLAHAF 482
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254446   523 SETGQNkrIPFEDRTGECLKRTGASVALTSISNVTAFFMAALIPIPALRAFSLQAAVVVVFNFAMVLLIFPAILSMDLYR 602
Cdd:TIGR00918  483 SETGQN--IPFEERTGECLKRTGASVVLTSISNVTAFFMAALIPIPALRAFSLQAAIVVVFNFAAVLLVFPAILSLDLRR 560
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254446   603 REDRRLDIFCCFTSPCVSRVIQVEPQAYTDThdntryspppPYSSHSFAHetqitMQSTVQLRTEYDPHTHVYYTTAEPR 682
Cdd:TIGR00918  561 REDRRLDIFCCFFSPCSARVIQIEPQAYADG----------SAPPVYSSH-----MQSTVQLRTEYDPGTQHYYTTNEPR 625
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254446   683 SEISVQPvtvtQDTLSCQSPESTSSTRDLLSQFSDSSLHCLEPPCTKWTLSSFAEKHYAPFLLKPKAKVVVIFLFLGLLG 762
Cdd:TIGR00918  626 SHLSVQP----SDPLSCQSPDIAGSTRDLLSQFEDSKAACLSLPCARWTLATFAEKHYAPFLLQSWAKVVVIFLFLALLG 701
                          730       740       750       760       770       780       790       800
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254446   763 VSLYGTTRVRDGLDLTDIVPRETREYDFIAAQFKYFSFYNMYIVTQK-ADYPNIQHLLYDLHRSFSNVKYVMLEENKQLP 841
Cdd:TIGR00918  702 LSLYGTTRVQDGLDLTDIVPRDTNEHDFLDAQFRYFSFYNMYAVTQGnFDYPTQQQLLYDLHQSFSSVKYVLKEDNGQLP 781
                          810       820       830       840       850       860       870       880
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254446   842 KMWLHYFRDWLQGLQDAFDSDWETGKIMPNNYKNGSDDGVLAYKLLVQTGSRDKPIDISQLTKQRLVDADGIINPSAFYI 921
Cdd:TIGR00918  782 RMWLHYFRDWLQGLQKAFDEDWRDGRITKENYRNGSDDAVLAYKLLVQTGHRDKPVDKEQLTTQRLVNADGIINPNAFYI 861
                          890       900       910       920       930       940       950       960
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254446   922 YLTAWVSNDPVAYAASQANIRPHRPEWVHDKADYMPETrLRIPAAEPIEYAQFPFYLNGLRDTSDFVEAIEKVRTICSNY 1001
Cdd:TIGR00918  862 YLSAWVSNDPVAYAASQANIYPHPPEWLHDKNDYDPEN-LRIPAAEPLEYAQFPFYLNGLRETSQFVEAIEHVRAICNNY 940
                          970       980       990      1000      1010      1020      1030      1040
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254446  1002 TSLGLSSYPNGYPFLFWEQYIGLRHWLLLFISVVLACTFLVCAVFLLNPWTAGIIVMVLALMTVELFGMMGLIGIKLSAV 1081
Cdd:TIGR00918  941 EGFGLPSYPSGYPFLFWEQYMGLRHWLLLSISVVLACTFLVCALLLLNPWTAGLIVLVLALMTVELFGMMGLLGIKLSAI 1020
                         1050      1060      1070      1080      1090      1100      1110      1120
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254446  1082 PVVILIASVGIGVEFTVHVALAFLTAIGDKNRRAVLALEHMFAPVLDGAVSTLLGVLMLAGSEFDFIVRYFFAVLAILTI 1161
Cdd:TIGR00918 1021 PVVILIASVGIGVEFTVHIALGFLTAIGDRNRRAVLALEHMFAPVLDGALSTLLGVLMLAGSEFDFIVRYFFAVLAVLTC 1100
                         1130      1140      1150      1160
                   ....*....|....*....|....*....|....*....|....*
gi 134254446  1162 LGVLNGLVLLPVLLSFFGPYPEVSPANGLNRLPTPSPEPPPSVVR 1206
Cdd:TIGR00918 1101 LGVLNGLVLLPVLLSMFGPEPEVSPAEGRSRLPTPSPEPPPGGVR 1145
PHA03377 super family cl31823
EBNA-3C; Provisional
1253-1369 5.00e-04

EBNA-3C; Provisional


The actual alignment was detected with superfamily member PHA03377:

Pssm-ID: 177614 [Multi-domain]  Cd Length: 1000  Bit Score: 44.66  E-value: 5.00e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254446 1253 QVIVEATENPVFAHSTVVHPES-RHHPPSNPRQ-QPHLDSGSLPPGRQGQQPRRDP-----PREGLW--PPPYRPRRDAF 1323
Cdd:PHA03377  699 QPSEESHLSSMSPTQPISHEEQpRYEDPDDPLDlSLHPDQAPPPSHQAPYSGHEEPqaqqaPYPGYWepRPPQAPYLGYQ 778
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*.
gi 134254446 1324 EISTEGHSGPSNRARWGPRGARSHNPRNPASTAMGSSVPGYCQPIT 1369
Cdd:PHA03377  779 EPQAQGVQVSSYPGYAGPWGLRAQHPRYRHSWAYWSQYPGHGHPQG 824
 
Name Accession Description Interval E-value
2A060602 TIGR00918
The Eukaryotic (Putative) Sterol Transporter (EST) Family;
43-1206 0e+00

The Eukaryotic (Putative) Sterol Transporter (EST) Family;


Pssm-ID: 273338  Cd Length: 1145  Bit Score: 2116.48  E-value: 0e+00
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254446    43 AAPDRDYLHRPSYCDAAFALEQISKGKATGRKAPLWLRAKFQRLLFKLGCYIQKNCGKFLVVGLLIFGAFAVGLKAANLE 122
Cdd:TIGR00918    3 AAPDSEYLQRPSYCDAAFALEQIDKGKATGRRAPLWLRAKFQRLLFTLGCYIQKHCGKVLFVGLLVFSAFAVGLRAANIE 82
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254446   123 TNVEELWVEVGGRVSRELNYTRQKIGEEAMFNPQLMIQTPKEEGANVLTTEALLQHLDSALQASRVHVYMYNRQWKLEHL 202
Cdd:TIGR00918   83 TNVEQLWVEVGGRVSQELAYTRQKIGEEAMFTPQLLIQTPHQEGANVLTPEALLQHLDSALKASRVHVYLYNRQWGLEHL 162
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254446   203 CYKSGELITETGYMDQIIEYLYPCLIITPLDCFWEGAKLQSGTAYLLGKPPLRWTNFDPLEFLEELKKINYQVDSWEEML 282
Cdd:TIGR00918  163 CYKSGEPSTEGGYIEQILEKLIPCLIITPLDCFWEGAKLQGGTAYLPGKPPLQWTNLDPASFLEELKQKMSQVESWEEML 242
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254446   283 NKAEVGHGYMDRPCLNPADPDCPATAPNKNSTKPLDMALVLNGGCHGLSRKYMHWQEELIVGGTVKNSTGKLVSAHALQT 362
Cdd:TIGR00918  243 KKAAVGQGYMERPCLNPADPDCPDTAPNKNSTQPPDVAAVLSGGCYGLSAKYMHWQEELIVGGTKRNRSGKLLSAQALQS 322
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254446   363 MFQLMTPKQMYEHFKGYEYVSHINWNEDKAAAILEAWQRTYVEVVHQSVAQNSTQKVLSFTTTTLDDILKSFSDVSVIRV 442
Cdd:TIGR00918  323 MFQLMTPKQMYEHFKGYYKVHHIGWNEEKAAAVLEAWQRNFSEEVQQSLPKNSSQKILVFSSTTLDDILKKFSDVSAIRI 402
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254446   443 ASGYLLMLAYACLTMLRWDCSKSQGAVGLAGVLLVALSVAAGLGLCSLIGISFNAATTQVLPFLALGVGVDDVFLLAHAF 522
Cdd:TIGR00918  403 VSGYLLMLAYACLTMLRWDCAKSQGSVGLAGVLLVALSVAAGLGLCALLGISFNAATTQVLPFLALGVGVDDVFLLAHAF 482
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254446   523 SETGQNkrIPFEDRTGECLKRTGASVALTSISNVTAFFMAALIPIPALRAFSLQAAVVVVFNFAMVLLIFPAILSMDLYR 602
Cdd:TIGR00918  483 SETGQN--IPFEERTGECLKRTGASVVLTSISNVTAFFMAALIPIPALRAFSLQAAIVVVFNFAAVLLVFPAILSLDLRR 560
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254446   603 REDRRLDIFCCFTSPCVSRVIQVEPQAYTDThdntryspppPYSSHSFAHetqitMQSTVQLRTEYDPHTHVYYTTAEPR 682
Cdd:TIGR00918  561 REDRRLDIFCCFFSPCSARVIQIEPQAYADG----------SAPPVYSSH-----MQSTVQLRTEYDPGTQHYYTTNEPR 625
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254446   683 SEISVQPvtvtQDTLSCQSPESTSSTRDLLSQFSDSSLHCLEPPCTKWTLSSFAEKHYAPFLLKPKAKVVVIFLFLGLLG 762
Cdd:TIGR00918  626 SHLSVQP----SDPLSCQSPDIAGSTRDLLSQFEDSKAACLSLPCARWTLATFAEKHYAPFLLQSWAKVVVIFLFLALLG 701
                          730       740       750       760       770       780       790       800
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254446   763 VSLYGTTRVRDGLDLTDIVPRETREYDFIAAQFKYFSFYNMYIVTQK-ADYPNIQHLLYDLHRSFSNVKYVMLEENKQLP 841
Cdd:TIGR00918  702 LSLYGTTRVQDGLDLTDIVPRDTNEHDFLDAQFRYFSFYNMYAVTQGnFDYPTQQQLLYDLHQSFSSVKYVLKEDNGQLP 781
                          810       820       830       840       850       860       870       880
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254446   842 KMWLHYFRDWLQGLQDAFDSDWETGKIMPNNYKNGSDDGVLAYKLLVQTGSRDKPIDISQLTKQRLVDADGIINPSAFYI 921
Cdd:TIGR00918  782 RMWLHYFRDWLQGLQKAFDEDWRDGRITKENYRNGSDDAVLAYKLLVQTGHRDKPVDKEQLTTQRLVNADGIINPNAFYI 861
                          890       900       910       920       930       940       950       960
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254446   922 YLTAWVSNDPVAYAASQANIRPHRPEWVHDKADYMPETrLRIPAAEPIEYAQFPFYLNGLRDTSDFVEAIEKVRTICSNY 1001
Cdd:TIGR00918  862 YLSAWVSNDPVAYAASQANIYPHPPEWLHDKNDYDPEN-LRIPAAEPLEYAQFPFYLNGLRETSQFVEAIEHVRAICNNY 940
                          970       980       990      1000      1010      1020      1030      1040
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254446  1002 TSLGLSSYPNGYPFLFWEQYIGLRHWLLLFISVVLACTFLVCAVFLLNPWTAGIIVMVLALMTVELFGMMGLIGIKLSAV 1081
Cdd:TIGR00918  941 EGFGLPSYPSGYPFLFWEQYMGLRHWLLLSISVVLACTFLVCALLLLNPWTAGLIVLVLALMTVELFGMMGLLGIKLSAI 1020
                         1050      1060      1070      1080      1090      1100      1110      1120
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254446  1082 PVVILIASVGIGVEFTVHVALAFLTAIGDKNRRAVLALEHMFAPVLDGAVSTLLGVLMLAGSEFDFIVRYFFAVLAILTI 1161
Cdd:TIGR00918 1021 PVVILIASVGIGVEFTVHIALGFLTAIGDRNRRAVLALEHMFAPVLDGALSTLLGVLMLAGSEFDFIVRYFFAVLAVLTC 1100
                         1130      1140      1150      1160
                   ....*....|....*....|....*....|....*....|....*
gi 134254446  1162 LGVLNGLVLLPVLLSFFGPYPEVSPANGLNRLPTPSPEPPPSVVR 1206
Cdd:TIGR00918 1101 LGVLNGLVLLPVLLSMFGPEPEVSPAEGRSRLPTPSPEPPPGGVR 1145
Sterol-sensing pfam12349
Sterol-sensing domain of SREBP cleavage-activation; Sterol regulatory element-binding proteins ...
462-616 1.07e-50

Sterol-sensing domain of SREBP cleavage-activation; Sterol regulatory element-binding proteins (SREBPs) are membrane-bound transcription factors that promote lipid synthesis in animal cells. They are embedded in the membranes of the endoplasmic reticulum (ER) in a helical hairpin orientation and are released from the ER by a two-step proteolytic process. Proteolysis begins when the SREBPs are cleaved at Site-1, which is located at a leucine residue in the middle of the hydrophobic loop in the lumen of the ER. Upon proteolytic processing SREBP can activate the expression of genes involved in cholesterol biosynthesis and uptake. SCAP stimulates cleavage of SREBPs via fusion of the their two C-termini. This domain is the transmembrane region that traverses the membrane eight times and is the sterol-sensing domain of the cleavage protein. WD40 domains are found towards the C-terminus.


Pssm-ID: 403533 [Multi-domain]  Cd Length: 153  Bit Score: 175.86  E-value: 1.07e-50
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254446   462 CSKSQGAVGLAGVLLVALSVAAGLGLCSLIGISFNAATTQVLPFLALGVGVDDVFLLAHAFSETgqNKRIPFEDRTGECL 541
Cdd:pfam12349    1 MVKSKFGLGLAGVIIVLASVASSLGLCAYFGLTLTLIISEVIPFLVLAIGVDNIFILVKAVQRT--PRSLDVSERIAEAL 78
                           90       100       110       120       130       140       150
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 134254446   542 KRTGASVALTSISNVTAFFMAALIPIPALRAFSLQAAVVVVFNFAMVLLIFPAILSMDLYRREDRRLDIFCCFTS 616
Cdd:pfam12349   79 GQVGPSILLTSLTEILAFLIGALTDMPAVQEFCLFAAVALLFDFLLQMTFFVAVLSLDIRRLESNRLDVLCCVRS 153
COG1033 COG1033
Predicted exporter protein, RND superfamily [General function prediction only];
469-606 3.92e-09

Predicted exporter protein, RND superfamily [General function prediction only];


Pssm-ID: 223964 [Multi-domain]  Cd Length: 727  Bit Score: 61.17  E-value: 3.92e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254446  469 VGLAGVLLVALSVAAGLGLCSLIGISFNAATtQVLPFLALGVGVDDVFLLAHAFSETGQNKriPFEDRTGECLKRTGASV 548
Cdd:COG1033   594 KAIIPLIPIAIVVGWNFGLMGLLGIPLTPAT-ATLGAIILGIGVDYSIHITERYREERKKG--GPKEAIETTVERTGKAI 670
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254446  549 ALTSISnvTAFFMAALI--PIPALRAFSLQAAVVVVFNFAMVLLIFPAILSMdLYRREDR 606
Cdd:COG1033   671 LASALT--TAIGFLALIfsPFPIISNFGLLTVIGILLSLLASLVLLPALLVL-LDGRRKR 727
PHA03377 PHA03377
EBNA-3C; Provisional
1253-1369 5.00e-04

EBNA-3C; Provisional


Pssm-ID: 177614 [Multi-domain]  Cd Length: 1000  Bit Score: 44.66  E-value: 5.00e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254446 1253 QVIVEATENPVFAHSTVVHPES-RHHPPSNPRQ-QPHLDSGSLPPGRQGQQPRRDP-----PREGLW--PPPYRPRRDAF 1323
Cdd:PHA03377  699 QPSEESHLSSMSPTQPISHEEQpRYEDPDDPLDlSLHPDQAPPPSHQAPYSGHEEPqaqqaPYPGYWepRPPQAPYLGYQ 778
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*.
gi 134254446 1324 EISTEGHSGPSNRARWGPRGARSHNPRNPASTAMGSSVPGYCQPIT 1369
Cdd:PHA03377  779 EPQAQGVQVSSYPGYAGPWGLRAQHPRYRHSWAYWSQYPGHGHPQG 824
 
Name Accession Description Interval E-value
2A060602 TIGR00918
The Eukaryotic (Putative) Sterol Transporter (EST) Family;
43-1206 0e+00

The Eukaryotic (Putative) Sterol Transporter (EST) Family;


Pssm-ID: 273338  Cd Length: 1145  Bit Score: 2116.48  E-value: 0e+00
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254446    43 AAPDRDYLHRPSYCDAAFALEQISKGKATGRKAPLWLRAKFQRLLFKLGCYIQKNCGKFLVVGLLIFGAFAVGLKAANLE 122
Cdd:TIGR00918    3 AAPDSEYLQRPSYCDAAFALEQIDKGKATGRRAPLWLRAKFQRLLFTLGCYIQKHCGKVLFVGLLVFSAFAVGLRAANIE 82
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254446   123 TNVEELWVEVGGRVSRELNYTRQKIGEEAMFNPQLMIQTPKEEGANVLTTEALLQHLDSALQASRVHVYMYNRQWKLEHL 202
Cdd:TIGR00918   83 TNVEQLWVEVGGRVSQELAYTRQKIGEEAMFTPQLLIQTPHQEGANVLTPEALLQHLDSALKASRVHVYLYNRQWGLEHL 162
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254446   203 CYKSGELITETGYMDQIIEYLYPCLIITPLDCFWEGAKLQSGTAYLLGKPPLRWTNFDPLEFLEELKKINYQVDSWEEML 282
Cdd:TIGR00918  163 CYKSGEPSTEGGYIEQILEKLIPCLIITPLDCFWEGAKLQGGTAYLPGKPPLQWTNLDPASFLEELKQKMSQVESWEEML 242
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254446   283 NKAEVGHGYMDRPCLNPADPDCPATAPNKNSTKPLDMALVLNGGCHGLSRKYMHWQEELIVGGTVKNSTGKLVSAHALQT 362
Cdd:TIGR00918  243 KKAAVGQGYMERPCLNPADPDCPDTAPNKNSTQPPDVAAVLSGGCYGLSAKYMHWQEELIVGGTKRNRSGKLLSAQALQS 322
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254446   363 MFQLMTPKQMYEHFKGYEYVSHINWNEDKAAAILEAWQRTYVEVVHQSVAQNSTQKVLSFTTTTLDDILKSFSDVSVIRV 442
Cdd:TIGR00918  323 MFQLMTPKQMYEHFKGYYKVHHIGWNEEKAAAVLEAWQRNFSEEVQQSLPKNSSQKILVFSSTTLDDILKKFSDVSAIRI 402
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254446   443 ASGYLLMLAYACLTMLRWDCSKSQGAVGLAGVLLVALSVAAGLGLCSLIGISFNAATTQVLPFLALGVGVDDVFLLAHAF 522
Cdd:TIGR00918  403 VSGYLLMLAYACLTMLRWDCAKSQGSVGLAGVLLVALSVAAGLGLCALLGISFNAATTQVLPFLALGVGVDDVFLLAHAF 482
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254446   523 SETGQNkrIPFEDRTGECLKRTGASVALTSISNVTAFFMAALIPIPALRAFSLQAAVVVVFNFAMVLLIFPAILSMDLYR 602
Cdd:TIGR00918  483 SETGQN--IPFEERTGECLKRTGASVVLTSISNVTAFFMAALIPIPALRAFSLQAAIVVVFNFAAVLLVFPAILSLDLRR 560
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254446   603 REDRRLDIFCCFTSPCVSRVIQVEPQAYTDThdntryspppPYSSHSFAHetqitMQSTVQLRTEYDPHTHVYYTTAEPR 682
Cdd:TIGR00918  561 REDRRLDIFCCFFSPCSARVIQIEPQAYADG----------SAPPVYSSH-----MQSTVQLRTEYDPGTQHYYTTNEPR 625
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254446   683 SEISVQPvtvtQDTLSCQSPESTSSTRDLLSQFSDSSLHCLEPPCTKWTLSSFAEKHYAPFLLKPKAKVVVIFLFLGLLG 762
Cdd:TIGR00918  626 SHLSVQP----SDPLSCQSPDIAGSTRDLLSQFEDSKAACLSLPCARWTLATFAEKHYAPFLLQSWAKVVVIFLFLALLG 701
                          730       740       750       760       770       780       790       800
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254446   763 VSLYGTTRVRDGLDLTDIVPRETREYDFIAAQFKYFSFYNMYIVTQK-ADYPNIQHLLYDLHRSFSNVKYVMLEENKQLP 841
Cdd:TIGR00918  702 LSLYGTTRVQDGLDLTDIVPRDTNEHDFLDAQFRYFSFYNMYAVTQGnFDYPTQQQLLYDLHQSFSSVKYVLKEDNGQLP 781
                          810       820       830       840       850       860       870       880
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254446   842 KMWLHYFRDWLQGLQDAFDSDWETGKIMPNNYKNGSDDGVLAYKLLVQTGSRDKPIDISQLTKQRLVDADGIINPSAFYI 921
Cdd:TIGR00918  782 RMWLHYFRDWLQGLQKAFDEDWRDGRITKENYRNGSDDAVLAYKLLVQTGHRDKPVDKEQLTTQRLVNADGIINPNAFYI 861
                          890       900       910       920       930       940       950       960
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254446   922 YLTAWVSNDPVAYAASQANIRPHRPEWVHDKADYMPETrLRIPAAEPIEYAQFPFYLNGLRDTSDFVEAIEKVRTICSNY 1001
Cdd:TIGR00918  862 YLSAWVSNDPVAYAASQANIYPHPPEWLHDKNDYDPEN-LRIPAAEPLEYAQFPFYLNGLRETSQFVEAIEHVRAICNNY 940
                          970       980       990      1000      1010      1020      1030      1040
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254446  1002 TSLGLSSYPNGYPFLFWEQYIGLRHWLLLFISVVLACTFLVCAVFLLNPWTAGIIVMVLALMTVELFGMMGLIGIKLSAV 1081
Cdd:TIGR00918  941 EGFGLPSYPSGYPFLFWEQYMGLRHWLLLSISVVLACTFLVCALLLLNPWTAGLIVLVLALMTVELFGMMGLLGIKLSAI 1020
                         1050      1060      1070      1080      1090      1100      1110      1120
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254446  1082 PVVILIASVGIGVEFTVHVALAFLTAIGDKNRRAVLALEHMFAPVLDGAVSTLLGVLMLAGSEFDFIVRYFFAVLAILTI 1161
Cdd:TIGR00918 1021 PVVILIASVGIGVEFTVHIALGFLTAIGDRNRRAVLALEHMFAPVLDGALSTLLGVLMLAGSEFDFIVRYFFAVLAVLTC 1100
                         1130      1140      1150      1160
                   ....*....|....*....|....*....|....*....|....*
gi 134254446  1162 LGVLNGLVLLPVLLSFFGPYPEVSPANGLNRLPTPSPEPPPSVVR 1206
Cdd:TIGR00918 1101 LGVLNGLVLLPVLLSMFGPEPEVSPAEGRSRLPTPSPEPPPGGVR 1145
2A060601 TIGR00917
Niemann-Pick C type protein family; The model describes Niemann-Pick C type protein in ...
398-1179 1.82e-66

Niemann-Pick C type protein family; The model describes Niemann-Pick C type protein in eukaryotes. The defective protein has been associated with Niemann-Pick disease which is described in humans as autosomal recessive lipidosis. It is characterized by the lysosomal accumulation of unestrified cholesterol. It is an integral membrane protein, which indicates that this protein is most likely involved in cholesterol transport or acts as some component of cholesterol homeostasis. [Transport and binding proteins, Other]


Pssm-ID: 273337 [Multi-domain]  Cd Length: 1205  Bit Score: 247.13  E-value: 1.82e-66
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254446   398 AWQRTYVEVVhQSVAQNSTQKVLSFTT-TTLDDILKSFSDVSVIRVASGYLLMLAYACLTM-----LRWDCSKSQGAVGL 471
Cdd:TIGR00917  533 AWEKAFIQLA-KDELLPMVQATISFSAeRSIEDELKRESTADVITIAISYLVMFAYISLTLgdsprLKSLYVTSKVLLGL 611
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254446   472 AGVLLVALSVAAGLGLCSLIGISFNAATTQVLPFLALGVGVDDVFLLAHAF---------SETGQNKRIPFEDRTGECLK 542
Cdd:TIGR00917  612 SGILIVMLSVLGSVGVFSAVGLKSTLIIMEVIPFLVLAVGVDNIFILVFFYfyleyfyrqVGVDNEQELTLERRLSRALM 691
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254446   543 RTGASVALTSISNVTAFFMAALIPIPALRAFSLQAAVVVVFNFAMVLLIFPAILSMDLYRREDRRLDIFCCftspcvsrv 622
Cdd:TIGR00917  692 EVGPSITLASLSEILAFALGALIKMPAVRVFSMFAVLAVFLDFLLQITAFVALLVLDFKRTEDKRVDCFPC--------- 762
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254446   623 IQVEPQAYTDThdntrysppppysshsfahetqitmqstvqlrteydphthvyyTTAEPRSEisvqpvtvtqdtlSCqsp 702
Cdd:TIGR00917  763 IKTSKSSISAE-------------------------------------------KGSGQRKA-------------GL--- 783
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254446   703 estsstrdllsqfsdsslhcleppctkwtLSSFAEKHYAPFLLKPKAKVVVIFLFLGLLGVSLYGTTRVRDGLDLTDIVP 782
Cdd:TIGR00917  784 -----------------------------LTRYFKEVYAPVLLHWIVKIVVIAFFVGLLMAGIALSTRVEIGLDQQIVLP 834
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254446   783 RETREYDFIAAQFKYFSFYNMYIVTQKADYPniqhllYDLHRSFSNVKYVMLEENKQL-------------PKMWLHYFR 849
Cdd:TIGR00917  835 QDSYLQIYFASLTPLLEVGPPFYIVIKGDYN------YTDFESQNKLCTMGGCDKDSIvnvfnnlsyiakpASSWLDDYL 908
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254446   850 DWLQGLQDAFDSDWETGKimpnnYKNGSDDGVLAYKllvqtgsrdkpiDISQLTKQRlvdadgiINPSAFYIYLTAWVSN 929
Cdd:TIGR00917  909 VWLSPQASCCCRKFTNGT-----FCNGPDPQCFRCA------------DLSSDAQGR-------PSTTQFKEKLPWFLNA 964
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254446   930 DP--------VAYAASQANIRPHrpewvhdkadympetrlripaAEPIEYAQFPFYLNGLRDTSDFVEAIEKVRTICSNY 1001
Cdd:TIGR00917  965 LPsadcakggHAAYSSAVDLQGY---------------------ATIIQASSFRTYHTPLNTQVDFINAMRAAQEFAAKV 1023
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254446  1002 T-SLGLSSYPNGYPFLFWEQYIGLRHWLLLFISVVLACTFLVCAVFL-LNPWTAGIIVMVLALMTVELFGMMGLIGIKLS 1079
Cdd:TIGR00917 1024 SrSSKMEVYPYSVFYVFFEQYLTIWKTAIINLSIALGAIFIVCLFLLqLNALSVVNLIMSVGMAVVFCVGIMHLWSISLN 1103
                          730       740       750       760       770       780       790       800
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254446  1080 AVPVVILIASVGIGVEFTVHVALAFLTAI-GDKNRRAVLALEHMFAPVLDGAVST-LLGVLMLAGSEFDFIVRYFFAVLA 1157
Cdd:TIGR00917 1104 AVSVVNSVMHKGIAIEFCTHINAQFSTGKhFSRNHRAKEALGGMGSSVFSGITLTkLVGVVVLGFSRSEIFVVYYFRMYL 1183
                          810       820
                   ....*....|....*....|..
gi 134254446  1158 ILTILGVLNGLVLLPVLLSFFG 1179
Cdd:TIGR00917 1184 ALVLLGFLHGLVFLPVLLSVLG 1205
Sterol-sensing pfam12349
Sterol-sensing domain of SREBP cleavage-activation; Sterol regulatory element-binding proteins ...
462-616 1.07e-50

Sterol-sensing domain of SREBP cleavage-activation; Sterol regulatory element-binding proteins (SREBPs) are membrane-bound transcription factors that promote lipid synthesis in animal cells. They are embedded in the membranes of the endoplasmic reticulum (ER) in a helical hairpin orientation and are released from the ER by a two-step proteolytic process. Proteolysis begins when the SREBPs are cleaved at Site-1, which is located at a leucine residue in the middle of the hydrophobic loop in the lumen of the ER. Upon proteolytic processing SREBP can activate the expression of genes involved in cholesterol biosynthesis and uptake. SCAP stimulates cleavage of SREBPs via fusion of the their two C-termini. This domain is the transmembrane region that traverses the membrane eight times and is the sterol-sensing domain of the cleavage protein. WD40 domains are found towards the C-terminus.


Pssm-ID: 403533 [Multi-domain]  Cd Length: 153  Bit Score: 175.86  E-value: 1.07e-50
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254446   462 CSKSQGAVGLAGVLLVALSVAAGLGLCSLIGISFNAATTQVLPFLALGVGVDDVFLLAHAFSETgqNKRIPFEDRTGECL 541
Cdd:pfam12349    1 MVKSKFGLGLAGVIIVLASVASSLGLCAYFGLTLTLIISEVIPFLVLAIGVDNIFILVKAVQRT--PRSLDVSERIAEAL 78
                           90       100       110       120       130       140       150
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 134254446   542 KRTGASVALTSISNVTAFFMAALIPIPALRAFSLQAAVVVVFNFAMVLLIFPAILSMDLYRREDRRLDIFCCFTS 616
Cdd:pfam12349   79 GQVGPSILLTSLTEILAFLIGALTDMPAVQEFCLFAAVALLFDFLLQMTFFVAVLSLDIRRLESNRLDVLCCVRS 153
Patched pfam02460
Patched family; The transmembrane protein Patched is a receptor for the morphogene Sonic ...
384-1178 1.92e-46

Patched family; The transmembrane protein Patched is a receptor for the morphogene Sonic Hedgehog. This protein associates with the smoothened protein to transduce hedgehog signals.


Pssm-ID: 308203  Cd Length: 793  Bit Score: 180.63  E-value: 1.92e-46
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254446   384 HINWNEDKAAAILEAWQRTYVEVVHQSVAQNSTQkVLSFTTTTLDDILKSFSDVSVIRVASGYLLMLAYACLT-----ML 458
Cdd:pfam02460  162 FLKFDEEEVEEDSKEWEDELSQLLHNKYASEHIQ-FTIFHDQILNDELVRNALTLTPFFVIGFFLLLTFSIIVsvtlsSY 240
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254446   459 RWDCSKSQGAVGLAGVLLVALSVAAGLGLCSLIGISFNAATTqVLPFLALGVGVDDVFLLAHAFSETgqNKRIPFEDRTG 538
Cdd:pfam02460  241 TIDWVRSKPILAALGLLSPVMAIVSSFGLLFWMGFPFNSIVC-VTPFLVLAIGVDDMFLMVAAWQRT--TATLSVKKRMG 317
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254446   539 ECLKRTGASVALTSISNVTAFFMAALIPIPALRAFSLQAAVVVVFNFAMVLLIFPAILSMdlyrredrrldifccftspc 618
Cdd:pfam02460  318 EALSEAGVSITITSLTDVLSFGIGTYTPTPAIQLFCAYTAVAIFFDFIYQITFFAAIMAI-------------------- 377
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254446   619 vsrviqvepqaytdthdntrysppppysshsfahetqitmqstvqlrteydphthvyytTAEPrsEISVQPVTVTQDTLS 698
Cdd:pfam02460  378 -----------------------------------------------------------CAKP--EAEGRHCLFVWATSS 396
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254446   699 CQSPESTSSTRDllsqfsdsSLHCLEPPctkwtLSSFAEKHYAPFLLKPKAKVVVIFLFLGLLGVSLYGTTRVRDGLDLT 778
Cdd:pfam02460  397 PQRIDSEGSEPD--------KSHNIEQL-----KSRFFLDIYCPFLLNPSVRVCMLVLFVVYIAIAIYGCVNIKEGLEPD 463
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254446   779 DIVPRETREYDFIAAQFKYFSFY--NMYIVTQKAdyPNIQ-HLLYD----LHRSFSNVKYVMleeNKQLPKMWLHYFRDW 851
Cdd:pfam02460  464 KLVLEDSPLVEYLSLREKHFWPEglQIQVAVNNP--PNLTiPESRDrmneMVDEFENTPYSL---GPNSTLFWLREYENF 538
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254446   852 LQGLQDAFDSDWEtgkimpnnykngsddgvlaykllvqtgsrdkpidisqltkqrlvdadgiinPSAFYIYLTAWVSNdp 931
Cdd:pfam02460  539 LSTLNMEEEEDEE---------------------------------------------------KEWSYGNLPSFLKA-- 565
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254446   932 vayaasqanirPHRPEW----VHDKADYMpetrlripaaepIEYAQFPFYLNGLRDTSDFVEAIEKVRTICSNYTSLGLS 1007
Cdd:pfam02460  566 -----------PGNSHWagdlVWDDNTTM------------VTKFRFTLAGKGLSTWNDRTRALQEWRSIADQYPEFNVT 622
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254446  1008 SYPNGYPFLfwEQYIGLRHWLLLFISVVLACTFLVCAVFLLNPWTAGIIVMVLALMTVELFGMMGLIGIKLSAVPVVILI 1087
Cdd:pfam02460  623 VFDEDAPFA--DQYLTILPSTIQNIVITLICMFIVCFLFIPNPPCVFVITLAIASIDIGVFGFLSLWGVDLDPISMITII 700
                          730       740       750       760       770       780       790       800
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254446  1088 ASVGIGVEFTVHVALAFLTAIG-DKNRRAVLALEHMFAPVLDGAVSTLLGVLMLAgseF--DFIVRYFFAVLAILTILGV 1164
Cdd:pfam02460  701 MSIGFSVDFSAHIAYHFVRSRGdTPAERVVDALEALGWPVFQGGLSTILGVLVLL---FvpSYMVVVFFKTVFLVVAIGL 777
                          810
                   ....*....|....
gi 134254446  1165 LNGLVLLPVLLSFF 1178
Cdd:pfam02460  778 LHGLFILPIILSLF 791
COG1033 COG1033
Predicted exporter protein, RND superfamily [General function prediction only];
469-606 3.92e-09

Predicted exporter protein, RND superfamily [General function prediction only];


Pssm-ID: 223964 [Multi-domain]  Cd Length: 727  Bit Score: 61.17  E-value: 3.92e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254446  469 VGLAGVLLVALSVAAGLGLCSLIGISFNAATtQVLPFLALGVGVDDVFLLAHAFSETGQNKriPFEDRTGECLKRTGASV 548
Cdd:COG1033   594 KAIIPLIPIAIVVGWNFGLMGLLGIPLTPAT-ATLGAIILGIGVDYSIHITERYREERKKG--GPKEAIETTVERTGKAI 670
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254446  549 ALTSISnvTAFFMAALI--PIPALRAFSLQAAVVVVFNFAMVLLIFPAILSMdLYRREDR 606
Cdd:COG1033   671 LASALT--TAIGFLALIfsPFPIISNFGLLTVIGILLSLLASLVLLPALLVL-LDGRRKR 727
COG1033 COG1033
Predicted exporter protein, RND superfamily [General function prediction only];
400-597 8.08e-09

Predicted exporter protein, RND superfamily [General function prediction only];


Pssm-ID: 223964 [Multi-domain]  Cd Length: 727  Bit Score: 60.01  E-value: 8.08e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254446  400 QRTYVEVVHQSVAQNSTQKVLSFTTTTL-------DDILKSF-SDVSVIRVASGYLLMLA-YACLTMLRWdcsksqgavG 470
Cdd:COG1033   153 DAQKEEIYEEIERIIEIAKFPSGVKLYLtgdpairYQILREIqKDMVVLLALAVILMVIVlYYVFRSVRR---------A 223
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254446  471 LAGVLLVALSVAAGLGLCSLIGISFNAATTQVLPFLaLGVGVDDVFLLAHAFSETGQNKRIPFEdRTGECLKRTGASVAL 550
Cdd:COG1033   224 LLPLIIVLVSVLWTLGAMGLLGIPLTITTSAVPPLL-IGIGIDYGVHFHNRYEEERRKGRTVEE-AVVEAIKHTGPAVLI 301
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|....*..
gi 134254446  551 TSISNVTAFFMAALIPIPALRAFSLQAAVVVVFNFAMVLLIFPAILS 597
Cdd:COG1033   302 AALTTAAGFLSLLTSSIPAIKEFGILLSIGIILAFLSSLTVLPALLI 348
COG1033 COG1033
Predicted exporter protein, RND superfamily [General function prediction only];
1034-1158 3.74e-08

Predicted exporter protein, RND superfamily [General function prediction only];


Pssm-ID: 223964 [Multi-domain]  Cd Length: 727  Bit Score: 58.08  E-value: 3.74e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254446 1034 VVLACTFLVCAVFLLNPWTAGIIVMVLALMTVELFGMMGLIGIKLSavPVVILIAS--VGIGVEFTVHVALAFLTAI-GD 1110
Cdd:COG1033   576 LGIILVFALLLIIFRSPLKAIIPLIPIAIVVGWNFGLMGLLGIPLT--PATATLGAiiLGIGVDYSIHITERYREERkKG 653
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*....
gi 134254446 1111 KNRRAVL-ALEHMFAPVLDGAVSTLLGVLMLAGSEFDFIvRYFFAVLAI 1158
Cdd:COG1033   654 GPKEAIEtTVERTGKAILASALTTAIGFLALIFSPFPII-SNFGLLTVI 701
2A067 TIGR00921
The (Largely Archaeal Putative) Hydrophobe/Amphiphile Efflux-3 (HAE3) Family; Characterized ...
429-612 2.45e-07

The (Largely Archaeal Putative) Hydrophobe/Amphiphile Efflux-3 (HAE3) Family; Characterized members of the RND superfamily all probably catalyze substrate efflux via an H+ antiport mechanism. These proteins are found ubiquitously in bacteria, archaea and eukaryotes. They fall into seven phylogenetic families, this family (2.A.6.7) consists of uncharacterised putative transporters, largely in the Archaea. [Transport and binding proteins, Unknown substrate]


Pssm-ID: 273340 [Multi-domain]  Cd Length: 719  Bit Score: 55.23  E-value: 2.45e-07
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254446   429 DILKSFSDVSVIRVASGYLLMLAYACLTMLRWdcsksqgAVGLAGVLLVALSVAAGLGLCSLIGISFNAATTQVLPFLaL 508
Cdd:TIGR00921  186 DIEREFGKDMGTTMAISGILVVLVLLLDFKRW-------WRPLLPLVIILFGVAWVLGIMGWLGIPLYATTLLAVPML-I 257
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254446   509 GVGVDDVFLLAHAFSETGQNKRiPFEDRTGECLKRTGASVALTSISNVtAFFMAALIPI-PALRAFSLQAAVVVVFNFAM 587
Cdd:TIGR00921  258 GVGIDYGIQTLNRYEEERDIGR-AKGEAIVTAVRRTGRAVLIALLTTS-AGFAALALSEfPMVSEFGLGLVAGLITAYLL 335
                          170       180
                   ....*....|....*....|....*.
gi 134254446   588 VLLIFPAIL-SMDLYRREDRRLDIFC 612
Cdd:TIGR00921  336 TLLVLPALLqSIDIGREKVKKEIIAI 361
2A067 TIGR00921
The (Largely Archaeal Putative) Hydrophobe/Amphiphile Efflux-3 (HAE3) Family; Characterized ...
469-596 3.48e-06

The (Largely Archaeal Putative) Hydrophobe/Amphiphile Efflux-3 (HAE3) Family; Characterized members of the RND superfamily all probably catalyze substrate efflux via an H+ antiport mechanism. These proteins are found ubiquitously in bacteria, archaea and eukaryotes. They fall into seven phylogenetic families, this family (2.A.6.7) consists of uncharacterised putative transporters, largely in the Archaea. [Transport and binding proteins, Unknown substrate]


Pssm-ID: 273340 [Multi-domain]  Cd Length: 719  Bit Score: 51.76  E-value: 3.48e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254446   469 VGLAGVLLVALSVAAGLGLCSLIGISFNAaTTQVLPFLALGVGVDDVFLLAHAFSETgQNKRIPFEDRTgECLKRTGASV 548
Cdd:TIGR00921  593 KAVFPLIAIGSGILWAIGLMGLRGIPSFL-AMATTISIILGLGMDYSIHLAERYFEE-RKEHGPKEAIT-HTMERTGPGI 669
                           90       100       110       120
                   ....*....|....*....|....*....|....*....|....*...
gi 134254446   549 ALTSISNVTAFFMAALIPIPALRAFSLQAAVVVVFNFAMVLLIFPAIL 596
Cdd:TIGR00921  670 LFSGLTTAGGFLSLLLSHFPIMRNFGLVQGIGVLSSLTAALVVFPALL 717
COG1033 COG1033
Predicted exporter protein, RND superfamily [General function prediction only];
1030-1161 5.75e-06

Predicted exporter protein, RND superfamily [General function prediction only];


Pssm-ID: 223964 [Multi-domain]  Cd Length: 727  Bit Score: 50.77  E-value: 5.75e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254446 1030 LFISVVLACTFLVCAVFL-LNPWTAGIIVMVLALMTVEL-FGMMGLIGIKLSAVPVVILIASVGIGVEFTVHVALAFL-- 1105
Cdd:COG1033   198 MVVLLALAVILMVIVLYYvFRSVRRALLPLIIVLVSVLWtLGAMGLLGIPLTITTSAVPPLLIGIGIDYGVHFHNRYEee 277
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....*..
gi 134254446 1106 TAIGDKNRRAVL-ALEHMFAPVLDGAVSTLLGVLMLAGSEFDFIVRyfFAVLAILTI 1161
Cdd:COG1033   278 RRKGRTVEEAVVeAIKHTGPAVLIAALTTAAGFLSLLTSSIPAIKE--FGILLSIGI 332
AcrB COG0841
Multidrug efflux pump subunit AcrB [Defense mechanisms];
1030-1158 1.49e-04

Multidrug efflux pump subunit AcrB [Defense mechanisms];


Pssm-ID: 223911 [Multi-domain]  Cd Length: 1009  Bit Score: 46.45  E-value: 1.49e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254446 1030 LFISVVLActFLVCAVFLLNpWTAGIIVMV---LALMTVelFGMMGLIGIKLSAVPVVILIASVGIGVEFTVHVALAFLT 1106
Cdd:COG0841   335 LFEAIVLV--VLVMYLFLGN-LRATLIPALavpVSLLGT--FAVMYAFGFSLNTLTLFALVLAIGLLVDDAIVVVENIER 409
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....*....
gi 134254446 1107 AIGDKNRR--AVLALEHMFAPVLDGAVSTLLG---VLMLAGS--EFdfiVRYFFAVLAI 1158
Cdd:COG0841   410 HMRGLPPReaAEKAMGEIGGAVIAITLVLIAVflpMAFMGGStgEL---FRQFAITIAV 465
2A067 TIGR00921
The (Largely Archaeal Putative) Hydrophobe/Amphiphile Efflux-3 (HAE3) Family; Characterized ...
1041-1151 2.34e-04

The (Largely Archaeal Putative) Hydrophobe/Amphiphile Efflux-3 (HAE3) Family; Characterized members of the RND superfamily all probably catalyze substrate efflux via an H+ antiport mechanism. These proteins are found ubiquitously in bacteria, archaea and eukaryotes. They fall into seven phylogenetic families, this family (2.A.6.7) consists of uncharacterised putative transporters, largely in the Archaea. [Transport and binding proteins, Unknown substrate]


Pssm-ID: 273340 [Multi-domain]  Cd Length: 719  Bit Score: 45.60  E-value: 2.34e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254446  1041 LVCAVFLL--NPWTAGIIVMVLALMTVEL-FGMMGLIGIKLSAVPVVILIASVGIGVEFTVHVALAFLTAIG---DKNRR 1114
Cdd:TIGR00921  205 LVVLVLLLdfKRWWRPLLPLVIILFGVAWvLGIMGWLGIPLYATTLLAVPMLIGVGIDYGIQTLNRYEEERDigrAKGEA 284
                           90       100       110
                   ....*....|....*....|....*....|....*..
gi 134254446  1115 AVLALEHMFAPVLDGAVSTLLGVLMLAGSEFDFIVRY 1151
Cdd:TIGR00921  285 IVTAVRRTGRAVLIALLTTSAGFAALALSEFPMVSEF 321
YdfJ COG2409
Uncharacterized membrane protein YdfJ, MMPL/SSD domain [Function unknown];
467-598 2.98e-04

Uncharacterized membrane protein YdfJ, MMPL/SSD domain [Function unknown];


Pssm-ID: 225272 [Multi-domain]  Cd Length: 937  Bit Score: 45.49  E-value: 2.98e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254446  467 GAVGLAGVLL--VALSVAAGLGLCSLIGISFNAAT-TQVLPF---LALGVGVD-DVFLLA---HAFSEtGQNKripfEDR 536
Cdd:COG2409   206 RSVITAFLPLitVGLSLLVAQGIVALLAYAFGLGVsTFALSLlvaLGIGAGTDyALFLVSryrEELRE-GQDR----EAA 280
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 134254446  537 TGECLKRTGASVALTSISNVTAFFMAALIPIPALRAFSLQAAVVVVFNFAMVLLIFPAILSM 598
Cdd:COG2409   281 VGTAYRTAGKTVAFSGLTVAIALLGLSFARLPFLKTLGIAAAIGVAVAVLAALTLLPALLAL 342
PHA03377 PHA03377
EBNA-3C; Provisional
1253-1369 5.00e-04

EBNA-3C; Provisional


Pssm-ID: 177614 [Multi-domain]  Cd Length: 1000  Bit Score: 44.66  E-value: 5.00e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254446 1253 QVIVEATENPVFAHSTVVHPES-RHHPPSNPRQ-QPHLDSGSLPPGRQGQQPRRDP-----PREGLW--PPPYRPRRDAF 1323
Cdd:PHA03377  699 QPSEESHLSSMSPTQPISHEEQpRYEDPDDPLDlSLHPDQAPPPSHQAPYSGHEEPqaqqaPYPGYWepRPPQAPYLGYQ 778
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*.
gi 134254446 1324 EISTEGHSGPSNRARWGPRGARSHNPRNPASTAMGSSVPGYCQPIT 1369
Cdd:PHA03377  779 EPQAQGVQVSSYPGYAGPWGLRAQHPRYRHSWAYWSQYPGHGHPQG 824
HpnN TIGR03480
hopanoid biosynthesis associated RND transporter like protein HpnN; The genomes containing ...
401-596 5.31e-04

hopanoid biosynthesis associated RND transporter like protein HpnN; The genomes containing members of this family share the machinery for the biosynthesis of hopanoid lipids. Furthermore, the genes of this family are usually located proximal to other components of this biological process. The proteins appear to be related to the RND family of export proteins, particularly the hydrophobe/amphiphile efflux-3 (HAE3) family represented by TIGR00921.


Pssm-ID: 274598 [Multi-domain]  Cd Length: 862  Bit Score: 44.60  E-value: 5.31e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254446   401 RTYVEVVhQSVAQNSTQKVLSFTTTTlDDILKSFsdvsvIRVASGYLLMLAYACLTMLRwdcSKSQGAVGLAGVLLVALS 480
Cdd:TIGR03480  683 RRFVRAV-RKVAPDATGAPVSILESG-DTVVGAF-----LQAFIYALVAITVLLLLTLR---RVRDVLLVLAPLLLAGLL 752
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254446   481 VAAglgLCSLIGISFNAATTQVLPFLaLGVGVDDVFLLAHAFSEtGQNKRIPFEDRTGEclkrtgaSVALTSISNVTAFF 560
Cdd:TIGR03480  753 TVA---AMVLLGIPFNFANIIALPLL-LGLGVDFGIYMVHRWRN-GVDSGNLLQSSTAR-------AVFFSALTTATAFG 820
                          170       180       190
                   ....*....|....*....|....*....|....*.
gi 134254446   561 MAALIPIPALRAFSLQAAVVVVFNFAMVLLIFPAIL 596
Cdd:TIGR03480  821 SLAVSSHPGTASMGILLSLGLGLTLLCTLIFLPALL 856
COG4258 COG4258
Predicted exporter [General function prediction only];
431-594 9.28e-04

Predicted exporter [General function prediction only];


Pssm-ID: 226709 [Multi-domain]  Cd Length: 788  Bit Score: 43.71  E-value: 9.28e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254446  431 LKSFSD---VSVIRVASGYLL--MLAYACLTMLRWDCSKsqGAVGLAGVLLVALSVAAGLGLCsliGISFNAATTQVLpF 505
Cdd:COG4258   633 RKSTFDrlfAAYRYVLAGLLAgaLALVLCLAVARRGWRR--GLRVLLPSVLALGCGLAVLAMA---GVPLNLFHLLAL-V 706
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254446  506 LALGVGVDdvflLAHAFSETGQNKRIPFedrtgeclkRTGASVALTSISNVTAFFMAALIPIPALRAFSLQAAVVVVFNF 585
Cdd:COG4258   707 LVLGVGIN----YALFFSNAGDPRAEPL---------TTLLALALAMLTTLLTFGLLAFSATPVLSSFGITLASGIILAF 773

                  ....*....
gi 134254446  586 AMVLLIFPA 594
Cdd:COG4258   774 VLAPLAMPD 782
MMPL pfam03176
MMPL family; Members of this family are putative integral membrane proteins from bacteria. ...
467-598 4.11e-03

MMPL family; Members of this family are putative integral membrane proteins from bacteria. Several of the members are mycobacterial proteins. Many of the proteins contain two copies of this aligned region. The function of these proteins is not known, although it has been suggested that they may be involved in lipid transport.


Pssm-ID: 308676 [Multi-domain]  Cd Length: 332  Bit Score: 41.12  E-value: 4.11e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254446   467 GAVGLAGVLL--VALSVAAGLGLCS-LIGISFNAATTQVLPF---LALGVGVD-DVFLLA--HAFSETGQNKripfEDRT 537
Cdd:pfam03176  164 RSVVAALLPLltVGLSLGAAQGLVAiLAHILGIGLSTFALNLlvvLLIAVGTDyALFLVSryREELRAGEDR----EEAV 239
                           90       100       110       120       130       140
                   ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 134254446   538 GECLKRTGASVALTSISNVTAFFMAALIPIPALRAFSLQAAVVVVFNFAMVLLIFPAILSM 598
Cdd:pfam03176  240 IRAVRGTGKVVTAAGLTVAIAMLALSFARLPVFAQVGPTIAIGVLVDVLAALTLLPALLAL 300
2A067 TIGR00921
The (Largely Archaeal Putative) Hydrophobe/Amphiphile Efflux-3 (HAE3) Family; Characterized ...
1036-1161 5.91e-03

The (Largely Archaeal Putative) Hydrophobe/Amphiphile Efflux-3 (HAE3) Family; Characterized members of the RND superfamily all probably catalyze substrate efflux via an H+ antiport mechanism. These proteins are found ubiquitously in bacteria, archaea and eukaryotes. They fall into seven phylogenetic families, this family (2.A.6.7) consists of uncharacterised putative transporters, largely in the Archaea. [Transport and binding proteins, Unknown substrate]


Pssm-ID: 273340 [Multi-domain]  Cd Length: 719  Bit Score: 40.98  E-value: 5.91e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254446  1036 LACTFLVCAVFLL---NPWTAgiIVMVLALMTVELF--GMMGLIGIKLSAVPVVILIASVGIGVEFTVHVALAFL---TA 1107
Cdd:TIGR00921  574 IAGAILVLMILLAvfrNPIKA--VFPLIAIGSGILWaiGLMGLRGIPSFLAMATTISIILGLGMDYSIHLAERYFeerKE 651
                           90       100       110       120       130       140
                   ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 134254446  1108 IGDKNrrAVL-ALEHMFAPVLDGAVSTLLGVLMLAGSEFDFI--------VRYFFAVLAILTI 1161
Cdd:TIGR00921  652 HGPKE--AIThTMERTGPGILFSGLTTAGGFLSLLLSHFPIMrnfglvqgIGVLSSLTAALVV 712
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH