NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|57526399|ref|NP_001009781|]
View 

cystic fibrosis transmembrane conductance regulator [Ovis aries]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
CFTR_protein super family cl36858
cystic fibrosis transmembrane conductor regulator (CFTR); The model describes the cystis ...
1-1469 0e+00

cystic fibrosis transmembrane conductor regulator (CFTR); The model describes the cystis fibrosis transmembrane conductor regulator (CFTR) in eukaryotes. The principal role of this protein is chloride ion conductance. The protein is predicted to consist of 12 transmembrane domains. Mutations or lesions in the genetic loci have been linked to the aetiology of asthma, bronchiectasis, chronic obstructive pulmonary disease etc. Disease-causing mutations have been studied by 36Cl efflux assays in vitro cell cultures and electrophysiology, all of which point to the impairment of chloride channel stability and not the biosynthetic processing per se. [Transport and binding proteins, Anions]


The actual alignment was detected with superfamily member TIGR01271:

Pssm-ID: 273530 [Multi-domain]  Cd Length: 1490  Bit Score: 2624.97  E-value: 0e+00
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399      1 MQRSPLEKASVVSKLFFSWTRPILKKGYRQRLELSDIYHISSSDSADNLSEKLEREWDRELAS-KKNPKLINALRRCFFW 79
Cdd:TIGR01271    1 MQRSPVEKANFLSKLFFWWTRPILRKGYRQKLELSDIYQIPSFDSADNLSERLEREWDRELASaKKNPKLLNALRRCFFW 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399     80 RFMFYGIILYLGEVTKAVQPLLLGRIIASYDPDNKVERSIAIYLGIGLCLLFIVRTLLLHPAIFGLHHIGMQMRIAMFSL 159
Cdd:TIGR01271   81 RFVFYGILLYFGEATKAVQPLLLGRIIASYDPFNAPEREIAYYLALGLCLLFIVRTLLLHPAIFGLHHLGMQMRIALFSL 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399    160 IYKKTLKLSSRVLDKISIGQLVSLLSNNLNKFDEGLALAHFVWIAPLQVTLLMGLLWDLLQAFTFCGLAFLVVLALLQAG 239
Cdd:TIGR01271  161 IYKKTLKLSSRVLDKISTGQLVSLLSNNLNKFDEGLALAHFVWIAPLQVILLMGLIWELLEVNGFCGLGFLILLALFQAC 240
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399    240 LGKMMMKYRDQRAGKINERLVITSEMIENIQSVKAYCWEEAMEKIIENLRQTELKLTRKAAYVRYLNSSAFFFSGFFVVF 319
Cdd:TIGR01271  241 LGQKMMPYRDKRAGKISERLAITSEIIENIQSVKAYCWEEAMEKIIKNIRQDELKLTRKIAYLRYFYSSAFFFSGFFVVF 320
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399    320 LSVLPYALLKGIILRKIFTTISFCIVLRMAVTRQFPWAVQTWYDSLGAINKIQDFLQKQEYKTLEYNLTTTDVVMENVTA 399
Cdd:TIGR01271  321 LSVVPYALIKGIILRRIFTTISYCIVLRMTVTRQFPGAIQTWYDSLGAITKIQDFLCKEEYKTLEYNLTTTEVEMVNVTA 400
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399    400 FWEEGFSKLFEKAKENNNNRKISNCDTSLFFSNL-LLGTPVLKDISFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSE 478
Cdd:TIGR01271  401 SWDEGIGELFEKIKQNNKARKQPNGDDGLFFSNFsLYVTPVLKNISFKLEKGQLLAVAGSTGSGKSSLLMMIMGELEPSE 480
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399    479 GKIKHSGRISFCSQYSWIMPGTIKDNIIFGVSYDEYRYRSVIKACQLEEDISKFSEKDNIVLGEGGITLSGGQRARISLA 558
Cdd:TIGR01271  481 GKIKHSGRISFSPQTSWIMPGTIKDNIIFGLSYDEYRYTSVIKACQLEEDIALFPEKDKTVLGEGGITLSGGQRARISLA 560
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399    559 RAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSVYFYGTFSELQNQRPD 638
Cdd:TIGR01271  561 RAVYKDADLYLLDSPFTHLDVVTEKEIFESCLCKLMSNKTRILVTSKLEHLKKADKILLLHEGVCYFYGTFSELQAKRPD 640
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399    639 FSSKLMGCDTFDQFTAERRNSIITETLRRFSLEGD-TSVSWNETKKPSFKQTG-EFGEKRKNS-ILNSINSIRKFSVVQK 715
Cdd:TIGR01271  641 FSSLLLGLEAFDNFSAERRNSILTETLRRVSIDGDsTVFSGPETIKQSFKQPPpEFAEKRKQSiILNPIASARKFSFVQM 720
                          730       740       750       760       770       780       790       800
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399    716 TSLQMNG--IDGASDEPLERRLSLVPHSEPGEGILPRSNAVNSGPTFLGGRRQSVLNLMTCSsvNQGQSIHRKTATSTRK 793
Cdd:TIGR01271  721 GPQKAQAttIEDAVREPSERKFSLVPEDEQGEESLPRGNQYHHGLQHQAQRRQSVLQLMTHS--NRGENRREQLQTSFRK 798
                          810       820       830       840       850       860       870       880
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399    794 MSLAPQAS--LAEIDIYSRRLSQDTGLEISEEINEEDLRDCFFDDVENIPAVTTWNTYLRYITVHKSLMFVLIWCLVVFL 871
Cdd:TIGR01271  799 KSSITQQNelASELDIYSRRLSKDSVYEISEEINEEDLKECFADERENVFETTTWNTYLRYITTNRNLVFVLIFCLVIFL 878
                          890       900       910       920       930       940       950       960
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399    872 VEVAASLVVLCLF---PKILLQDKGNSTKNAS--NSYAVIITSTSSYYIFYIYVGVADTLLALGLFRGLPLVHTLITVSK 946
Cdd:TIGR01271  879 AEVAASLLGLWLItdnPSAPNYVDQQHANASSpdVQKPVIITPTSAYYIFYIYVGTADSVLALGFFRGLPLVHTLLTVSK 958
                          970       980       990      1000      1010      1020      1030      1040
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399    947 TLHHKMLQSVLQAPMSTLNTLKTGGILNRFSKDIAVLDDLLPLTIFDFIQLLLIVIGAVVVVSVLQPYIFLATVPVIAAF 1026
Cdd:TIGR01271  959 RLHEQMLHSVLQAPMAVLNTMKAGRILNRFTKDMAIIDDMLPLTLFDFIQLTLIVLGAIFVVSVLQPYIFIAAIPVAVIF 1038
                         1050      1060      1070      1080      1090      1100      1110      1120
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399   1027 ILLRGYFLHTSQQLKQLESEGRSPIFTHLVTSLKGLWTLRAFGRQPYFETLFHKALNLHTANWFLYLSTLRWFQMRIEMI 1106
Cdd:TIGR01271 1039 IMLRAYFLRTSQQLKQLESEARSPIFSHLITSLKGLWTIRAFGRQSYFETLFHKALNLHTANWFLYLSTLRWFQMRIDII 1118
                         1130      1140      1150      1160      1170      1180      1190      1200
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399   1107 FVIFFIAVTFISILTTGEGEGRVGIILTLAMNIMGTLQWAVNSSIDVDSLMRSVSRVFKFIDMPTEDGKPNNSFRPskdS 1186
Cdd:TIGR01271 1119 FVFFFIAVTFIAIGTNQDGEGEVGIILTLAMNILSTLQWAVNSSIDVDGLMRSVSRVFKFIDLPQEEPRPSGGGGK---Y 1195
                         1210      1220      1230      1240      1250      1260      1270      1280
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399   1187 QPSKVMIIENQHVKKddIWPSGGQMTVKDLTAKYIDGGNAILENISFSISPGQRVGLLGRTGSGKSTLLLAFLRLLNTKG 1266
Cdd:TIGR01271 1196 QLSTVLVIENPHAQK--CWPSGGQMDVQGLTAKYTEAGRAVLQDLSFSVEGGQRVGLLGRTGSGKSTLLSALLRLLSTEG 1273
                         1290      1300      1310      1320      1330      1340      1350      1360
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399   1267 EIQIDGVSWDSITLQQWRKAFGVIPQKVFIFSGTFRKNLDPYEQWSDQEIWKVADEVGLRSVIEQFPGKLDFVLVDGGCV 1346
Cdd:TIGR01271 1274 EIQIDGVSWNSVTLQTWRKAFGVIPQKVFIFSGTFRKNLDPYEQWSDEEIWKVAEEVGLKSVIEQFPDKLDFVLVDGGYV 1353
                         1370      1380      1390      1400      1410      1420      1430      1440
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399   1347 LSHGHKQLMCLARSVLSKAKILLLDEPSAHLDPITYQIIRRTLKQAFADCTVILSEHRIEAMLECQRFLVIEENKVRQYD 1426
Cdd:TIGR01271 1354 LSNGHKQLMCLARSILSKAKILLLDEPSAHLDPVTLQIIRKTLKQSFSNCTVILSEHRVEALLECQQFLVIEGSSVKQYD 1433
                         1450      1460      1470      1480
                   ....*....|....*....|....*....|....*....|....*
gi 57526399   1427 SIQRMLSEKSLFRQAISPADRLKLLP--HRNSSRQRSRANIAALK 1469
Cdd:TIGR01271 1434 SIQKLLNETSLFKQAMSAADRLKLFPlhRRNSSKRKPQPKITALR 1478
 
Name Accession Description Interval E-value
CFTR_protein TIGR01271
cystic fibrosis transmembrane conductor regulator (CFTR); The model describes the cystis ...
1-1469 0e+00

cystic fibrosis transmembrane conductor regulator (CFTR); The model describes the cystis fibrosis transmembrane conductor regulator (CFTR) in eukaryotes. The principal role of this protein is chloride ion conductance. The protein is predicted to consist of 12 transmembrane domains. Mutations or lesions in the genetic loci have been linked to the aetiology of asthma, bronchiectasis, chronic obstructive pulmonary disease etc. Disease-causing mutations have been studied by 36Cl efflux assays in vitro cell cultures and electrophysiology, all of which point to the impairment of chloride channel stability and not the biosynthetic processing per se. [Transport and binding proteins, Anions]


Pssm-ID: 273530 [Multi-domain]  Cd Length: 1490  Bit Score: 2624.97  E-value: 0e+00
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399      1 MQRSPLEKASVVSKLFFSWTRPILKKGYRQRLELSDIYHISSSDSADNLSEKLEREWDRELAS-KKNPKLINALRRCFFW 79
Cdd:TIGR01271    1 MQRSPVEKANFLSKLFFWWTRPILRKGYRQKLELSDIYQIPSFDSADNLSERLEREWDRELASaKKNPKLLNALRRCFFW 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399     80 RFMFYGIILYLGEVTKAVQPLLLGRIIASYDPDNKVERSIAIYLGIGLCLLFIVRTLLLHPAIFGLHHIGMQMRIAMFSL 159
Cdd:TIGR01271   81 RFVFYGILLYFGEATKAVQPLLLGRIIASYDPFNAPEREIAYYLALGLCLLFIVRTLLLHPAIFGLHHLGMQMRIALFSL 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399    160 IYKKTLKLSSRVLDKISIGQLVSLLSNNLNKFDEGLALAHFVWIAPLQVTLLMGLLWDLLQAFTFCGLAFLVVLALLQAG 239
Cdd:TIGR01271  161 IYKKTLKLSSRVLDKISTGQLVSLLSNNLNKFDEGLALAHFVWIAPLQVILLMGLIWELLEVNGFCGLGFLILLALFQAC 240
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399    240 LGKMMMKYRDQRAGKINERLVITSEMIENIQSVKAYCWEEAMEKIIENLRQTELKLTRKAAYVRYLNSSAFFFSGFFVVF 319
Cdd:TIGR01271  241 LGQKMMPYRDKRAGKISERLAITSEIIENIQSVKAYCWEEAMEKIIKNIRQDELKLTRKIAYLRYFYSSAFFFSGFFVVF 320
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399    320 LSVLPYALLKGIILRKIFTTISFCIVLRMAVTRQFPWAVQTWYDSLGAINKIQDFLQKQEYKTLEYNLTTTDVVMENVTA 399
Cdd:TIGR01271  321 LSVVPYALIKGIILRRIFTTISYCIVLRMTVTRQFPGAIQTWYDSLGAITKIQDFLCKEEYKTLEYNLTTTEVEMVNVTA 400
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399    400 FWEEGFSKLFEKAKENNNNRKISNCDTSLFFSNL-LLGTPVLKDISFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSE 478
Cdd:TIGR01271  401 SWDEGIGELFEKIKQNNKARKQPNGDDGLFFSNFsLYVTPVLKNISFKLEKGQLLAVAGSTGSGKSSLLMMIMGELEPSE 480
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399    479 GKIKHSGRISFCSQYSWIMPGTIKDNIIFGVSYDEYRYRSVIKACQLEEDISKFSEKDNIVLGEGGITLSGGQRARISLA 558
Cdd:TIGR01271  481 GKIKHSGRISFSPQTSWIMPGTIKDNIIFGLSYDEYRYTSVIKACQLEEDIALFPEKDKTVLGEGGITLSGGQRARISLA 560
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399    559 RAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSVYFYGTFSELQNQRPD 638
Cdd:TIGR01271  561 RAVYKDADLYLLDSPFTHLDVVTEKEIFESCLCKLMSNKTRILVTSKLEHLKKADKILLLHEGVCYFYGTFSELQAKRPD 640
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399    639 FSSKLMGCDTFDQFTAERRNSIITETLRRFSLEGD-TSVSWNETKKPSFKQTG-EFGEKRKNS-ILNSINSIRKFSVVQK 715
Cdd:TIGR01271  641 FSSLLLGLEAFDNFSAERRNSILTETLRRVSIDGDsTVFSGPETIKQSFKQPPpEFAEKRKQSiILNPIASARKFSFVQM 720
                          730       740       750       760       770       780       790       800
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399    716 TSLQMNG--IDGASDEPLERRLSLVPHSEPGEGILPRSNAVNSGPTFLGGRRQSVLNLMTCSsvNQGQSIHRKTATSTRK 793
Cdd:TIGR01271  721 GPQKAQAttIEDAVREPSERKFSLVPEDEQGEESLPRGNQYHHGLQHQAQRRQSVLQLMTHS--NRGENRREQLQTSFRK 798
                          810       820       830       840       850       860       870       880
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399    794 MSLAPQAS--LAEIDIYSRRLSQDTGLEISEEINEEDLRDCFFDDVENIPAVTTWNTYLRYITVHKSLMFVLIWCLVVFL 871
Cdd:TIGR01271  799 KSSITQQNelASELDIYSRRLSKDSVYEISEEINEEDLKECFADERENVFETTTWNTYLRYITTNRNLVFVLIFCLVIFL 878
                          890       900       910       920       930       940       950       960
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399    872 VEVAASLVVLCLF---PKILLQDKGNSTKNAS--NSYAVIITSTSSYYIFYIYVGVADTLLALGLFRGLPLVHTLITVSK 946
Cdd:TIGR01271  879 AEVAASLLGLWLItdnPSAPNYVDQQHANASSpdVQKPVIITPTSAYYIFYIYVGTADSVLALGFFRGLPLVHTLLTVSK 958
                          970       980       990      1000      1010      1020      1030      1040
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399    947 TLHHKMLQSVLQAPMSTLNTLKTGGILNRFSKDIAVLDDLLPLTIFDFIQLLLIVIGAVVVVSVLQPYIFLATVPVIAAF 1026
Cdd:TIGR01271  959 RLHEQMLHSVLQAPMAVLNTMKAGRILNRFTKDMAIIDDMLPLTLFDFIQLTLIVLGAIFVVSVLQPYIFIAAIPVAVIF 1038
                         1050      1060      1070      1080      1090      1100      1110      1120
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399   1027 ILLRGYFLHTSQQLKQLESEGRSPIFTHLVTSLKGLWTLRAFGRQPYFETLFHKALNLHTANWFLYLSTLRWFQMRIEMI 1106
Cdd:TIGR01271 1039 IMLRAYFLRTSQQLKQLESEARSPIFSHLITSLKGLWTIRAFGRQSYFETLFHKALNLHTANWFLYLSTLRWFQMRIDII 1118
                         1130      1140      1150      1160      1170      1180      1190      1200
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399   1107 FVIFFIAVTFISILTTGEGEGRVGIILTLAMNIMGTLQWAVNSSIDVDSLMRSVSRVFKFIDMPTEDGKPNNSFRPskdS 1186
Cdd:TIGR01271 1119 FVFFFIAVTFIAIGTNQDGEGEVGIILTLAMNILSTLQWAVNSSIDVDGLMRSVSRVFKFIDLPQEEPRPSGGGGK---Y 1195
                         1210      1220      1230      1240      1250      1260      1270      1280
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399   1187 QPSKVMIIENQHVKKddIWPSGGQMTVKDLTAKYIDGGNAILENISFSISPGQRVGLLGRTGSGKSTLLLAFLRLLNTKG 1266
Cdd:TIGR01271 1196 QLSTVLVIENPHAQK--CWPSGGQMDVQGLTAKYTEAGRAVLQDLSFSVEGGQRVGLLGRTGSGKSTLLSALLRLLSTEG 1273
                         1290      1300      1310      1320      1330      1340      1350      1360
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399   1267 EIQIDGVSWDSITLQQWRKAFGVIPQKVFIFSGTFRKNLDPYEQWSDQEIWKVADEVGLRSVIEQFPGKLDFVLVDGGCV 1346
Cdd:TIGR01271 1274 EIQIDGVSWNSVTLQTWRKAFGVIPQKVFIFSGTFRKNLDPYEQWSDEEIWKVAEEVGLKSVIEQFPDKLDFVLVDGGYV 1353
                         1370      1380      1390      1400      1410      1420      1430      1440
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399   1347 LSHGHKQLMCLARSVLSKAKILLLDEPSAHLDPITYQIIRRTLKQAFADCTVILSEHRIEAMLECQRFLVIEENKVRQYD 1426
Cdd:TIGR01271 1354 LSNGHKQLMCLARSILSKAKILLLDEPSAHLDPVTLQIIRKTLKQSFSNCTVILSEHRVEALLECQQFLVIEGSSVKQYD 1433
                         1450      1460      1470      1480
                   ....*....|....*....|....*....|....*....|....*
gi 57526399   1427 SIQRMLSEKSLFRQAISPADRLKLLP--HRNSSRQRSRANIAALK 1469
Cdd:TIGR01271 1434 SIQKLLNETSLFKQAMSAADRLKLFPlhRRNSSKRKPQPKITALR 1478
ABC_6TM_CFTR_D2 cd18600
Six-transmembrane helical domain 2 of Cystic Fibrosis Transmembrane Conductance Regulator; ...
844-1167 0e+00

Six-transmembrane helical domain 2 of Cystic Fibrosis Transmembrane Conductance Regulator; This group represents the six-transmembrane domain 2 (TMD2) of the ABC transporters that belong to the ABCC subfamily, such as the sulphonylurea receptors SUR1/2 (ABCC8), the cystic fibrosis transmembrane conductance regulator (CFTR, ABCC7), Multidrug-Resistance associated Proteins (MRP1-9), VMR1 (vacuolar multidrug resistance protein 1), and YOR1 (yeast oligomycin resistance transporter protein). This TM subunit exhibits the type 3 ATP-binding cassette (ABC) exporter fold, which is characterized by 6 TM helices per subunit (domain), or a total of 12 TM helices for the complete transporter. The type 3 ABC exporters are found in both prokaryotes and eukaryotes, where they mediate the cellular secretion of toxic compounds, a various type of lipids and polypeptides. All ABC transporters share a common architecture of two transmembrane domains (TMDs) and two nucleotide-binding domains (NBDs). The two NBDs together bind and hydrolyze ATP, thereby providing the driving force for transport, while the TMDs participate in substrate recognition and translocation across the lipid membrane by alternating between inward- and outward-facing conformations. By contrast, bacterial ABC exporters are typically assembled from dimers of TMD-NBD half-transporters. Thus, most bacterial ABC transporters are comprised of two identical TMDs and two identical NBDs.


Pssm-ID: 350044 [Multi-domain]  Cd Length: 324  Bit Score: 578.68  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399  844 TTWNTYLRYITVHKSLMFVLIWCLVVFLVEVAASLVVLCLFPKILLQDKGNSTKNASNSYAVIITSTSSYYIFYIYVGVA 923
Cdd:cd18600    1 TTWNTYLRYITSHKSLIFVLILCLVIFAIEVAASLVGLWLLRSQADRVNTTRPESSSNTYAVIVTFTSSYYVFYIYVGVA 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399  924 DTLLALGLFRGLPLVHTLITVSKTLHHKMLQSVLQAPMSTLNTLKTGGILNRFSKDIAVLDDLLPLTIFDFIQLLLIVIG 1003
Cdd:cd18600   81 DSLLAMGFFRGLPLVHTLITVSKTLHQKMLHAVLHAPMSTFNTMKAGRILNRFSKDTAILDDLLPLTIFDFIQLFLIVIG 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399 1004 AVVVVSVLQPYIFLATVPVIAAFILLRGYFLHTSQQLKQLESEGRSPIFTHLVTSLKGLWTLRAFGRQPYFETLFHKALN 1083
Cdd:cd18600  161 AITVVSILQPYIFLATVPVIIAFIVLRAYFLRTSQQLKQLESEARSPIFAHLVTSLKGLWTLRAFGRQPYFETLFHKALN 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399 1084 LHTANWFLYLSTLRWFQMRIEMIFVIFFIAVTFISILTTGEGEGRVGIILTLAMNIMGTLQWAVNSSIDVDSLMRSVSRV 1163
Cdd:cd18600  241 LHTANWFLYLSTLRWFQMRIEMIFVIFFTAVTFISIGTTGDGEGRVGIILTLAMNIMSTLQWAVNTSIDVDSLMRSVSRI 320

                 ....
gi 57526399 1164 FKFI 1167
Cdd:cd18600  321 FKFI 324
PLN03232 PLN03232
ABC transporter C family member; Provisional
5-1446 1.08e-145

ABC transporter C family member; Provisional


Pssm-ID: 215640 [Multi-domain]  Cd Length: 1495  Bit Score: 483.71  E-value: 1.08e-145
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399     5 PLEKASVVSKLFFSWTRPILKKGYRQRLELSDIYHISSSDSADNLSEKLEREWDRElASKKNPKLINALRRCFFWRFMFY 84
Cdd:PLN03232  228 PERYASIFSRIYFSWMTPLMQLGYRKPITEKDVWQLDQWDQTETLIKRFQRCWTEE-SRRPKPWLLRALNNSLGGRFWLG 306
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399    85 GIILYLGEVTKAVQPLLLGRIIASY---DPD-NKVERSIAIYLGIGLCLLFIVRTLLlhpaifGLHHIGMQMRIAMFSLI 160
Cdd:PLN03232  307 GIFKIGHDLSQFVGPVILSHLLQSMqegDPAwVGYVYAFLIFFGVTFGVLCESQYFQ------NVGRVGFRLRSTLVAAI 380
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399   161 YKKTLKLSSRVLDKISIGQLVSLLSNNLNKFDEGLALAHFVWIAPLQVTLLMGLLWDLLQAFTFCGLAFLVVLALLQAGL 240
Cdd:PLN03232  381 FHKSLRLTHEARKNFASGKVTNMITTDANALQQIAEQLHGLWSAPFRIIVSMVLLYQQLGVASLFGSLILFLLIPLQTLI 460
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399   241 GKMMMKYRDQRAGKINERLVITSEMIENIQSVKAYCWEEAMEKIIENLRQTELKLTRKAAYVRYLNSSAFFFSGFFVVFL 320
Cdd:PLN03232  461 VRKMRKLTKEGLQWTDKRVGIINEILASMDTVKCYAWEKSFESRIQGIRNEELSWFRKAQLLSAFNSFILNSIPVVVTLV 540
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399   321 SVLPYALLKG-IILRKIFTTISFCIVLRMAVTrQFPWAVQTWYDSLGAINKIQDFLQKQEyKTLEYNLT----TTDVVME 395
Cdd:PLN03232  541 SFGVFVLLGGdLTPARAFTSLSLFAVLRSPLN-MLPNLLSQVVNANVSLQRIEELLLSEE-RILAQNPPlqpgAPAISIK 618
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399   396 NVTAFWEEGFSKlfekakennnnrkisncdtslffsnlllgtPVLKDISFKIERGQLLAVAGSTGAGKTSLLMMIMGELE 475
Cdd:PLN03232  619 NGYFSWDSKTSK------------------------------PTLSDINLEIPVGSLVAIVGGTGEGKTSLISAMLGELS 668
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399   476 PSE-GKIKHSGRISFCSQYSWIMPGTIKDNIIFGVSYDEYRYRSVIKACQLEEDISKFSEKDNIVLGEGGITLSGGQRAR 554
Cdd:PLN03232  669 HAEtSSVVIRGSVAYVPQVSWIFNATVRENILFGSDFESERYWRAIDVTALQHDLDLLPGRDLTEIGERGVNISGGQKQR 748
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399   555 ISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSVYFYGTFSELQN 634
Cdd:PLN03232  749 VSMARAVYSNSDIYIFDDPLSALDAHVAHQVFDSCMKDELKGKTRVLVTNQLHFLPLMDRIILVSEGMIKEEGTFAELSK 828
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399   635 QRPDFSSKLMGCDTFDQFTAERRNSiitETLRRFSleGDTSVSWNETKKPSFKQtgefgekrknsilnsinsirkfsvvq 714
Cdd:PLN03232  829 SGSLFKKLMENAGKMDATQEVNTND---ENILKLG--PTVTIDVSERNLGSTKQ-------------------------- 877
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399   715 ktslqmngidgasdeplerrlslvphsepgegilprsnavnsgptflGGRRQSVLnlmtcssvnqgqsihrktatstrkm 794
Cdd:PLN03232  878 -----------------------------------------------GKRGRSVL------------------------- 885
                         810       820       830       840       850       860       870       880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399   795 slapqaslaeidiysrrlsqdtgleISEEINEEdlrdcffddvenipAVTTWNTYLRYITVHKSLMFVLIWCLVVFLVEV 874
Cdd:PLN03232  886 -------------------------VKQEERET--------------GIISWNVLMRYNKAVGGLWVVMILLVCYLTTEV 926
                         890       900       910       920       930       940       950       960
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399   875 --AASLVVLCLFpkillqdkgnSTKNASNSYaviitsTSSYYIFyIYVGVADTLLALGLFRGLPLVHTLITVSKTLHHKM 952
Cdd:PLN03232  927 lrVSSSTWLSIW----------TDQSTPKSY------SPGFYIV-VYALLGFGQVAVTFTNSFWLISSSLHAAKRLHDAM 989
                         970       980       990      1000      1010      1020      1030      1040
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399   953 LQSVLQAPMSTLNTLKTGGILNRFSKDIAVLDDLLPLTIFDFIQLLLIVIGAVVVVSVLQPYIFLATVPVIAAFILLRGY 1032
Cdd:PLN03232  990 LNSILRAPMLFFHTNPTGRVINRFSKDIGDIDRNVANLMNMFMNQLWQLLSTFALIGTVSTISLWAIMPLLILFYAAYLY 1069
                        1050      1060      1070      1080      1090      1100      1110      1120
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399  1033 FLHTSQQLKQLESEGRSPIFTHLVTSLKGLWTLRAFGRQPYFETLFHKALNLHTANWFLYLSTLRWFQMRIEMIF-VIFF 1111
Cdd:PLN03232 1070 YQSTSREVRRLDSVTRSPIYAQFGEALNGLSSIRAYKAYDRMAKINGKSMDNNIRFTLANTSSNRWLTIRLETLGgVMIW 1149
                        1130      1140      1150      1160      1170      1180      1190      1200
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399  1112 IAVTFiSILTTGEGEGRV------GIILTLAMNIMGTLQWAVNSSIDVDSLMRSVSRVFKFIDMPTEdgkpnnsfrpskd 1185
Cdd:PLN03232 1150 LTATF-AVLRNGNAENQAgfastmGLLLSYTLNITTLLSGVLRQASKAENSLNSVERVGNYIDLPSE------------- 1215
                        1210      1220      1230      1240      1250      1260      1270      1280
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399  1186 sqpsKVMIIENQhvKKDDIWPSGGQMTVKDLTAKYIDGGNAILENISFSISPGQRVGLLGRTGSGKSTLLLAFLRLLNT- 1264
Cdd:PLN03232 1216 ----ATAIIENN--RPVSGWPSRGSIKFEDVHLRYRPGLPPVLHGLSFFVSPSEKVGVVGRTGAGKSSMLNALFRIVELe 1289
                        1290      1300      1310      1320      1330      1340      1350      1360
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399  1265 KGEIQIDGVSWDSITLQQWRKAFGVIPQKVFIFSGTFRKNLDPYEQWSDQEIWKVADEVGLRSVIEQFPGKLDFVLVDGG 1344
Cdd:PLN03232 1290 KGRIMIDDCDVAKFGLTDLRRVLSIIPQSPVLFSGTVRFNIDPFSEHNDADLWEALERAHIKDVIDRNPFGLDAEVSEGG 1369
                        1370      1380      1390      1400      1410      1420      1430      1440
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399  1345 CVLSHGHKQLMCLARSVLSKAKILLLDEPSAHLDPITYQIIRRTLKQAFADCTVILSEHRIEAMLECQRFLVIEENKVRQ 1424
Cdd:PLN03232 1370 ENFSVGQRQLLSLARALLRRSKILVLDEATASVDVRTDSLIQRTIREEFKSCTMLVIAHRLNTIIDCDKILVLSSGQVLE 1449
                        1450      1460
                  ....*....|....*....|....*.
gi 57526399  1425 YDSIQRMLSEK--SLFR--QAISPAD 1446
Cdd:PLN03232 1450 YDSPQELLSRDtsAFFRmvHSTGPAN 1475
CFTR_R pfam14396
Cystic fibrosis TM conductance regulator (CFTR), regulator domain;
638-849 2.89e-120

Cystic fibrosis TM conductance regulator (CFTR), regulator domain;


Pssm-ID: 316884  Cd Length: 213  Bit Score: 374.44  E-value: 2.89e-120
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399    638 DFSSKLMGCDTFDQFTAERRNSIITETLRRFSLEGDTSVSWNETKKPSFKQTGEFGEKRKNS-ILNSINSIRKFSVVQKT 716
Cdd:pfam14396    1 DFSSLLMGLEAFDNFSAERRNSILTETLRRFSVDGDAGGSRNEPKKQSFKQTGDFGEKRKNSvILNPLNSSRKFSIIQKS 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399    717 SLQMNGIDGASDEPLERRLSLVPHSEPGEGILPRSNAVNSGPTFLGGRRQSVLNLMTcSSVNQGQSIHRKTATSTRKMSL 796
Cdd:pfam14396   81 PLQMNGIEEGLDEPPERRLSLVPESEQGEAALPRSNVLNTGPTLQGQRRQSVLNLMT-NTVAQGQNRREKGQSSFRKMSV 159
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|....
gi 57526399    797 APQASLA-EIDIYSRRLSQDTGLEISEEINEEDLRDCFFDDVENIPAVTTWNTY 849
Cdd:pfam14396  160 VPQSNLAsELDIYARRLSKDSVLDITEEINEEDLKECFADDIENVFETTTWNTY 213
MdlB COG1132
ABC-type multidrug transport system, ATPase and permease component [Defense mechanisms];
863-1440 1.54e-68

ABC-type multidrug transport system, ATPase and permease component [Defense mechanisms];


Pssm-ID: 224055 [Multi-domain]  Cd Length: 567  Bit Score: 241.95  E-value: 1.54e-68
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399  863 LIWCLVVFLVEVAASLVVLCLFPKILlqDKGNSTKNASNSYAVIItstssyyiFYIYVGVAdtllALGLFRGLPLVHTLI 942
Cdd:COG1132   16 LLLAILLLLLSALLSLLLPLLIGRII--DALLADLGELLELLLLL--------LLLALLGG----VLRALQSYLGSRLGQ 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399  943 TVSKTLHHKMLQSVLQAPMSTLNTLKTGGILNRFSKDIAVLDDLLPLTIFDFIQLLLIVIGAVVVVSVLQPYIFLATVPV 1022
Cdd:COG1132   82 KIVADLRRDLFEKLLRLPLSFFDKAKSGDLISRLTNDVEAVSNLVSTVLVLVFTSILLLIGSLVLLFSLSWRLALILLLI 161
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399 1023 IAAFILLRGYFLHTSQQLKQLESEGRSPIFTHLVTSLKGLWTLRAFGRQPYFETLFHKALNLHTANWFLYLSTLRWFQMR 1102
Cdd:COG1132  162 LPLLALVLSLLARKSRKLSRRVREALGELNARLLESLSGIRVIKAFGAEDRELKRFEEANEELRRANLRASRLEALLAPL 241
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399 1103 IEMIFVIFFIAVTFISILTTGEGE---GRVGIILTLAMNIMGTLQWAVNSSIDVDSLMRSVSRVFKFIDMPTEdgkpnns 1179
Cdd:COG1132  242 MLLLSSLGTVLVLALGGFLVLSGSltvGALAAFILYLLRLLTPILQLGEVVSLLQRASAAAERLFELLDEEPE------- 314
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399 1180 frpskdsqpskvmiIENQHVKKddiWPSGGQMTVKDLTAKYiDGGNAILENISFSISPGQRVGLLGRTGSGKSTLLLA-F 1258
Cdd:COG1132  315 --------------VEDPPDPL---KDTIGSIEFENVSFSY-PGKKPVLKDISFSIEPGEKVAIVGPSGSGKSTLIKLlL 376
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399 1259 LRLLNTKGEIQIDGVSWDSITLQQWRKAFGVIPQKVFIFSGTFRKNLDPYEQW-SDQEIWKVADEVGLRSVIEQFPGKLD 1337
Cdd:COG1132  377 RLYDPTSGEILIDGIDIRDISLDSLRKRIGIVSQDPLLFSGTIRENIALGRPDaTDEEIEEALKLANAHEFIANLPDGYD 456
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399 1338 FVLVDGGCVLSHGHKQLMCLARSVLSKAKILLLDEPSAHLDPITYQIIRRTLKQAFADCTVILSEHRIEAMLECQRFLVI 1417
Cdd:COG1132  457 TIVGERGVNLSGGQRQRLAIARALLRNPPILILDEATSALDTETEALIQDALKKLLKGRTTLIIAHRLSTIKNADRIIVL 536
                        570       580
                 ....*....|....*....|...
gi 57526399 1418 EENKVRQYDSIQRMLSEKSLFRQ 1440
Cdd:COG1132  537 DNGRIVERGTHEELLAKGGLYAR 559
AAA smart00382
ATPases associated with a variety of cellular activities; AAA - ATPases associated with a ...
449-612 8.94e-08

ATPases associated with a variety of cellular activities; AAA - ATPases associated with a variety of cellular activities. This profile/alignment only detects a fraction of this vast family. The poorly conserved N-terminal helix is missing from the alignment.


Pssm-ID: 214640 [Multi-domain]  Cd Length: 148  Bit Score: 52.76  E-value: 8.94e-08
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399     449 RGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKhsgrisfcsqyswimpgTIKDNIIFGVSYDEYRyrsvikacqleed 528
Cdd:smart00382    1 PGEVILIVGPPGSGKTTLARALARELGPPGGGVI-----------------YIDGEDILEEVLDQLL------------- 50
                            90       100       110       120       130       140       150       160
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399     529 iskfsekdNIVLGEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTR------ILV 602
Cdd:smart00382   51 --------LIIVGGKKASGSGELRLRLALALARKLKPDVLILDEITSLLDAEQEALLLLLEELRLLLLLKSeknltvILT 122
                           170
                    ....*....|
gi 57526399     603 TSKMEHLKKA 612
Cdd:smart00382  123 TNDEKDLGPA 132
 
Name Accession Description Interval E-value
CFTR_protein TIGR01271
cystic fibrosis transmembrane conductor regulator (CFTR); The model describes the cystis ...
1-1469 0e+00

cystic fibrosis transmembrane conductor regulator (CFTR); The model describes the cystis fibrosis transmembrane conductor regulator (CFTR) in eukaryotes. The principal role of this protein is chloride ion conductance. The protein is predicted to consist of 12 transmembrane domains. Mutations or lesions in the genetic loci have been linked to the aetiology of asthma, bronchiectasis, chronic obstructive pulmonary disease etc. Disease-causing mutations have been studied by 36Cl efflux assays in vitro cell cultures and electrophysiology, all of which point to the impairment of chloride channel stability and not the biosynthetic processing per se. [Transport and binding proteins, Anions]


Pssm-ID: 273530 [Multi-domain]  Cd Length: 1490  Bit Score: 2624.97  E-value: 0e+00
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399      1 MQRSPLEKASVVSKLFFSWTRPILKKGYRQRLELSDIYHISSSDSADNLSEKLEREWDRELAS-KKNPKLINALRRCFFW 79
Cdd:TIGR01271    1 MQRSPVEKANFLSKLFFWWTRPILRKGYRQKLELSDIYQIPSFDSADNLSERLEREWDRELASaKKNPKLLNALRRCFFW 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399     80 RFMFYGIILYLGEVTKAVQPLLLGRIIASYDPDNKVERSIAIYLGIGLCLLFIVRTLLLHPAIFGLHHIGMQMRIAMFSL 159
Cdd:TIGR01271   81 RFVFYGILLYFGEATKAVQPLLLGRIIASYDPFNAPEREIAYYLALGLCLLFIVRTLLLHPAIFGLHHLGMQMRIALFSL 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399    160 IYKKTLKLSSRVLDKISIGQLVSLLSNNLNKFDEGLALAHFVWIAPLQVTLLMGLLWDLLQAFTFCGLAFLVVLALLQAG 239
Cdd:TIGR01271  161 IYKKTLKLSSRVLDKISTGQLVSLLSNNLNKFDEGLALAHFVWIAPLQVILLMGLIWELLEVNGFCGLGFLILLALFQAC 240
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399    240 LGKMMMKYRDQRAGKINERLVITSEMIENIQSVKAYCWEEAMEKIIENLRQTELKLTRKAAYVRYLNSSAFFFSGFFVVF 319
Cdd:TIGR01271  241 LGQKMMPYRDKRAGKISERLAITSEIIENIQSVKAYCWEEAMEKIIKNIRQDELKLTRKIAYLRYFYSSAFFFSGFFVVF 320
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399    320 LSVLPYALLKGIILRKIFTTISFCIVLRMAVTRQFPWAVQTWYDSLGAINKIQDFLQKQEYKTLEYNLTTTDVVMENVTA 399
Cdd:TIGR01271  321 LSVVPYALIKGIILRRIFTTISYCIVLRMTVTRQFPGAIQTWYDSLGAITKIQDFLCKEEYKTLEYNLTTTEVEMVNVTA 400
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399    400 FWEEGFSKLFEKAKENNNNRKISNCDTSLFFSNL-LLGTPVLKDISFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSE 478
Cdd:TIGR01271  401 SWDEGIGELFEKIKQNNKARKQPNGDDGLFFSNFsLYVTPVLKNISFKLEKGQLLAVAGSTGSGKSSLLMMIMGELEPSE 480
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399    479 GKIKHSGRISFCSQYSWIMPGTIKDNIIFGVSYDEYRYRSVIKACQLEEDISKFSEKDNIVLGEGGITLSGGQRARISLA 558
Cdd:TIGR01271  481 GKIKHSGRISFSPQTSWIMPGTIKDNIIFGLSYDEYRYTSVIKACQLEEDIALFPEKDKTVLGEGGITLSGGQRARISLA 560
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399    559 RAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSVYFYGTFSELQNQRPD 638
Cdd:TIGR01271  561 RAVYKDADLYLLDSPFTHLDVVTEKEIFESCLCKLMSNKTRILVTSKLEHLKKADKILLLHEGVCYFYGTFSELQAKRPD 640
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399    639 FSSKLMGCDTFDQFTAERRNSIITETLRRFSLEGD-TSVSWNETKKPSFKQTG-EFGEKRKNS-ILNSINSIRKFSVVQK 715
Cdd:TIGR01271  641 FSSLLLGLEAFDNFSAERRNSILTETLRRVSIDGDsTVFSGPETIKQSFKQPPpEFAEKRKQSiILNPIASARKFSFVQM 720
                          730       740       750       760       770       780       790       800
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399    716 TSLQMNG--IDGASDEPLERRLSLVPHSEPGEGILPRSNAVNSGPTFLGGRRQSVLNLMTCSsvNQGQSIHRKTATSTRK 793
Cdd:TIGR01271  721 GPQKAQAttIEDAVREPSERKFSLVPEDEQGEESLPRGNQYHHGLQHQAQRRQSVLQLMTHS--NRGENRREQLQTSFRK 798
                          810       820       830       840       850       860       870       880
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399    794 MSLAPQAS--LAEIDIYSRRLSQDTGLEISEEINEEDLRDCFFDDVENIPAVTTWNTYLRYITVHKSLMFVLIWCLVVFL 871
Cdd:TIGR01271  799 KSSITQQNelASELDIYSRRLSKDSVYEISEEINEEDLKECFADERENVFETTTWNTYLRYITTNRNLVFVLIFCLVIFL 878
                          890       900       910       920       930       940       950       960
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399    872 VEVAASLVVLCLF---PKILLQDKGNSTKNAS--NSYAVIITSTSSYYIFYIYVGVADTLLALGLFRGLPLVHTLITVSK 946
Cdd:TIGR01271  879 AEVAASLLGLWLItdnPSAPNYVDQQHANASSpdVQKPVIITPTSAYYIFYIYVGTADSVLALGFFRGLPLVHTLLTVSK 958
                          970       980       990      1000      1010      1020      1030      1040
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399    947 TLHHKMLQSVLQAPMSTLNTLKTGGILNRFSKDIAVLDDLLPLTIFDFIQLLLIVIGAVVVVSVLQPYIFLATVPVIAAF 1026
Cdd:TIGR01271  959 RLHEQMLHSVLQAPMAVLNTMKAGRILNRFTKDMAIIDDMLPLTLFDFIQLTLIVLGAIFVVSVLQPYIFIAAIPVAVIF 1038
                         1050      1060      1070      1080      1090      1100      1110      1120
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399   1027 ILLRGYFLHTSQQLKQLESEGRSPIFTHLVTSLKGLWTLRAFGRQPYFETLFHKALNLHTANWFLYLSTLRWFQMRIEMI 1106
Cdd:TIGR01271 1039 IMLRAYFLRTSQQLKQLESEARSPIFSHLITSLKGLWTIRAFGRQSYFETLFHKALNLHTANWFLYLSTLRWFQMRIDII 1118
                         1130      1140      1150      1160      1170      1180      1190      1200
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399   1107 FVIFFIAVTFISILTTGEGEGRVGIILTLAMNIMGTLQWAVNSSIDVDSLMRSVSRVFKFIDMPTEDGKPNNSFRPskdS 1186
Cdd:TIGR01271 1119 FVFFFIAVTFIAIGTNQDGEGEVGIILTLAMNILSTLQWAVNSSIDVDGLMRSVSRVFKFIDLPQEEPRPSGGGGK---Y 1195
                         1210      1220      1230      1240      1250      1260      1270      1280
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399   1187 QPSKVMIIENQHVKKddIWPSGGQMTVKDLTAKYIDGGNAILENISFSISPGQRVGLLGRTGSGKSTLLLAFLRLLNTKG 1266
Cdd:TIGR01271 1196 QLSTVLVIENPHAQK--CWPSGGQMDVQGLTAKYTEAGRAVLQDLSFSVEGGQRVGLLGRTGSGKSTLLSALLRLLSTEG 1273
                         1290      1300      1310      1320      1330      1340      1350      1360
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399   1267 EIQIDGVSWDSITLQQWRKAFGVIPQKVFIFSGTFRKNLDPYEQWSDQEIWKVADEVGLRSVIEQFPGKLDFVLVDGGCV 1346
Cdd:TIGR01271 1274 EIQIDGVSWNSVTLQTWRKAFGVIPQKVFIFSGTFRKNLDPYEQWSDEEIWKVAEEVGLKSVIEQFPDKLDFVLVDGGYV 1353
                         1370      1380      1390      1400      1410      1420      1430      1440
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399   1347 LSHGHKQLMCLARSVLSKAKILLLDEPSAHLDPITYQIIRRTLKQAFADCTVILSEHRIEAMLECQRFLVIEENKVRQYD 1426
Cdd:TIGR01271 1354 LSNGHKQLMCLARSILSKAKILLLDEPSAHLDPVTLQIIRKTLKQSFSNCTVILSEHRVEALLECQQFLVIEGSSVKQYD 1433
                         1450      1460      1470      1480
                   ....*....|....*....|....*....|....*....|....*
gi 57526399   1427 SIQRMLSEKSLFRQAISPADRLKLLP--HRNSSRQRSRANIAALK 1469
Cdd:TIGR01271 1434 SIQKLLNETSLFKQAMSAADRLKLFPlhRRNSSKRKPQPKITALR 1478
ABC_6TM_CFTR_D2 cd18600
Six-transmembrane helical domain 2 of Cystic Fibrosis Transmembrane Conductance Regulator; ...
844-1167 0e+00

Six-transmembrane helical domain 2 of Cystic Fibrosis Transmembrane Conductance Regulator; This group represents the six-transmembrane domain 2 (TMD2) of the ABC transporters that belong to the ABCC subfamily, such as the sulphonylurea receptors SUR1/2 (ABCC8), the cystic fibrosis transmembrane conductance regulator (CFTR, ABCC7), Multidrug-Resistance associated Proteins (MRP1-9), VMR1 (vacuolar multidrug resistance protein 1), and YOR1 (yeast oligomycin resistance transporter protein). This TM subunit exhibits the type 3 ATP-binding cassette (ABC) exporter fold, which is characterized by 6 TM helices per subunit (domain), or a total of 12 TM helices for the complete transporter. The type 3 ABC exporters are found in both prokaryotes and eukaryotes, where they mediate the cellular secretion of toxic compounds, a various type of lipids and polypeptides. All ABC transporters share a common architecture of two transmembrane domains (TMDs) and two nucleotide-binding domains (NBDs). The two NBDs together bind and hydrolyze ATP, thereby providing the driving force for transport, while the TMDs participate in substrate recognition and translocation across the lipid membrane by alternating between inward- and outward-facing conformations. By contrast, bacterial ABC exporters are typically assembled from dimers of TMD-NBD half-transporters. Thus, most bacterial ABC transporters are comprised of two identical TMDs and two identical NBDs.


Pssm-ID: 350044 [Multi-domain]  Cd Length: 324  Bit Score: 578.68  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399  844 TTWNTYLRYITVHKSLMFVLIWCLVVFLVEVAASLVVLCLFPKILLQDKGNSTKNASNSYAVIITSTSSYYIFYIYVGVA 923
Cdd:cd18600    1 TTWNTYLRYITSHKSLIFVLILCLVIFAIEVAASLVGLWLLRSQADRVNTTRPESSSNTYAVIVTFTSSYYVFYIYVGVA 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399  924 DTLLALGLFRGLPLVHTLITVSKTLHHKMLQSVLQAPMSTLNTLKTGGILNRFSKDIAVLDDLLPLTIFDFIQLLLIVIG 1003
Cdd:cd18600   81 DSLLAMGFFRGLPLVHTLITVSKTLHQKMLHAVLHAPMSTFNTMKAGRILNRFSKDTAILDDLLPLTIFDFIQLFLIVIG 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399 1004 AVVVVSVLQPYIFLATVPVIAAFILLRGYFLHTSQQLKQLESEGRSPIFTHLVTSLKGLWTLRAFGRQPYFETLFHKALN 1083
Cdd:cd18600  161 AITVVSILQPYIFLATVPVIIAFIVLRAYFLRTSQQLKQLESEARSPIFAHLVTSLKGLWTLRAFGRQPYFETLFHKALN 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399 1084 LHTANWFLYLSTLRWFQMRIEMIFVIFFIAVTFISILTTGEGEGRVGIILTLAMNIMGTLQWAVNSSIDVDSLMRSVSRV 1163
Cdd:cd18600  241 LHTANWFLYLSTLRWFQMRIEMIFVIFFTAVTFISIGTTGDGEGRVGIILTLAMNIMSTLQWAVNTSIDVDSLMRSVSRI 320

                 ....
gi 57526399 1164 FKFI 1167
Cdd:cd18600  321 FKFI 324
ABCC_CFTR1 cd03291
ATP-binding cassette domain of the cystic fibrosis transmembrane regulator, subfamily C; The ...
389-669 0e+00

ATP-binding cassette domain of the cystic fibrosis transmembrane regulator, subfamily C; The CFTR subfamily domain 1. The cystic fibrosis transmembrane regulator (CFTR), the product of the gene mutated in patients with cystic fibrosis, has adapted the ABC transporter structural motif to form a tightly regulated anion channel at the apical surface of many epithelia. Use of the term assembly of a functional ion channel implies the coming together of subunits, or at least smaller not-yet functional components of the active whole. In fact, on the basis of current knowledge only the CFTR polypeptide itself is required to form an ATP- and protein kinase A-dependent low-conductance chloride channel of the type present in the apical membrane of many epithelial cells. CFTR displays the typical organization (IM-ABC)2 and carries a characteristic hydrophilic R-domain that separates IM1-ABC1 from IM2-ABC2.


Pssm-ID: 213258 [Multi-domain]  Cd Length: 282  Bit Score: 563.71  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399  389 TTDVVMENVTAFWEEGFSKLFEKAKENNNNRKISNCDTSLFFSNL-LLGTPVLKDISFKIERGQLLAVAGSTGAGKTSLL 467
Cdd:cd03291    1 TTGVIMENVTAFWDEGFGELLEKAKQENNDRKHSSDDNNLFFSNLcLVGAPVLKNINLKIEKGEMLAITGSTGSGKTSLL 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399  468 MMIMGELEPSEGKIKHSGRISFCSQYSWIMPGTIKDNIIFGVSYDEYRYRSVIKACQLEEDISKFSEKDNIVLGEGGITL 547
Cdd:cd03291   81 MLILGELEPSEGKIKHSGRISFSSQFSWIMPGTIKENIIFGVSYDEYRYKSVVKACQLEEDITKFPEKDNTVLGEGGITL 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399  548 SGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSVYFYG 627
Cdd:cd03291  161 SGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYG 240
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|..
gi 57526399  628 TFSELQNQRPDFSSKLMGCDTFDQFTAERRNSIITETLRRFS 669
Cdd:cd03291  241 TFSELQSLRPDFSSKLMGYDTFDQFSAERRNSILTETLRRFS 282
ABCC_CFTR2 cd03289
ATP-binding cassette domain 2 of CFTR,subfamily C; The cystic fibrosis transmembrane regulator ...
1209-1469 1.91e-166

ATP-binding cassette domain 2 of CFTR,subfamily C; The cystic fibrosis transmembrane regulator (CFTR), the product of the gene mutated in patients with cystic fibrosis, has adapted the ABC transporter structural motif to form a tightly regulated anion channel at the apical surface of many epithelia. Use of the term assembly of a functional ion channel implies the coming together of subunits or at least smaller not-yet functional components of the active whole. In fact, on the basis of current knowledge only the CFTR polypeptide itself is required to form an ATP- and protein kinase A-dependent low-conductance chloride channel of the type present in the apical membrane of many epithelial cells. CFTR displays the typical organization (IM-ABC)2 and carries a characteristic hydrophilic R-domain that separates IM1-ABC1 from IM2-ABC2.


Pssm-ID: 213256 [Multi-domain]  Cd Length: 275  Bit Score: 500.54  E-value: 1.91e-166
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399 1209 GQMTVKDLTAKYIDGGNAILENISFSISPGQRVGLLGRTGSGKSTLLLAFLRLLNTKGEIQIDGVSWDSITLQQWRKAFG 1288
Cdd:cd03289    1 GQMTVKDLTAKYTEGGNAVLENISFSISPGQRVGLLGRTGSGKSTLLSAFLRLLNTEGDIQIDGVSWNSVPLQKWRKAFG 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399 1289 VIPQKVFIFSGTFRKNLDPYEQWSDQEIWKVADEVGLRSVIEQFPGKLDFVLVDGGCVLSHGHKQLMCLARSVLSKAKIL 1368
Cdd:cd03289   81 VIPQKVFIFSGTFRKNLDPYGKWSDEEIWKVAEEVGLKSVIEQFPGQLDFVLVDGGCVLSHGHKQLMCLARSVLSKAKIL 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399 1369 LLDEPSAHLDPITYQIIRRTLKQAFADCTVILSEHRIEAMLECQRFLVIEENKVRQYDSIQRMLSEKSLFRQAISPADRL 1448
Cdd:cd03289  161 LLDEPSAHLDPITYQVIRKTLKQAFADCTVILSEHRIEAMLECQRFLVIEENKVRQYDSIQKLLNEKSHFKQAISPSDRL 240
                        250       260
                 ....*....|....*....|...
gi 57526399 1449 KLLPHRNSS--RQRSRANIAALK 1469
Cdd:cd03289  241 KLFPRRNSSksKRKPRPQIQALQ 263
MRP_assoc_pro TIGR00957
multi drug resistance-associated protein (MRP); This model describes multi drug ...
5-1438 1.17e-152

multi drug resistance-associated protein (MRP); This model describes multi drug resistance-associated protein (MRP) in eukaryotes. The multidrug resistance-associated protein is an integral membrane protein that causes multidrug resistance when overexpressed in mammalian cells. It belongs to ABC transporter superfamily. The protein topology and function was experimentally demonstrated by epitope tagging and immunofluorescence. Insertion of tags in the critical regions associated with drug efflux, abrogated its function. The C-terminal domain seem to highly conserved. [Transport and binding proteins, Other]


Pssm-ID: 188098 [Multi-domain]  Cd Length: 1522  Bit Score: 503.32  E-value: 1.17e-152
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399      5 PLEKASVVSKLFFSWTRPILKKGYRQRLELSDIYHISSSDSADNLSEKLEREWDRELAS--------------------- 63
Cdd:TIGR00957  203 PESSASFLSRITFWWITGMAVYGYRQPLEESDLWSLNKEDTSEMVVPVLVENWKKECKKtrkqpvsavygkkdpskpkgs 282
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399     64 -------------------KKNPKLINALRRCFFWRFMFYGIILYLGEVTKAVQPLLLgRIIASYDPDNKVERSIAIYLG 124
Cdd:TIGR00957  283 sqldaneevealivksphkPRKPSLFKVLYKTFGPYFLMSFCFKAIHDLMMFIGPQIL-SLLIRFVNDPMAPDWQGYFYT 361
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399    125 IGLCLLFIVRTLLLHPAIFGLHHIGMQMRIAMFSLIYKKTLKLSSRVLDKISIGQLVSLLSNNLNKFDEGLALAHFVWIA 204
Cdd:TIGR00957  362 GLLFVCACLQTLILHQYFHICFVSGMRIKTAVMGAVYRKALVITNSARKSSTVGEIVNLMSVDAQRFMDLATYINMIWSA 441
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399    205 PLQVTLLMGLLWDLLQAFTFCGLAFLVVLALLQAGLGKMMMKYRDQRAGKINERLVITSEMIENIQSVKAYCWEEAMEKI 284
Cdd:TIGR00957  442 PLQVILALYFLWLNLGPSVLAGVAVMVLMVPLNAVMAMKTKTYQVAHMKSKDNRIKLMNEILNGIKVLKLYAWELAFLDK 521
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399    285 IENLRQTELKLTRKAAYVRYLNSSAFFFS--GFFVVFLSVLPYALLKGII-LRKIFTTISFCIVLRMAVTrQFPWAVQTW 361
Cdd:TIGR00957  522 VEGIRQEELKVLKKSAYLHAVGTFTWVCTpfLVALITFAVYVTVDENNILdAEKAFVSLALFNILRFPLN-ILPMVISSI 600
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399    362 YDSLGAINKIQDFLQKQEYKTLEYNLTTTD------VVMENVTAFWEEGFSklfekakennnnrkisncdtslffsnlll 435
Cdd:TIGR00957  601 VQASVSLKRLRIFLSHEELEPDSIERRTIKpgegnsITVHNATFTWARDLP----------------------------- 651
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399    436 gtPVLKDISFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISFCSQYSWIMPGTIKDNIIFGVSYDEYR 515
Cdd:TIGR00957  652 --PTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVHMKGSVAYVPQQAWIQNDSLRENILFGKALNEKY 729
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399    516 YRSVIKACQLEEDISKFSEKDNIVLGEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCK--L 593
Cdd:TIGR00957  730 YQQVLEACALLPDLEILPSGDRTEIGEKGVNLSGGQKQRVSLARAVYSNADIYLFDDPLSAVDAHVGKHIFEHVIGPegV 809
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399    594 MANKTRILVTSKMEHLKKADKILILHEGSVYFYGTFSELQNQRPDFSSKLmgcdtfdqftaerRNSIITETlrrfslEGD 673
Cdd:TIGR00957  810 LKNKTRILVTHGISYLPQVDVIIVMSGGKISEMGSYQELLQRDGAFAEFL-------------RTYAPDEQ------QGH 870
                          730       740       750       760       770       780       790       800
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399    674 TSVSWNetkkpsfkqTGEFGEKRKNSILNsiNSIRKFSVVQKTslqmngidgasdepLERRLSlvPHSEPGEGIlprsna 753
Cdd:TIGR00957  871 LEDSWT---------ALVSGEGKEAKLIE--NGMLVTDVVGKQ--------------LQRQLS--ASSSDSGDQ------ 917
                          810       820       830       840       850       860       870       880
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399    754 vnsgptflgGRRQSvlnlmtcsSVNQGQSIHRKTATStrKMSLAPQASLAEIDIysrrlsqdtgleiseeineedlrDCF 833
Cdd:TIGR00957  918 ---------SRHHG--------SSAELQKAEAKEETW--KLMEADKAQTGQVEL-----------------------SVY 955
                          890       900       910       920       930       940       950       960
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399    834 FDDVENIPAVTTWNTYLRYITVHKSLMFVLIWcLVVFLVEVAAslvvlclfpkillqdkgNSTKNASNsyaviiTSTSSY 913
Cdd:TIGR00957  956 WDYMKAIGLFITFLSIFLFVCNHVSALASNYW-LSLWTDDPMV-----------------NGTQNNTS------LRLSVY 1011
                          970       980       990      1000      1010      1020      1030      1040
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399    914 YIFYIYVGVADTLLALGLFRGLplvhtlITVSKTLHHKMLQSVLQAPMSTLNTLKTGGILNRFSKDIAVLDDLLPLTIFD 993
Cdd:TIGR00957 1012 GALGILQGFAVFGYSMAVSIGG------IQASRVLHQDLLHNKLRSPMSFFERTPSGNLVNRFSKELDTVDSMIPPVIKM 1085
                         1050      1060      1070      1080      1090      1100      1110      1120
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399    994 FIQLLLIVIGAVVVVSVLQPYIFLATVPVIAAFILLRGYFLHTSQQLKQLESEGRSPIFTHLVTSLKGLWTLRAFGRQPY 1073
Cdd:TIGR00957 1086 FMGSLFNVIGALIVILLATPIAAVIIPPLGLLYFFVQRFYVASSRQLKRLESVSRSPVYSHFNETLLGVSVIRAFEEQER 1165
                         1130      1140      1150      1160      1170      1180      1190      1200
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399   1074 FETLFHKALNLHTANWFLYLSTLRWFQMRIEMI--FVIFFIAVtFISILTTGEGEGRVGIILTLAMNIMGTLQWAVNSSI 1151
Cdd:TIGR00957 1166 FIHQSDLKVDENQKAYYPSIVANRWLAVRLECVgnCIVLFAAL-FAVISRHSLSAGLVGLSVSYSLQVTFYLNWLVRMSS 1244
                         1210      1220      1230      1240      1250      1260      1270      1280
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399   1152 DVDSLMRSVSRVFKFIDMPTEdgkpnnsfrpskdsQPSKVmiienQHVKKDDIWPSGGQMTVKDLTAKYIDGGNAILENI 1231
Cdd:TIGR00957 1245 EMETNIVAVERLKEYSETEKE--------------APWQI-----QETAPPSGWPPRGRVEFRNYCLRYREDLDLVLRHI 1305
                         1290      1300      1310      1320      1330      1340      1350      1360
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399   1232 SFSISPGQRVGLLGRTGSGKSTLLLAFLRLLNT-KGEIQIDGVSWDSITLQQWRKAFGVIPQKVFIFSGTFRKNLDPYEQ 1310
Cdd:TIGR00957 1306 NVTIHGGEKVGIVGRTGAGKSSLTLGLFRINESaEGEIIIDGLNIAKIGLHDLRFKITIIPQDPVLFSGSLRMNLDPFSQ 1385
                         1370      1380      1390      1400      1410      1420      1430      1440
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399   1311 WSDQEIWKVADEVGLRSVIEQFPGKLDFVLVDGGCVLSHGHKQLMCLARSVLSKAKILLLDEPSAHLDPITYQIIRRTLK 1390
Cdd:TIGR00957 1386 YSDEEVWWALELAHLKTFVSALPDKLDHECAEGGENLSVGQRQLVCLARALLRKTKILVLDEATAAVDLETDNLIQSTIR 1465
                         1450      1460      1470      1480
                   ....*....|....*....|....*....|....*....|....*...
gi 57526399   1391 QAFADCTVILSEHRIEAMLECQRFLVIEENKVRQYDSIQRMLSEKSLF 1438
Cdd:TIGR00957 1466 TQFEDCTVLTIAHRLNTIMDYTRVIVLDKGEVAEFGAPSNLLQQRGIF 1513
PLN03232 PLN03232
ABC transporter C family member; Provisional
5-1446 1.08e-145

ABC transporter C family member; Provisional


Pssm-ID: 215640 [Multi-domain]  Cd Length: 1495  Bit Score: 483.71  E-value: 1.08e-145
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399     5 PLEKASVVSKLFFSWTRPILKKGYRQRLELSDIYHISSSDSADNLSEKLEREWDRElASKKNPKLINALRRCFFWRFMFY 84
Cdd:PLN03232  228 PERYASIFSRIYFSWMTPLMQLGYRKPITEKDVWQLDQWDQTETLIKRFQRCWTEE-SRRPKPWLLRALNNSLGGRFWLG 306
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399    85 GIILYLGEVTKAVQPLLLGRIIASY---DPD-NKVERSIAIYLGIGLCLLFIVRTLLlhpaifGLHHIGMQMRIAMFSLI 160
Cdd:PLN03232  307 GIFKIGHDLSQFVGPVILSHLLQSMqegDPAwVGYVYAFLIFFGVTFGVLCESQYFQ------NVGRVGFRLRSTLVAAI 380
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399   161 YKKTLKLSSRVLDKISIGQLVSLLSNNLNKFDEGLALAHFVWIAPLQVTLLMGLLWDLLQAFTFCGLAFLVVLALLQAGL 240
Cdd:PLN03232  381 FHKSLRLTHEARKNFASGKVTNMITTDANALQQIAEQLHGLWSAPFRIIVSMVLLYQQLGVASLFGSLILFLLIPLQTLI 460
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399   241 GKMMMKYRDQRAGKINERLVITSEMIENIQSVKAYCWEEAMEKIIENLRQTELKLTRKAAYVRYLNSSAFFFSGFFVVFL 320
Cdd:PLN03232  461 VRKMRKLTKEGLQWTDKRVGIINEILASMDTVKCYAWEKSFESRIQGIRNEELSWFRKAQLLSAFNSFILNSIPVVVTLV 540
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399   321 SVLPYALLKG-IILRKIFTTISFCIVLRMAVTrQFPWAVQTWYDSLGAINKIQDFLQKQEyKTLEYNLT----TTDVVME 395
Cdd:PLN03232  541 SFGVFVLLGGdLTPARAFTSLSLFAVLRSPLN-MLPNLLSQVVNANVSLQRIEELLLSEE-RILAQNPPlqpgAPAISIK 618
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399   396 NVTAFWEEGFSKlfekakennnnrkisncdtslffsnlllgtPVLKDISFKIERGQLLAVAGSTGAGKTSLLMMIMGELE 475
Cdd:PLN03232  619 NGYFSWDSKTSK------------------------------PTLSDINLEIPVGSLVAIVGGTGEGKTSLISAMLGELS 668
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399   476 PSE-GKIKHSGRISFCSQYSWIMPGTIKDNIIFGVSYDEYRYRSVIKACQLEEDISKFSEKDNIVLGEGGITLSGGQRAR 554
Cdd:PLN03232  669 HAEtSSVVIRGSVAYVPQVSWIFNATVRENILFGSDFESERYWRAIDVTALQHDLDLLPGRDLTEIGERGVNISGGQKQR 748
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399   555 ISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSVYFYGTFSELQN 634
Cdd:PLN03232  749 VSMARAVYSNSDIYIFDDPLSALDAHVAHQVFDSCMKDELKGKTRVLVTNQLHFLPLMDRIILVSEGMIKEEGTFAELSK 828
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399   635 QRPDFSSKLMGCDTFDQFTAERRNSiitETLRRFSleGDTSVSWNETKKPSFKQtgefgekrknsilnsinsirkfsvvq 714
Cdd:PLN03232  829 SGSLFKKLMENAGKMDATQEVNTND---ENILKLG--PTVTIDVSERNLGSTKQ-------------------------- 877
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399   715 ktslqmngidgasdeplerrlslvphsepgegilprsnavnsgptflGGRRQSVLnlmtcssvnqgqsihrktatstrkm 794
Cdd:PLN03232  878 -----------------------------------------------GKRGRSVL------------------------- 885
                         810       820       830       840       850       860       870       880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399   795 slapqaslaeidiysrrlsqdtgleISEEINEEdlrdcffddvenipAVTTWNTYLRYITVHKSLMFVLIWCLVVFLVEV 874
Cdd:PLN03232  886 -------------------------VKQEERET--------------GIISWNVLMRYNKAVGGLWVVMILLVCYLTTEV 926
                         890       900       910       920       930       940       950       960
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399   875 --AASLVVLCLFpkillqdkgnSTKNASNSYaviitsTSSYYIFyIYVGVADTLLALGLFRGLPLVHTLITVSKTLHHKM 952
Cdd:PLN03232  927 lrVSSSTWLSIW----------TDQSTPKSY------SPGFYIV-VYALLGFGQVAVTFTNSFWLISSSLHAAKRLHDAM 989
                         970       980       990      1000      1010      1020      1030      1040
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399   953 LQSVLQAPMSTLNTLKTGGILNRFSKDIAVLDDLLPLTIFDFIQLLLIVIGAVVVVSVLQPYIFLATVPVIAAFILLRGY 1032
Cdd:PLN03232  990 LNSILRAPMLFFHTNPTGRVINRFSKDIGDIDRNVANLMNMFMNQLWQLLSTFALIGTVSTISLWAIMPLLILFYAAYLY 1069
                        1050      1060      1070      1080      1090      1100      1110      1120
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399  1033 FLHTSQQLKQLESEGRSPIFTHLVTSLKGLWTLRAFGRQPYFETLFHKALNLHTANWFLYLSTLRWFQMRIEMIF-VIFF 1111
Cdd:PLN03232 1070 YQSTSREVRRLDSVTRSPIYAQFGEALNGLSSIRAYKAYDRMAKINGKSMDNNIRFTLANTSSNRWLTIRLETLGgVMIW 1149
                        1130      1140      1150      1160      1170      1180      1190      1200
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399  1112 IAVTFiSILTTGEGEGRV------GIILTLAMNIMGTLQWAVNSSIDVDSLMRSVSRVFKFIDMPTEdgkpnnsfrpskd 1185
Cdd:PLN03232 1150 LTATF-AVLRNGNAENQAgfastmGLLLSYTLNITTLLSGVLRQASKAENSLNSVERVGNYIDLPSE------------- 1215
                        1210      1220      1230      1240      1250      1260      1270      1280
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399  1186 sqpsKVMIIENQhvKKDDIWPSGGQMTVKDLTAKYIDGGNAILENISFSISPGQRVGLLGRTGSGKSTLLLAFLRLLNT- 1264
Cdd:PLN03232 1216 ----ATAIIENN--RPVSGWPSRGSIKFEDVHLRYRPGLPPVLHGLSFFVSPSEKVGVVGRTGAGKSSMLNALFRIVELe 1289
                        1290      1300      1310      1320      1330      1340      1350      1360
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399  1265 KGEIQIDGVSWDSITLQQWRKAFGVIPQKVFIFSGTFRKNLDPYEQWSDQEIWKVADEVGLRSVIEQFPGKLDFVLVDGG 1344
Cdd:PLN03232 1290 KGRIMIDDCDVAKFGLTDLRRVLSIIPQSPVLFSGTVRFNIDPFSEHNDADLWEALERAHIKDVIDRNPFGLDAEVSEGG 1369
                        1370      1380      1390      1400      1410      1420      1430      1440
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399  1345 CVLSHGHKQLMCLARSVLSKAKILLLDEPSAHLDPITYQIIRRTLKQAFADCTVILSEHRIEAMLECQRFLVIEENKVRQ 1424
Cdd:PLN03232 1370 ENFSVGQRQLLSLARALLRRSKILVLDEATASVDVRTDSLIQRTIREEFKSCTMLVIAHRLNTIIDCDKILVLSSGQVLE 1449
                        1450      1460
                  ....*....|....*....|....*.
gi 57526399  1425 YDSIQRMLSEK--SLFR--QAISPAD 1446
Cdd:PLN03232 1450 YDSPQELLSRDtsAFFRmvHSTGPAN 1475
PLN03130 PLN03130
ABC transporter C family member; Provisional
5-1438 1.38e-134

ABC transporter C family member; Provisional


Pssm-ID: 215595 [Multi-domain]  Cd Length: 1622  Bit Score: 454.97  E-value: 1.38e-134
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399     5 PLEKASVVSKLFFSWTRPILKKGYRQRLELSDIYHISSSDSADNLSEKLEREWDRELaSKKNPKLINALRRCFFWRFMFY 84
Cdd:PLN03130  228 PERHANIFSRIFFGWMTPLMQLGYKRPLTEKDVWKLDTWDQTETLYRSFQKCWDEEL-KKPKPWLLRALNNSLGGRFWLG 306
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399    85 GIILYLGEVTKAVQPLLLGRIIASYDPDNKVER----SIAIYLGIGLCLLF-------IVRTlllhpaifglhhiGMQMR 153
Cdd:PLN03130  307 GFFKIGNDLSQFVGPLLLNLLLESMQNGEPAWIgyiyAFSIFVGVVLGVLCeaqyfqnVMRV-------------GFRLR 373
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399   154 IAMFSLIYKKTLKLSSRVLDKISIGQLVSLLSNNLNKFDEGLALAHFVWIAPLQVTLLMGLLWDLLQAFTFCGLAFLVVL 233
Cdd:PLN03130  374 STLVAAVFRKSLRLTHEGRKKFTSGKITNLMTTDAEALQQICQQLHTLWSAPFRIIIAMVLLYQQLGVASLIGSLMLVLM 453
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399   234 ALLQAGLGKMMMKYRDQRAGKINERLVITSEMIENIQSVKAYCWEEAMEKIIENLRQTELKLTRKAAYVRYLNSSAFFFS 313
Cdd:PLN03130  454 FPIQTFIISKMQKLTKEGLQRTDKRIGLMNEVLAAMDTVKCYAWENSFQSKVQTVRDDELSWFRKAQLLSAFNSFILNSI 533
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399   314 GFFVVFLSVLPYALLKGIIL-RKIFTTISFCIVLRMAVTrQFPWAVQTWYDSLGAINKIQDFLQKQEY-----KTLEYNL 387
Cdd:PLN03130  534 PVLVTVVSFGVFTLLGGDLTpARAFTSLSLFAVLRFPLF-MLPNLITQAVNANVSLKRLEELLLAEERvllpnPPLEPGL 612
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399   388 TTtdVVMENVTAFWEegfSKLfEKakennnnrkisncdtslffsnlllgtPVLKDISFKIERGQLLAVAGSTGAGKTSLL 467
Cdd:PLN03130  613 PA--ISIKNGYFSWD---SKA-ER--------------------------PTLSNINLDVPVGSLVAIVGSTGEGKTSLI 660
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399   468 MMIMGELEP-SEGKIKHSGRISFCSQYSWIMPGTIKDNIIFGVSYDEYRYRSVIKACQLEEDISKFSEKDNIVLGEGGIT 546
Cdd:PLN03130  661 SAMLGELPPrSDASVVIRGTVAYVPQVSWIFNATVRDNILFGSPFDPERYERAIDVTALQHDLDLLPGGDLTEIGERGVN 740
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399   547 LSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSVYFY 626
Cdd:PLN03130  741 ISGGQKQRVSMARAVYSNSDVYIFDDPLSALDAHVGRQVFDKCIKDELRGKTRVLVTNQLHFLSQVDRIILVHEGMIKEE 820
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399   627 GTFSELQNQRPDFSsKLMgcdtfdqftaERRNSiitetLRRFSLEGDTSVSWNETKKPsfKQTGEFGEKRKNSILNSiNS 706
Cdd:PLN03130  821 GTYEELSNNGPLFQ-KLM----------ENAGK-----MEEYVEENGEEEDDQTSSKP--VANGNANNLKKDSSSKK-KS 881
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399   707 IRKFSVVQKTSLQMNGIdgASDEPLERRlslvphsepgegilprSNAvnsgptfLGGRrQSVLNLMTCSSvnqgqsihrk 786
Cdd:PLN03130  882 KEGKSVLIKQEERETGV--VSWKVLERY----------------KNA-------LGGA-WVVMILFLCYV---------- 925
                         810       820       830       840       850       860       870       880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399   787 tatstrkmslapqasLAEIdiysRRLSQDTGLeiSEEINEEDLRDcffddvenipavttwntylryitvHKSLMFVLIWC 866
Cdd:PLN03130  926 ---------------LTEV----FRVSSSTWL--SEWTDQGTPKT------------------------HGPLFYNLIYA 960
                         890       900       910       920       930       940       950       960
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399   867 LVVFlvevaaslvvlclfpkillqdkGNSTKNASNSYAVIITSTSSyyifyiyvgvadtllalglfrglplvhtlitvSK 946
Cdd:PLN03130  961 LLSF----------------------GQVLVTLLNSYWLIMSSLYA--------------------------------AK 986
                         970       980       990      1000      1010      1020      1030      1040
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399   947 TLHHKMLQSVLQAPMSTLNTLKTGGILNRFSKDIAVLDDLLPLTIFDFI----QLL--LIVIGAVVVVSvlqpyiFLATV 1020
Cdd:PLN03130  987 RLHDAMLGSILRAPMSFFHTNPLGRIINRFAKDLGDIDRNVAVFVNMFLgqifQLLstFVLIGIVSTIS------LWAIM 1060
                        1050      1060      1070      1080      1090      1100      1110      1120
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399  1021 PVIAAFILLRGYFLHTSQQLKQLESEGRSPIFTHLVTSLKGLWTLRAFGRQPYFETLFHKALNLHTANWFLYLSTLRWFQ 1100
Cdd:PLN03130 1061 PLLVLFYGAYLYYQSTAREVKRLDSITRSPVYAQFGEALNGLSTIRAYKAYDRMAEINGRSMDNNIRFTLVNMSSNRWLA 1140
                        1130      1140      1150      1160      1170      1180      1190      1200
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399  1101 MRIEMI--FVIFFIAvTFiSILTTGEGEGRV------GIILTLAMNIMGTLQWAVNSSIDVDSLMRSVSRVFKFIDMPTE 1172
Cdd:PLN03130 1141 IRLETLggLMIWLTA-SF-AVMQNGRAENQAafastmGLLLSYALNITSLLTAVLRLASLAENSLNAVERVGTYIDLPSE 1218
                        1210      1220      1230      1240      1250      1260      1270      1280
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399  1173 dgKPnnsfrpskdsqpskvMIIENQhvKKDDIWPSGGQMTVKDLTAKYIDGGNAILENISFSISPGQRVGLLGRTGSGKS 1252
Cdd:PLN03130 1219 --AP---------------LVIENN--RPPPGWPSSGSIKFEDVVLRYRPELPPVLHGLSFEISPSEKVGIVGRTGAGKS 1279
                        1290      1300      1310      1320      1330      1340      1350      1360
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399  1253 TLLLAFLRLLN-TKGEIQIDGVSWDSITLQQWRKAFGVIPQKVFIFSGTFRKNLDPYEQWSDQEIWKVADEVGLRSVIEQ 1331
Cdd:PLN03130 1280 SMLNALFRIVElERGRILIDGCDISKFGLMDLRKVLGIIPQAPVLFSGTVRFNLDPFNEHNDADLWESLERAHLKDVIRR 1359
                        1370      1380      1390      1400      1410      1420      1430      1440
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399  1332 FPGKLDFVLVDGGCVLSHGHKQLMCLARSVLSKAKILLLDEPSAHLDPITYQIIRRTLKQAFADCTVILSEHRIEAMLEC 1411
Cdd:PLN03130 1360 NSLGLDAEVSEAGENFSVGQRQLLSLARALLRRSKILVLDEATAAVDVRTDALIQKTIREEFKSCTMLIIAHRLNTIIDC 1439
                        1450      1460
                  ....*....|....*....|....*...
gi 57526399  1412 QRFLVIEENKVRQYDSIQRMLS-EKSLF 1438
Cdd:PLN03130 1440 DRILVLDAGRVVEFDTPENLLSnEGSAF 1467
CFTR_R pfam14396
Cystic fibrosis TM conductance regulator (CFTR), regulator domain;
638-849 2.89e-120

Cystic fibrosis TM conductance regulator (CFTR), regulator domain;


Pssm-ID: 316884  Cd Length: 213  Bit Score: 374.44  E-value: 2.89e-120
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399    638 DFSSKLMGCDTFDQFTAERRNSIITETLRRFSLEGDTSVSWNETKKPSFKQTGEFGEKRKNS-ILNSINSIRKFSVVQKT 716
Cdd:pfam14396    1 DFSSLLMGLEAFDNFSAERRNSILTETLRRFSVDGDAGGSRNEPKKQSFKQTGDFGEKRKNSvILNPLNSSRKFSIIQKS 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399    717 SLQMNGIDGASDEPLERRLSLVPHSEPGEGILPRSNAVNSGPTFLGGRRQSVLNLMTcSSVNQGQSIHRKTATSTRKMSL 796
Cdd:pfam14396   81 PLQMNGIEEGLDEPPERRLSLVPESEQGEAALPRSNVLNTGPTLQGQRRQSVLNLMT-NTVAQGQNRREKGQSSFRKMSV 159
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|....
gi 57526399    797 APQASLA-EIDIYSRRLSQDTGLEISEEINEEDLRDCFFDDVENIPAVTTWNTY 849
Cdd:pfam14396  160 VPQSNLAsELDIYARRLSKDSVLDITEEINEEDLKECFADDIENVFETTTWNTY 213
ABC_6TM_CFTR_D1 cd18594
Six-transmembrane helical domain 1 of Cystic Fibrosis Transmembrane Conductance Regulator; ...
83-372 1.15e-119

Six-transmembrane helical domain 1 of Cystic Fibrosis Transmembrane Conductance Regulator; This group represents the six-transmembrane domain 1 (TMD1) of the cystic fibrosis transmembrane conductance regulator (CFTR, ABCC7), which belongs to the ABCC subfamily. CFTR functions as a chloride channel, in contrast to other ABC transporters, and controls ion and water secretion and absorption in epithelial tissues. ABC proteins are formed from two homologous halves each containing a transmembrane domain (TMD) and a cytosolic nucleotide binding domain (NBD). In CFTR, these two TMD-NBD halves are linked by the unique regulatory (R) domain, which is not present in other ABC transporters. The ion channel only opens when its R-domain is phosphorylated by cyclic AMP-dependent protein kinase (PKA) and ATP is bound at the NBDs. Mutations in CFTR cause cystic fibrosis, the most common lethal genetic disorder in populations of Northern European descent.


Pssm-ID: 350038 [Multi-domain]  Cd Length: 291  Bit Score: 375.82  E-value: 1.15e-119
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399   83 FYGIILYLGEVTKAVQPLLLGRIIASYDPDNKVERSIAIYLGIGLCLLFIVRTLLLHPAIFGLHHIGMQMRIAMFSLIYK 162
Cdd:cd18594    1 LLGILLFLEESLKIVQPLLLGRLVAYFVPDSTVTKTEAYLYALGLSLCAFLRVLLHHPYFFGLHRYGMQLRIALSSLIYK 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399  163 KTLKLSSRVLDKISIGQLVSLLSNNLNKFDEGLALAHFVWIAPLQVTLLMGLLWDLLQAFTFCGLAFLVVLALLQAGLGK 242
Cdd:cd18594   81 KTLKLSSSALSKITTGHIVNLLSNDVQKFDEVLVYLHFLWIAPLQVIVLTGLLWREIGPSSLAGLGVLLLLLPLQAYLGK 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399  243 MMMKYRDQRAGKINERLVITSEMIENIQSVKAYCWEEAMEKIIENLRQTELKLTRKAAYVRYLNSSAFFFSGFFVVFLSV 322
Cdd:cd18594  161 LFAKYRRKTAGLTDERVKIMNEIISGMRVIKMYTWEESFAKLIENIRKKELKLIRKAAYIRAFNMAFFFFSPTLVSFATF 240
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|.
gi 57526399  323 LPYALLKGII-LRKIFTTISFCIVLRMAVTRQFPWAVQTWYDSLGAINKIQ 372
Cdd:cd18594  241 VPYVLTGNTLtARKVFTVISLLNALRMTITRFFPESIQTLSESRVSLKRIQ 291
PTZ00243 PTZ00243
ABC transporter; Provisional
69-1439 8.50e-117

ABC transporter; Provisional


Pssm-ID: 240327 [Multi-domain]  Cd Length: 1560  Bit Score: 403.01  E-value: 8.50e-117
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399    69 LINALRRCFFWRFMFygiiLYLGEVTKAVQPLLLGRIIASYDPDNKVERSiaiylGIGLCLLFIVRTLLLHPAIFGLHHI 148
Cdd:PTZ00243  238 LFAALPYYVWWQIPF----KLLSDVCTLTLPVLLKYFVKFLDADNATWGR-----GLGLVLTLFLTQLIQSVCLHRFYYI 308
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399   149 ----GMQMRIAMFSLIYKKTLKLSSRVLDK--ISIGQLVSLLSNNLNKFDEGLALAHFVWIAPLQVTLLMGLLWDLLQAF 222
Cdd:PTZ00243  309 sircGLQYRSALNALIFEKCFTISSKSLAQpdMNTGRIINMMSTDVERINSFMQYCMYLWSSPMVLLLSILLLSRLVGWC 388
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399   223 TFCGLAFLVVLALLQAGLGKMMMKYRDQRAGKINERLVITSEMIENIQSVKAYCWEEAMEKIIENLRQTELKLTRKAAYV 302
Cdd:PTZ00243  389 ALMAVAVLLVTLPLNGAIMKHQMAARRKIAKAADARVKATNEFFSGIRIAKFMAWEPCFVANIEDKRARELRYLRDVQLA 468
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399   303 RYLNSSAFFFSGFFVVFLSVLPYALLkGIILRK--IFTTISFCIVLRMAVtRQFPWAVQTWYDSLGAINKIQDFLQ---- 376
Cdd:PTZ00243  469 RVATSFVNNATPTLMIAVVFTVYYLL-GHELTPevVFPTIALLGVLRMPF-FMIPWVFTTVLQFLVSIKRISTFLEcdna 546
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399   377 -------KQEYKTLEYNLTTT---DVVMEN--VTAFW------------------------------------------- 401
Cdd:PTZ00243  547 tcstvqdMEEYWREQREHSTAcqlAAVLENvdVTAFVpvklprapkvktsllsralrmlcceqcrptkrhpspsvvvedt 626
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399   402 -------------EEGFSKLFEKAKENNNNRKISNCDTSLFFSnlLLGTPVLKDISFKIERGQLLAVAGSTGAGKTSLLM 468
Cdd:PTZ00243  627 dygspssasrhivEGGTGGGHEATPTSERSAKTPKMKTDDFFE--LEPKVLLRDVSVSVPRGKLTVVLGATGSGKSTLLQ 704
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399   469 MIMGELEPSEGKIKHSGRISFCSQYSWIMPGTIKDNIIFGVSYDEYRYRSVIKACQLEEDISKFSEKDNIVLGEGGITLS 548
Cdd:PTZ00243  705 SLLSQFEISEGRVWAERSIAYVPQQAWIMNATVRGNILFFDEEDAARLADAVRVSQLEADLAQLGGGLETEIGEKGVNLS 784
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399   549 GGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSVYFYGT 628
Cdd:PTZ00243  785 GGQKARVSLARAVYANRDVYLLDDPLSALDAHVGERVVEECFLGALAGKTRVLATHQVHVVPRADYVVALGDGRVEFSGS 864
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399   629 FSelqnqrpDFssklMGCDTFDQFTAERRNSiitetlrrfslegdtsvswnetkkpsfkqtgefgEKRKNSILNsinsir 708
Cdd:PTZ00243  865 SA-------DF----MRTSLYATLAAELKEN----------------------------------KDSKEGDAD------ 893
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399   709 kfsvvqktslqmngidgASDEPLERRLSLVPHSEPGEGiLPRSNAVNSGPTflggrrqsvlnlmtcssvnqgqsihRKTA 788
Cdd:PTZ00243  894 -----------------AEVAEVDAAPGGAVDHEPPVA-KQEGNAEGGDGA-------------------------ALDA 930
                         810       820       830       840       850       860       870       880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399   789 TSTRKMSLAPQASlaeidiysrrlsqdtgleiseeineedlrdcffddvENIPavttWNTYLRYITVHKSLMFVLIWCLV 868
Cdd:PTZ00243  931 AAGRLMTREEKAS------------------------------------GSVP----WSTYVAYLRFCGGLHAAGFVLAT 970
                         890       900       910       920       930       940       950       960
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399   869 VFLVEV--AASLVVLCLFpkillqdkgnSTKNASnsyaviiTSTSSYYIFYIYVGVADTLlalglfrGLPL-----VHTL 941
Cdd:PTZ00243  971 FAVTELvtVSSGVWLSMW----------STRSFK-------LSAATYLYVYLGIVLLGTF-------SVPLrfflsYEAM 1026
                         970       980       990      1000      1010      1020      1030      1040
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399   942 ITVSKTLHHKMLQSVLQAPMSTLNTLKTGGILNRFSKDIAVLDDLLPLTIFDFIQLLLIVIGAVVVVSVLQPYIFLATVP 1021
Cdd:PTZ00243 1027 RRGSRNMHRDLLRSVSRGTMSFFDTTPLGRILNRFSRDIDILDNTLPMSYLYLLQCLFSICSSILVTSASQPFVLVALVP 1106
                        1050      1060      1070      1080      1090      1100      1110      1120
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399  1022 VIAAFILLRGYFLHTSQQLKQLESEGRSPIFTHLVTSLKGLWTLRAFGRQpyfETLFHKALN----LHTANwFLYLSTLR 1097
Cdd:PTZ00243 1107 CGYLYYRLMQFYNSANREIRRIKSVAKSPVFTLLEEALQGSATITAYGKA---HLVMQEALRrldvVYSCS-YLENVANR 1182
                        1130      1140      1150      1160      1170      1180      1190      1200
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399  1098 WFQMRIEMIFVIFFIAVTFISILTTGEGEGR--VGII---LTLAMNIMGTLQWAVNSSIDVDSLMRSVSRVFKFID---- 1168
Cdd:PTZ00243 1183 WLGVRVEFLSNIVVTVIALIGVIGTMLRATSqeIGLVslsLTMAMQTTATLNWLVRQVATVEADMNSVERLLYYTDevph 1262
                        1210      1220      1230      1240      1250      1260      1270      1280
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399  1169 --MPTEDGKPNNSFRPSKDSQP-SKVMIIENQHVKKDDIWP-SGGQMTVKDLTAKYIDGGNAILENISFSISPGQRVGLL 1244
Cdd:PTZ00243 1263 edMPELDEEVDALERRTGMAADvTGTVVIEPASPTSAAPHPvQAGSLVFEGVQMRYREGLPLVLRGVSFRIAPREKVGIV 1342
                        1290      1300      1310      1320      1330      1340      1350      1360
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399  1245 GRTGSGKSTLLLAFLRLLNT-KGEIQIDGVSWDSITLQQWRKAFGVIPQKVFIFSGTFRKNLDPYEQWSDQEIWKVADEV 1323
Cdd:PTZ00243 1343 GRTGSGKSTLLLTFMRMVEVcGGEIRVNGREIGAYGLRELRRQFSMIPQDPVLFDGTVRQNVDPFLEASSAEVWAALELV 1422
                        1370      1380      1390      1400      1410      1420      1430      1440
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399  1324 GLRSVIEQFPGKLDFVLVDGGCVLSHGHKQLMCLARSVLSK-AKILLLDEPSAHLDPITYQIIRRTLKQAFADCTVILSE 1402
Cdd:PTZ00243 1423 GLRERVASESEGIDSRVLEGGSNYSVGQRQLMCMARALLKKgSGFILMDEATANIDPALDRQIQATVMSAFSAYTVITIA 1502
                        1450      1460      1470
                  ....*....|....*....|....*....|....*...
gi 57526399  1403 HRIEAMLECQRFLVIEENKVRQYDSIQRM-LSEKSLFR 1439
Cdd:PTZ00243 1503 HRLHTVAQYDKIIVMDHGAVAEMGSPRELvMNRQSIFH 1540
ABCC_MRP_domain1 cd03250
ATP-binding cassette domain 1 of multidrug resistance-associated protein, subfamily C; This ...
392-622 2.77e-94

ATP-binding cassette domain 1 of multidrug resistance-associated protein, subfamily C; This subfamily is also known as MRP (multidrug resistance-associated protein). Some of the MRP members have five additional transmembrane segments in their N-terminus, but the function of these additional membrane-spanning domains is not clear. The MRP was found in the multidrug-resisting lung cancer cell in which p-glycoprotein was not overexpressed. MRP exports glutathione by drug stimulation, as well as, certain substrates in conjugated forms with anions, such as glutathione, glucuronate, and sulfate.


Pssm-ID: 213217 [Multi-domain]  Cd Length: 204  Bit Score: 302.08  E-value: 2.77e-94
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399  392 VVMENVTAFWEEGFSKlfekakennnnrkisncdtslffsnlllGTPVLKDISFKIERGQLLAVAGSTGAGKTSLLMMIM 471
Cdd:cd03250    1 ISVEDASFTWDSGEQE----------------------------TSFTLKDINLEVPKGELVAIVGPVGSGKSSLLSALL 52
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399  472 GELEPSEGKIKHSGRISFCSQYSWIMPGTIKDNIIFGVSYDEYRYRSVIKACQLEEDISKFSEKDNIVLGEGGITLSGGQ 551
Cdd:cd03250   53 GELEKLSGSVSVPGSIAYVSQEPWIQNGTIRENILFGKPFDEERYEKVIKACALEPDLEILPDGDLTEIGEKGINLSGGQ 132
                        170       180       190       200       210       220       230
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 57526399  552 RARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCK-LMANKTRILVTSKMEHLKKADKILILHEGS 622
Cdd:cd03250  133 KQRISLARAVYSDADIYLLDDPLSAVDAHVGRHIFENCILGlLLNNKTRILVTHQLQLLPHADQIVVLDNGR 204
ABCC_MRP_domain2 cd03244
ATP-binding cassette domain 2 of multidrug resistance-associated protein; The ABC subfamily C ...
1209-1427 1.34e-86

ATP-binding cassette domain 2 of multidrug resistance-associated protein; The ABC subfamily C is also known as MRP (multidrug resistance-associated protein). Some of the MRP members have five additional transmembrane segments in their N-terminus, but the function of these additional membrane-spanning domains is not clear. The MRP was found in the multidrug-resistance lung cancer cell in which p-glycoprotein was not overexpressed. MRP exports glutathione by drug stimulation, as well as, certain substrates in conjugated forms with anions, such as glutathione, glucuronate, and sulfate.


Pssm-ID: 213211 [Multi-domain]  Cd Length: 221  Bit Score: 281.30  E-value: 1.34e-86
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399 1209 GQMTVKDLTAKYIDGGNAILENISFSISPGQRVGLLGRTGSGKSTLLLAFL-RLLNTKGEIQIDGVSWDSITLQQWRKAF 1287
Cdd:cd03244    1 GDIEFKNVSLRYRPNLPPVLKNISFSIKPGEKVGIVGRTGSGKSSLLLALFrLVELSSGSILIDGVDISKIGLHDLRSRI 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399 1288 GVIPQKVFIFSGTFRKNLDPYEQWSDQEIWKVADEVGLRSVIEQFPGKLDFVLVDGGCVLSHGHKQLMCLARSVLSKAKI 1367
Cdd:cd03244   81 SIIPQDPVLFSGTIRSNLDPFGEYSDEELWQALERVGLKEFVESLPGGLDTVVEEGGENLSVGQRQLLCLARALLRKSKI 160
                        170       180       190       200       210       220
                 ....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399 1368 LLLDEPSAHLDPITYQIIRRTLKQAFADCTVILSEHRIEAMLECQRFLVIEENKVRQYDS 1427
Cdd:cd03244  161 LVLDEATASVDPETDALIQKTIREAFKDCTVLTIAHRLDTIIDSDRILVLDKGRVVEFDS 220
ABC_6TM_MRP4_D2_like cd18601
Six-transmembrane helical domain 2 (TMD2) of multidrug resistance-associated protein 4 (MRP4) ...
895-1163 6.82e-80

Six-transmembrane helical domain 2 (TMD2) of multidrug resistance-associated protein 4 (MRP4) and similar proteins; This group represents the six-transmembrane domain 2 (TMD2) of multidrug resistance-associated protein 4 (MRP4), which belongs to the subfamily C of the ATP-binding cassette (ABC) transporter superfamily. The MRP subfamily (ABCC subfamily) is composed of 13 members, of which MRP1 to MRP9 are the major transporters that cause multidrug resistance in tumor cells by pumping anticancer drugs out of the cell. These nine MRP members function as ATP-dependent exporters for endogenous substances and xenobiotics. MRP family can be divided into two groups, depending on their structural architecture. MRP4, MRP5, MRP8, and MRP9 (ABCC4, 5, 11 and 12, respectively) have a typical ABC transporter structure and each composed of two transmembrane domains (TMD1 and TMD2) and two nucleotide domains (NBD1 and NBD2). On the other hand, MRP1, 2, 3, 6 and 7 (ABCC1, 2, 3, 6 and 7, respectively) have an additional N-terminal five transmembrane segments in a single domain (TMD0) connected to the core (TMD-NBD) by a cytoplasmic linker (L0).


Pssm-ID: 350045 [Multi-domain]  Cd Length: 314  Bit Score: 266.11  E-value: 6.82e-80
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399  895 STKNASNSYAVIITSTSSYYIFYIYVGVADTLLALGLFRGLPLVHTLITVSKTLHHKMLQSVLQAPMSTLNTLKTGGILN 974
Cdd:cd18601   41 DRVQGENSTNVDIEDLDRDFNLGIYAGLTAATFVFGFLRSLLFFHVAVSASKNLHNKMFASVLRAPIRFFDTNPIGRILN 120
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399  975 RFSKDIAVLDDLLPLTIFDFIQLLLIVIGAVVVVSVLQPYIFLATVPVIAAFILLRGYFLHTSQQLKQLESEGRSPIFTH 1054
Cdd:cd18601  121 RFSKDIGHLDDLLPLTFLDFLQLLLQVVGVVLLAVVVNPWVLIPVIPLVILFLFLRRYYLKTSREVKRIEGTTRSPVFSH 200
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399 1055 LVTSLKGLWTLRAFGRQPYFETLFHKALNLHTANWFLYLSTLRWFQMRIEMIFVIFFIAVTFISI-LTTGEGEGRVGIIL 1133
Cdd:cd18601  201 LSSTLQGLWTIRAYSAQERFQEEFDAHQDLHSEAWFLFLATSRWLAVRLDALCALFVTVVAFGSLfLAESLDAGLVGLSL 280
                        250       260       270
                 ....*....|....*....|....*....|
gi 57526399 1134 TLAMNIMGTLQWAVNSSIDVDSLMRSVSRV 1163
Cdd:cd18601  281 SYALTLMGTFQWCVRQSAEVENLMTSVERV 310
ABC_6TM_ABCC_D2 cd18580
Six-transmembrane helical domain 2 (TMD2) of the ABC transporters, subfamily C; This group ...
865-1167 5.07e-74

Six-transmembrane helical domain 2 (TMD2) of the ABC transporters, subfamily C; This group represents the six-transmembrane domain 2 (TMD2) of the ABC transporters that belong to the ABCC subfamily, such as the sulphonylurea receptors SUR1/2 (ABCC8), the cystic fibrosis transmembrane conductance regulator (CFTR, ABCC7), Multidrug-Resistance associated Proteins (MRP1-9), VMR1 (vacuolar multidrug resistance protein 1), and YOR1 (yeast oligomycin resistance transporter protein). This TM subunit exhibits the type 3 ATP-binding cassette (ABC) exporter fold, which is characterized by 6 TM helices per subunit (domain), or a total of 12 TM helices for the complete transporter. The type 3 ABC exporters are found in both prokaryotes and eukaryotes, where they mediate the cellular secretion of toxic compounds, a various type of lipids and polypeptides. All ABC transporters share a common architecture of two transmembrane domains (TMDs) and two nucleotide-binding domains (NBDs). The two NBDs together bind and hydrolyze ATP, thereby providing the driving force for transport, while the TMDs participate in substrate recognition and translocation across the lipid membrane by alternating between inward- and outward-facing conformations. By contrast, bacterial ABC exporters are typically assembled from dimers of TMD-NBD half-transporters. Thus, most bacterial ABC transporters are comprised of two identical TMDs and two identical NBDs.


Pssm-ID: 350024 [Multi-domain]  Cd Length: 294  Bit Score: 248.19  E-value: 5.07e-74
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399  865 WCLVVFLVevaASLVVLCLFPKILLqdkgnstKNASNSYAVIITSTSSYYIFYIYVGVADTLLALGLFRGLPLVHTLITV 944
Cdd:cd18580    1 VLLLLLLL---LLLAFLSQFSNIWL-------DWWSSDWSSSPNSSSGYYLGVYAALLVLASVLLVLLRWLLFVLAGLRA 70
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399  945 SKTLHHKMLQSVLQAPMSTLNTLKTGGILNRFSKDIAVLDDLLPLTIFDFIQLLLIVIGAVVVVSVLQPYIFLATVPVIA 1024
Cdd:cd18580   71 SRRLHDKLLRSVLRAPMSFFDTTPSGRILNRFSKDIGLIDEELPLALLDFLQSLFSVLGSLIVIAIVSPYFLIVLPPLLV 150
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399 1025 AFILLRGYFLHTSQQLKQLESEGRSPIFTHLVTSLKGLWTLRAFGRQPYFETLFHKALNLHTANWFLYLSTLRWFQMRIE 1104
Cdd:cd18580  151 VYYLLQRYYLRTSRQLRRLESESRSPLYSHFSETLSGLSTIRAFGWQERFIEENLRLLDASQRAFYLLLAVQRWLGLRLD 230
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 57526399 1105 MIFVIFFIAVTFISILTTGE-GEGRVGIILTLAMNIMGTLQWAVNSSIDVDSLMRSVSRVFKFI 1167
Cdd:cd18580  231 LLGALLALVVALLAVLLRSSiSAGLVGLALTYALSLTGSLQWLVRQWTELETSMVSVERILEYT 294
MdlB COG1132
ABC-type multidrug transport system, ATPase and permease component [Defense mechanisms];
863-1440 1.54e-68

ABC-type multidrug transport system, ATPase and permease component [Defense mechanisms];


Pssm-ID: 224055 [Multi-domain]  Cd Length: 567  Bit Score: 241.95  E-value: 1.54e-68
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399  863 LIWCLVVFLVEVAASLVVLCLFPKILlqDKGNSTKNASNSYAVIItstssyyiFYIYVGVAdtllALGLFRGLPLVHTLI 942
Cdd:COG1132   16 LLLAILLLLLSALLSLLLPLLIGRII--DALLADLGELLELLLLL--------LLLALLGG----VLRALQSYLGSRLGQ 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399  943 TVSKTLHHKMLQSVLQAPMSTLNTLKTGGILNRFSKDIAVLDDLLPLTIFDFIQLLLIVIGAVVVVSVLQPYIFLATVPV 1022
Cdd:COG1132   82 KIVADLRRDLFEKLLRLPLSFFDKAKSGDLISRLTNDVEAVSNLVSTVLVLVFTSILLLIGSLVLLFSLSWRLALILLLI 161
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399 1023 IAAFILLRGYFLHTSQQLKQLESEGRSPIFTHLVTSLKGLWTLRAFGRQPYFETLFHKALNLHTANWFLYLSTLRWFQMR 1102
Cdd:COG1132  162 LPLLALVLSLLARKSRKLSRRVREALGELNARLLESLSGIRVIKAFGAEDRELKRFEEANEELRRANLRASRLEALLAPL 241
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399 1103 IEMIFVIFFIAVTFISILTTGEGE---GRVGIILTLAMNIMGTLQWAVNSSIDVDSLMRSVSRVFKFIDMPTEdgkpnns 1179
Cdd:COG1132  242 MLLLSSLGTVLVLALGGFLVLSGSltvGALAAFILYLLRLLTPILQLGEVVSLLQRASAAAERLFELLDEEPE------- 314
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399 1180 frpskdsqpskvmiIENQHVKKddiWPSGGQMTVKDLTAKYiDGGNAILENISFSISPGQRVGLLGRTGSGKSTLLLA-F 1258
Cdd:COG1132  315 --------------VEDPPDPL---KDTIGSIEFENVSFSY-PGKKPVLKDISFSIEPGEKVAIVGPSGSGKSTLIKLlL 376
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399 1259 LRLLNTKGEIQIDGVSWDSITLQQWRKAFGVIPQKVFIFSGTFRKNLDPYEQW-SDQEIWKVADEVGLRSVIEQFPGKLD 1337
Cdd:COG1132  377 RLYDPTSGEILIDGIDIRDISLDSLRKRIGIVSQDPLLFSGTIRENIALGRPDaTDEEIEEALKLANAHEFIANLPDGYD 456
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399 1338 FVLVDGGCVLSHGHKQLMCLARSVLSKAKILLLDEPSAHLDPITYQIIRRTLKQAFADCTVILSEHRIEAMLECQRFLVI 1417
Cdd:COG1132  457 TIVGERGVNLSGGQRQRLAIARALLRNPPILILDEATSALDTETEALIQDALKKLLKGRTTLIIAHRLSTIKNADRIIVL 536
                        570       580
                 ....*....|....*....|...
gi 57526399 1418 EENKVRQYDSIQRMLSEKSLFRQ 1440
Cdd:COG1132  537 DNGRIVERGTHEELLAKGGLYAR 559
ABC_6TM_MRP4_D1_like cd18593
Six-transmembrane helical domain 1 (TMD1) of multidrug resistance-associated protein 4 (MRP4) ...
83-371 5.57e-57

Six-transmembrane helical domain 1 (TMD1) of multidrug resistance-associated protein 4 (MRP4) and similar proteins; This group represents the six-transmembrane domain 1 (TMD1) of multidrug resistance-associated protein 4 (MRP4), which belongs to the subfamily C of the ATP-binding cassette (ABC) transporter superfamily. The MRP subfamily (ABCC subfamily) is composed of 13 members, of which MRP1 to MRP9 are the major transporters that cause multidrug resistance in tumor cells by pumping anticancer drugs out of the cell. These nine MRP members function as ATP-dependent exporters for endogenous substances and xenobiotics. MRP family can be divided into two groups, depending on their structural architecture. MRP4, MRP5, MRP8, and MRP9 (ABCC4, 5, 11 and 12, respectively) have a typical ABC transporter structure and each composed of two transmembrane domains (TMD1 and TMD2) and two nucleotide domains (NBD1 and NBD2). On the other hand, MRP1, 2, 3, 6 and 7 (ABCC1, 2, 3, 6 and 7, respectively) have an additional N-terminal five transmembrane segments in a single domain (TMD0) connected to the core (TMD-NBD) by a cytoplasmic linker (L0).


Pssm-ID: 350037 [Multi-domain]  Cd Length: 291  Bit Score: 199.37  E-value: 5.57e-57
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399   83 FYGIILYLGEVTKAVQPLLLGRIIASYDPDNK-VERSIAIYLGIGLCLLFIVRTLLLHPAIFGLHHIGMQMRIAMFSLIY 161
Cdd:cd18593    1 LLGIFLFLEEAIRVVQPIFLGKLIRYFEGNGSsISLTEAYLYAGGVSLCSFLFIITHHPYFFGMQRIGMRLRVACSSLIY 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399  162 KKTLKLSSRVLDKISIGQLVSLLSNNLNKFDEGLALAHFVWIAPLQVTLLMGLLWDLLQAFTFCGLAFLVVLALLQAGLG 241
Cdd:cd18593   81 RKALRLSQAALGKTTVGQIVNLLSNDVNRFDQAVLFLHYLWVAPLQLIAVIYILWFEIGWSCLAGLAVLLILIPLQSFFG 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399  242 KMMMKYRDQRAGKINERLVITSEMIENIQSVKAYCWEEAMEKIIENLRQTELKLTRKAAYVRYLNSSAFFFSGFFVVFLS 321
Cdd:cd18593  161 KLFSKLRRKTAARTDKRIRIMNEIINGIRVIKMYAWEKAFAKLVDDLRRKEIKKVRRTSFLRALNMGLFFVSSKLILFLT 240
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|.
gi 57526399  322 VLPYALLKGIIL-RKIFTTISFCIVLRMAVTRQFPWAVQTWYDSLGAINKI 371
Cdd:cd18593  241 FLAYILLGNILTaERVFVTMALYNAVRLTMTLFFPFAIQFGSELSVSIRRI 291
MdlB COG1132
ABC-type multidrug transport system, ATPase and permease component [Defense mechanisms];
78-640 3.48e-54

ABC-type multidrug transport system, ATPase and permease component [Defense mechanisms];


Pssm-ID: 224055 [Multi-domain]  Cd Length: 567  Bit Score: 199.58  E-value: 3.48e-54
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399   78 FWRFMFYGIILYLGEVTKAVQPLLLGRIIASYDPDNKVERSIAIYLGIGLCLLFIVRTLllhpAIFGLHHIGMQMRIAMF 157
Cdd:COG1132   13 YKLLLLAILLLLLSALLSLLLPLLIGRIIDALLADLGELLELLLLLLLLALLGGVLRAL----QSYLGSRLGQKIVADLR 88
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399  158 SLIYKKTLKLSSRVLDKISIGQLVSLLSNNLNKFDEGLA-LAHFVWIAPLQVTLLMGLLWDLLQAFTFCGLAFLVVLALL 236
Cdd:COG1132   89 RDLFEKLLRLPLSFFDKAKSGDLISRLTNDVEAVSNLVStVLVLVFTSILLLIGSLVLLFSLSWRLALILLLILPLLALV 168
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399  237 QAGLGKMMMKYRDQRAGKINERLVITSEMIENIQSVKAYCWEEAMEKIIENLRQTELKLTRKAAYVRYLNSSAFFFSGF- 315
Cdd:COG1132  169 LSLLARKSRKLSRRVREALGELNARLLESLSGIRVIKAFGAEDRELKRFEEANEELRRANLRASRLEALLAPLMLLLSSl 248
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399  316 -FVVFLSVLPYALLKGII-LRKIFTTISFCIVLRMAVtRQFPWAVQTWYDSLGAINKIQDFLQKQEYKTLEYNLTTT--- 390
Cdd:COG1132  249 gTVLVLALGGFLVLSGSLtVGALAAFILYLLRLLTPI-LQLGEVVSLLQRASAAAERLFELLDEEPEVEDPPDPLKDtig 327
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399  391 DVVMENVTAFWEEGfsklfekakennnnrkisncdtslffsnlllgTPVLKDISFKIERGQLLAVAGSTGAGKTSLLMMI 470
Cdd:COG1132  328 SIEFENVSFSYPGK--------------------------------KPVLKDISFSIEPGEKVAIVGPSGSGKSTLIKLL 375
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399  471 MGELEPSEGKIKHSG-------------RISFCSQYSWIMPGTIKDNIIFGVSY-DEYRYRSVIKACQLEEDISKFSEKD 536
Cdd:COG1132  376 LRLYDPTSGEILIDGidirdisldslrkRIGIVSQDPLLFSGTIRENIALGRPDaTDEEIEEALKLANAHEFIANLPDGY 455
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399  537 NIVLGEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFEScVCKLMANKTRILVTSKMEHLKKADKIL 616
Cdd:COG1132  456 DTIVGERGVNLSGGQRQRLAIARALLRNPPILILDEATSALDTETEALIQDA-LKKLLKGRTTLIIAHRLSTIKNADRII 534
                        570       580
                 ....*....|....*....|....
gi 57526399  617 ILHEGSVYFYGTFSELQNQRPDFS 640
Cdd:COG1132  535 VLDNGRIVERGTHEELLAKGGLYA 558
ABC_6TM_ABCC_D1 cd18579
Six-transmembrane helical domain 1 (TMD1) of the ABC transporters, subfamily C; This group ...
85-371 7.91e-54

Six-transmembrane helical domain 1 (TMD1) of the ABC transporters, subfamily C; This group represents the six-transmembrane domain 1 (TMD1)of the ABC transporters that belong to the ABCC subfamily, such as the sulphonylurea receptors SUR1/2 (ABCC8), the cystic fibrosis transmembrane conductance regulator (CFTR, ABCC7), Multidrug-Resistance associated Proteins (MRP1-9), VMR1 (vacuolar multidrug resistance protein 1), and YOR1 (yeast oligomycin resistance transporter protein). This TM subunit exhibits the type 3 ATP-binding cassette (ABC) exporter fold, which is characterized by 6 TM helices per subunit (domain), or a total of 12 TM helices for the complete transporter. The type 3 ABC exporters are found in both prokaryotes and eukaryotes, where they mediate the cellular secretion of toxic compounds, a various type of lipids and polypeptides. ABC transporters typically consist of two transmembrane domains (TMDs) and two nucleotide-binding domains (NBDs). The two NBDs together bind and hydrolyze ATP, thereby providing the driving force for transport, while the TMDs participate in substrate recognition and translocation across the lipid membrane by alternating between inward- and outward-facing conformations. By contrast, bacterial ABC exporters are typically assembled from dimers of TMD-NBD half-transporters. Thus, most bacterial ABC transporters are comprised of two identical TMDs and two identical NBDs.


Pssm-ID: 350023 [Multi-domain]  Cd Length: 289  Bit Score: 190.00  E-value: 7.91e-54
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399   85 GIILYLGEVTKAVQPLLLGRIIASYDPDNKVERSIAIYLGIGLCLLFIVRTLLLHPAIFGLHHIGMQMRIAMFSLIYKKT 164
Cdd:cd18579    3 GLLKLLEDLLSLAQPLLLGLLISYLSSYPDEPLSEGYLLALALFLVSLLQSLLLHQYFFLSFRLGMRVRSALSSLIYRKA 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399  165 LKLSSRVLDKISIGQLVSLLSNNLNKFDEGLALAHFVWIAPLQVTLLMGLLWDLLQAFTFCGLAFLVVLALLQAGLGKMM 244
Cdd:cd18579   83 LRLSSSARQETSTGEIVNLMSVDVQRIEDFFLFLHYLWSAPLQIIVALYLLYRLLGWAALAGLGVLLLLIPLQAFLAKLI 162
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399  245 MKYRDQRAGKINERLVITSEMIENIQSVKAYCWEEAMEKIIENLRQTELKLTRKAAYVRYLNSSAFFFSGFFVVFLSVLP 324
Cdd:cd18579  163 SKLRKKLMKATDERVKLTNEILSGIKVIKLYAWEKPFLKRIEELRKKELKALRKFGYLRALNSFLFFSTPVLVSLATFAT 242
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*...
gi 57526399  325 YALLKGII-LRKIFTTISFCIVLRMaVTRQFPWAVQTWYDSLGAINKI 371
Cdd:cd18579  243 YVLLGNPLtAAKVFTALSLFNLLRF-PLLMLPQAISSLIEALVSLKRI 289
ABCC_NFT1 cd03369
ATP-binding cassette domain 2 of NFT1, subfamily C; Domain 2 of NFT1 (New full-length MRP-type ...
1205-1427 2.39e-53

ATP-binding cassette domain 2 of NFT1, subfamily C; Domain 2 of NFT1 (New full-length MRP-type transporter 1). NFT1 belongs to the MRP (multidrug resistance-associated protein) family of ABC transporters. Some of the MRP members have five additional transmembrane segments in their N-terminus, but the function of these additional membrane-spanning domains is not clear. The MRP was found in the multidrug-resisting lung cancer cell in which p-glycoprotein was not overexpressed. MRP exports glutathione by drug stimulation, as well as, certain substrates in conjugated forms with anions such as glutathione, glucuronate, and sulfate.


Pssm-ID: 213269 [Multi-domain]  Cd Length: 207  Bit Score: 185.69  E-value: 2.39e-53
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399 1205 WPSGGQMTVKDLTAKYIDGGNAILENISFSISPGQRVGLLGRTGSGKSTLLLAFLRLLN-TKGEIQIDGVSWDSITLQQW 1283
Cdd:cd03369    1 WPEHGEIEVENLSVRYAPDLPPVLKNVSFKVKAGEKIGIVGRTGAGKSTLILALFRFLEaEEGKIEIDGIDISTIPLEDL 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399 1284 RKAFGVIPQKVFIFSGTFRKNLDPYEQWSDQEIWKVadevgLRsvieqfpgkldfvLVDGGCVLSHGHKQLMCLARSVLS 1363
Cdd:cd03369   81 RSSLTIIPQDPTLFSGTIRSNLDPFDEYSDEEIYGA-----LR-------------VSEGGLNLSQGQRQLLCLARALLK 142
                        170       180       190       200       210       220
                 ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 57526399 1364 KAKILLLDEPSAHLDPITYQIIRRTLKQAFADCTVILSEHRIEAMLECQRFLVIEENKVRQYDS 1427
Cdd:cd03369  143 RPRVLVLDEATASIDYATDALIQKTIREEFTNSTILTIAHRLRTIIDYDKILVMDAGEVKEYDH 206
SunT COG2274
ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase ...
927-1444 1.15e-52

ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms];


Pssm-ID: 225183 [Multi-domain]  Cd Length: 709  Bit Score: 198.22  E-value: 1.15e-52
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399  927 LALGLFRGLPLVHTLITVSKTLHHKMLQSVLQAPMSTLNTLKTGGILNRFSKDIAVLDDLLPLTIFDFIQLLLIVIGAVV 1006
Cdd:COG2274  208 ALLRLLRTYLIAHLGKRLDLELSGRFFRHLLRLPLSYFEKRSVGEIISRVRELEQIREFLTGSILTLIIDLLFALIFLAV 287
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399 1007 VVSvLQPYIFLATVPVIAAFILLRGYFLHTSQQL--KQLESEGRspIFTHLVTSLKGLWTLRAFGRQPYFETLFHKALNl 1084
Cdd:COG2274  288 MFL-YSWKLTLIVLAAIPLNVLITLIFQPLLRRKtrKLIEESAE--QQSFLVETIKGIETVKALAAEPRFRSQWDNRLA- 363
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399 1085 HTANWFLYLSTLR-WFQMRIEMIFVIFFIAVTFISILTTGEGEGRVGIIL---TLAMNIMGTLQWAVNSSIDVDSLMRSV 1160
Cdd:COG2274  364 KQVNIGFKTEKLAlILNTIKSLLQQLSSVLILWFGAILVLEGELTLGQLVafnMLAGYFISPITRLSQLWTDFQQAKVAL 443
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399 1161 SRVFKFIDMPTEDgkpnnsfrpSKDSQPSkvmiienqhvkkdDIWPSGGQMTVKDLTAKYIDGGNAILENISFSISPGQR 1240
Cdd:COG2274  444 ERLGDILDTPPEQ---------EGDKTLI-------------HLPKLQGEIEFENVSFRYGPDDPPVLEDLSLEIPPGEK 501
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399 1241 VGLLGRTGSGKSTLLLAFLRLLN-TKGEIQIDGVSWDSITLQQWRKAFGVIPQKVFIFSGTFRKNL---DPyeQWSDQEI 1316
Cdd:COG2274  502 VAIVGRSGSGKSTLLKLLLGLYKpQQGRILLDGVDLNDIDLASLRRQVGYVLQDPFLFSGSIRENIalgNP--EATDEEI 579
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399 1317 WKVADEVGLRSVIEQFPGKLDFVLVDGGCVLSHGHKQLMCLARSVLSKAKILLLDEPSAHLDPITYQIIRRTLKQAFADC 1396
Cdd:COG2274  580 IEAAQLAGAHEFIENLPMGYDTPVGEGGANLSGGQRQRLALARALLSKPKILLLDEATSALDPETEAIILQNLLQILQGR 659
                        490       500       510       520
                 ....*....|....*....|....*....|....*....|....*...
gi 57526399 1397 TVILSEHRIEAMLECQRFLVIEENKVRQYDSIQRMLSEKSLFRQAISP 1444
Cdd:COG2274  660 TVIIIAHRLSTIRSADRIIVLDQGKIVEQGSHEELLAQGGLYARLYQQ 707
ABC_6TM_VMR1_D2_like cd18604
Six-transmembrane helical domain 2 (TMD2) of the yeast Vmr1p, Ybt1p and Nft1; ABCC subfamily; ...
900-1163 6.23e-49

Six-transmembrane helical domain 2 (TMD2) of the yeast Vmr1p, Ybt1p and Nft1; ABCC subfamily; This group includes the six-transmembrane domain 2 (TMD2) of the yeast Vmr1p, Ybt1p and Nft1, all of which are ABC transporters of the MRP (multidrug resistance-associated protein) subfamily (ABCC). Yeast ABCC (also termed MRP/CFTR) subfamily includes six members (Ycf1p, Bpt1p, Ybt1p/Bat1p, Nft1p, Vmr1p, and Yor1p), of which three members (Ycf1p, Bpt1P and Yor1p) are not included here. While Yor1p, an oligomycin resistance ABC transporter, has been shown to localize to the plasma membrane, the other 4 members (Ycf1p, Bpt1p, Ybt1p/Bat1p, Nft1p and Vmr1p) have been shown to localize to the vacuolar membrane. Ybt1p is originally identified as a bile acid transporter and regulates membrane fusion through Ca2+ transport modulation. Ybt1p also plays a part in ade2 pigment transport. Moreover, Ybt1p has been recently shown to translocate phosphatidylcholine from the outer leaflet of the vacuole to the inner leaflet for degradation and choline recycling. Vmr1p, a vacuolar membrane protein, participates in the export of numerous growth inhibitors from the cell, such as cycloheximide, 2,4-dinitrophenole, cadmium and other toxic metals. Nft1p is not well-characterized, but it is proposed to be regulate Ycf1p, which is involved in heavy metal detoxification.


Pssm-ID: 350048 [Multi-domain]  Cd Length: 297  Bit Score: 176.12  E-value: 6.23e-49
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399  900 SNSYAVIITSTSS-----YYIfYIYVGVADTLLALGLFRGLPLVHTLITVSKTLHHKMLQSVLQAPMSTLNTLKTGGILN 974
Cdd:cd18604   26 ASAYETSSALPPSevsvlYYL-GIYALISLLSVLLGTLRYLLFFFGSLRASRKLHERLLHSVLRAPLRWLDTTPVGRILN 104
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399  975 RFSKDIAVLDDLLPLTIFDFIQLLLIVIGAVVVVSVLQPYIFLATVPVIAAFILLRGYFLHTSQQLKQLESEGRSPIFTH 1054
Cdd:cd18604  105 RFSKDIETIDSELADSLSSLLESTLSLLVILIAIVVVSPAFLLPAVVLAALYVYIGRLYLRASRELKRLESVARSPILSH 184
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399 1055 LVTSLKGLWTLRAFGRQPYFETLFHKALNLHTANWFLYLSTLRWFQMRIEMIFVIFFIAVTFISILTTGEGEGRVGIILT 1134
Cdd:cd18604  185 FGETLAGLVTIRAFGAEERFIEEMLRRIDRYSRAFRYLWNLNRWLSVRIDLLGALFSFATAALLVYGPGIDAGLAGFSLS 264
                        250       260
                 ....*....|....*....|....*....
gi 57526399 1135 LAMNIMGTLQWAVNSSIDVDSLMRSVSRV 1163
Cdd:cd18604  265 FALGFSSAILWLVRSYNELELDMNSVERI 293
ABC_6TM_YOR1_D2_like cd18606
Six-transmembrane helical domain 2 (TMD2) of the yeast Yor1p and similar proteins; ABCC ...
909-1163 4.63e-48

Six-transmembrane helical domain 2 (TMD2) of the yeast Yor1p and similar proteins; ABCC subfamily; This group includes the six-transmembrane domain 1 (TMD1) of the yeast Yor1p, an oligomycin resistance ABC transporter, and similar proteins. Members of this group belong to the MRP (multidrug resistance-associated protein) subfamily (ABCC). In addition to Yor1p, yeast ABCC (also termed MRP/CFTR) subfamily also comprises five other members (Ycf1p, Bpt1p, Ybt1p/Bat1p, Nft1p, and Vmr1p), which are not included in this group. Yor1p is a plasma membrane ATP-binding transporter that mediates export of many different organic anions including oligomycin. While Yor1p has been shown to localize to the plasma membrane, the other 4 members (Ycf1p, Bpt1p, Ybt1p/Bat1p, Nft1p and Vmr1p) have been shown to localize to the vacuolar membrane.


Pssm-ID: 350050 [Multi-domain]  Cd Length: 290  Bit Score: 173.43  E-value: 4.63e-48
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399  909 STSSYYIFYIYVGVADTLLALGLFrgLPLVHTLITVSKTLHHKMLQSVLQAPMSTLNTLKTGGILNRFSKDIAVLDDLLP 988
Cdd:cd18606   33 SQGFYIGIYAGLGVLQAIFLFLFG--LLLAYLGIRASKRLHNKALKRVLRAPMSFFDTTPLGRILNRFSKDTDVLDNELP 110
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57526399  989 LTIFDFIQLLLIVIGAVVVVSVLQPYIFLATVPVIAAFILLRGYFLHTSQQLKQLESEGRSPIFTHLVTSLKGLWTLRAF 1068
Cdd:cd18606  111 DSLRMFLYTLSSIIGTFILIIIYLPWFAIALPPLLVLYYFIANYYRASSRELKRLESILRSFVYANFSESLSGLST