NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|85701434|ref|NP_001012658|]
View 

CRS4C-6 precursor [Mus musculus]

Protein Classification

Defensin_propep domain-containing protein (domain architecture ID 10467841)

Defensin_propep domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Defensin_propep pfam00879
Defensin propeptide;
1-51 8.45e-11

Defensin propeptide;


:

Pssm-ID: 395707  Cd Length: 51  Bit Score: 52.22  E-value: 8.45e-11
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|.
gi 85701434    1 MKTLVLLSALVLLAFYVQADSTQETDEETKTDDQPGEEDQGVSVSFEDPER 51
Cdd:pfam00879  1 MRTLALLAAILLVALQAQAEPLQARADEAPDQEQPGAEDQDVSISFAGDES 51
 
Name Accession Description Interval E-value
Defensin_propep pfam00879
Defensin propeptide;
1-51 8.45e-11

Defensin propeptide;


Pssm-ID: 395707  Cd Length: 51  Bit Score: 52.22  E-value: 8.45e-11
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|.
gi 85701434    1 MKTLVLLSALVLLAFYVQADSTQETDEETKTDDQPGEEDQGVSVSFEDPER 51
Cdd:pfam00879  1 MRTLALLAAILLVALQAQAEPLQARADEAPDQEQPGAEDQDVSISFAGDES 51
 
Name Accession Description Interval E-value
Defensin_propep pfam00879
Defensin propeptide;
1-51 8.45e-11

Defensin propeptide;


Pssm-ID: 395707  Cd Length: 51  Bit Score: 52.22  E-value: 8.45e-11
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|.
gi 85701434    1 MKTLVLLSALVLLAFYVQADSTQETDEETKTDDQPGEEDQGVSVSFEDPER 51
Cdd:pfam00879  1 MRTLALLAAILLVALQAQAEPLQARADEAPDQEQPGAEDQDVSISFAGDES 51
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH