NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|85702055|ref|NP_001028719|]
View 

coiled-coil domain-containing protein 185 [Mus musculus]

Protein Classification

coiled-coil domain-containing protein (domain architecture ID 12173875)

coiled-coil domain-containing protein similar to Homo sapiens coiled-coil domain-containing protein 177, a myelin proteolipid protein-like protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
DUF4659 pfam15558
Domain of unknown function (DUF4659); This family of proteins is found in eukaryotes. Proteins ...
239-618 5.50e-102

Domain of unknown function (DUF4659); This family of proteins is found in eukaryotes. Proteins in this family are typically between 427 and 674 amino acids in length. There are two completely conserved residues (D and I) that may be functionally important.


:

Pssm-ID: 406094 [Multi-domain]  Cd Length: 374  Bit Score: 314.64  E-value: 5.50e-102
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85702055   239 VISLRDQKILALVLSRLKKAQRMRELQQQAAVAWEELKRSDQKVHLTLERERKLLLLQSQEQWQGQREQHKPQRGHGHEQ 318
Cdd:pfam15558   1 VVPERDRKIAALMLARHQEEQLMRELQQQAALAWEELRRSDQKRQETLERERQLLLQQSQEQWQAQKEQRKARLSREERR 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85702055   319 phqgykqqgpRRDRQARSAVrsENESEWMVQADNPEIRGLAKMDKVQAQAEHLKQCQVQSLREQERVLQSVRDLNRLQLQ 398
Cdd:pfam15558  81 ----------RADRQEKQVI--LQEERWREQAEEQENRRQEKLERAAQEAEHKKQCQEQNLKEKEEELQALREQNSLQLQ 148
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85702055   399 KRLEIAGHKREHVMMESPKKLQESNLSTVVNFQARKVLMDCQAKAEELLRKLSLEQSSQSSQSYQdiqKGLVKEqRHREQ 478
Cdd:pfam15558 149 ERLEQACHKRQLKELEEQKKVQELNLSELVNHQALKVLVDCQAKAEELLRRLSLEQKLQRSQENY---EQLVEE-RHREL 224
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85702055   479 QAKAQTEAEQFQRRRWHAEEAEELLQVSKRVLAELAEQKSRQARSHAHKTTRDRAQHLQELNILRERNHHILKLTAEKEE 558
Cdd:pfam15558 225 REKAQKEEEQFQRAKWRAEESEEERQEHKEALAELAEQKIQQARQVAHKTVQDKAQRARELRLEKEKNHRLLKLKVEKEE 304
                         330       340       350       360       370       380       390
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85702055   559 KCHIKGIKEAIKKKEQRLAQMTSGKDPIFQEYQKGPASSKI----------NRCFDQVAAEPQLSVHLQS 618
Cdd:pfam15558 305 KCHREGIKEAIEKKEERSEQISREKEATLEEARKVARASFHmrekvreetnSRTFDKMALEAQLHASLQR 374
 
Name Accession Description Interval E-value
DUF4659 pfam15558
Domain of unknown function (DUF4659); This family of proteins is found in eukaryotes. Proteins ...
239-618 5.50e-102

Domain of unknown function (DUF4659); This family of proteins is found in eukaryotes. Proteins in this family are typically between 427 and 674 amino acids in length. There are two completely conserved residues (D and I) that may be functionally important.


Pssm-ID: 406094 [Multi-domain]  Cd Length: 374  Bit Score: 314.64  E-value: 5.50e-102
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85702055   239 VISLRDQKILALVLSRLKKAQRMRELQQQAAVAWEELKRSDQKVHLTLERERKLLLLQSQEQWQGQREQHKPQRGHGHEQ 318
Cdd:pfam15558   1 VVPERDRKIAALMLARHQEEQLMRELQQQAALAWEELRRSDQKRQETLERERQLLLQQSQEQWQAQKEQRKARLSREERR 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85702055   319 phqgykqqgpRRDRQARSAVrsENESEWMVQADNPEIRGLAKMDKVQAQAEHLKQCQVQSLREQERVLQSVRDLNRLQLQ 398
Cdd:pfam15558  81 ----------RADRQEKQVI--LQEERWREQAEEQENRRQEKLERAAQEAEHKKQCQEQNLKEKEEELQALREQNSLQLQ 148
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85702055   399 KRLEIAGHKREHVMMESPKKLQESNLSTVVNFQARKVLMDCQAKAEELLRKLSLEQSSQSSQSYQdiqKGLVKEqRHREQ 478
Cdd:pfam15558 149 ERLEQACHKRQLKELEEQKKVQELNLSELVNHQALKVLVDCQAKAEELLRRLSLEQKLQRSQENY---EQLVEE-RHREL 224
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85702055   479 QAKAQTEAEQFQRRRWHAEEAEELLQVSKRVLAELAEQKSRQARSHAHKTTRDRAQHLQELNILRERNHHILKLTAEKEE 558
Cdd:pfam15558 225 REKAQKEEEQFQRAKWRAEESEEERQEHKEALAELAEQKIQQARQVAHKTVQDKAQRARELRLEKEKNHRLLKLKVEKEE 304
                         330       340       350       360       370       380       390
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85702055   559 KCHIKGIKEAIKKKEQRLAQMTSGKDPIFQEYQKGPASSKI----------NRCFDQVAAEPQLSVHLQS 618
Cdd:pfam15558 305 KCHREGIKEAIEKKEERSEQISREKEATLEEARKVARASFHmrekvreetnSRTFDKMALEAQLHASLQR 374
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
243-578 8.83e-04

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274008 [Multi-domain]  Cd Length: 1179  Bit Score: 42.35  E-value: 8.83e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85702055    243 RDQKILALVLSRLKKAQRMRELQQQAAVAWEELKRSDQKVHLTLERERKLLLLQSQEQWQGQREQHKPQrghgheqphQG 322
Cdd:TIGR02168  675 RRREIEELEEKIEELEEKIAELEKALAELRKELEELEEELEQLRKELEELSRQISALRKDLARLEAEVE---------QL 745
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85702055    323 YKQQGPRRDRQARSAVRSENESEWMVQADNPEIRGLAKMDKVQAQAEHLKQcQVQSLREQERVLQS-VRDLNRLQLQKRL 401
Cdd:TIGR02168  746 EERIAQLSKELTELEAEIEELEERLEEAEEELAEAEAEIEELEAQIEQLKE-ELKALREALDELRAeLTLLNEEAANLRE 824
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85702055    402 EIAGHKREHVMMEspKKLQESNLSTVVNFQARKVLMDCQAKAEELLRKLSLEqssqssqsyqdiQKGLVKEQRHREQQAK 481
Cdd:TIGR02168  825 RLESLERRIAATE--RRLEDLEEQIEELSEDIESLAAEIEELEELIEELESE------------LEALLNERASLEEALA 890
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85702055    482 AQTEAEQfqrrrwhaEEAEELLQVSKRVLAelAEQKSRQARSHAHKTTRDRAQHLQELNILRERNHHILKLTAEKEEKCH 561
Cdd:TIGR02168  891 LLRSELE--------ELSEELRELESKRSE--LRRELEELREKLAQLELRLEGLEVRIDNLQERLSEEYSLTLEEAEALE 960
                          330
                   ....*....|....*..
gi 85702055    562 iKGIKEAIKKKEQRLAQ 578
Cdd:TIGR02168  961 -NKIEDDEEEARRRLKR 976
 
Name Accession Description Interval E-value
DUF4659 pfam15558
Domain of unknown function (DUF4659); This family of proteins is found in eukaryotes. Proteins ...
239-618 5.50e-102

Domain of unknown function (DUF4659); This family of proteins is found in eukaryotes. Proteins in this family are typically between 427 and 674 amino acids in length. There are two completely conserved residues (D and I) that may be functionally important.


Pssm-ID: 406094 [Multi-domain]  Cd Length: 374  Bit Score: 314.64  E-value: 5.50e-102
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85702055   239 VISLRDQKILALVLSRLKKAQRMRELQQQAAVAWEELKRSDQKVHLTLERERKLLLLQSQEQWQGQREQHKPQRGHGHEQ 318
Cdd:pfam15558   1 VVPERDRKIAALMLARHQEEQLMRELQQQAALAWEELRRSDQKRQETLERERQLLLQQSQEQWQAQKEQRKARLSREERR 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85702055   319 phqgykqqgpRRDRQARSAVrsENESEWMVQADNPEIRGLAKMDKVQAQAEHLKQCQVQSLREQERVLQSVRDLNRLQLQ 398
Cdd:pfam15558  81 ----------RADRQEKQVI--LQEERWREQAEEQENRRQEKLERAAQEAEHKKQCQEQNLKEKEEELQALREQNSLQLQ 148
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85702055   399 KRLEIAGHKREHVMMESPKKLQESNLSTVVNFQARKVLMDCQAKAEELLRKLSLEQSSQSSQSYQdiqKGLVKEqRHREQ 478
Cdd:pfam15558 149 ERLEQACHKRQLKELEEQKKVQELNLSELVNHQALKVLVDCQAKAEELLRRLSLEQKLQRSQENY---EQLVEE-RHREL 224
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85702055   479 QAKAQTEAEQFQRRRWHAEEAEELLQVSKRVLAELAEQKSRQARSHAHKTTRDRAQHLQELNILRERNHHILKLTAEKEE 558
Cdd:pfam15558 225 REKAQKEEEQFQRAKWRAEESEEERQEHKEALAELAEQKIQQARQVAHKTVQDKAQRARELRLEKEKNHRLLKLKVEKEE 304
                         330       340       350       360       370       380       390
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85702055   559 KCHIKGIKEAIKKKEQRLAQMTSGKDPIFQEYQKGPASSKI----------NRCFDQVAAEPQLSVHLQS 618
Cdd:pfam15558 305 KCHREGIKEAIEKKEERSEQISREKEATLEEARKVARASFHmrekvreetnSRTFDKMALEAQLHASLQR 374
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
243-578 8.83e-04

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274008 [Multi-domain]  Cd Length: 1179  Bit Score: 42.35  E-value: 8.83e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85702055    243 RDQKILALVLSRLKKAQRMRELQQQAAVAWEELKRSDQKVHLTLERERKLLLLQSQEQWQGQREQHKPQrghgheqphQG 322
Cdd:TIGR02168  675 RRREIEELEEKIEELEEKIAELEKALAELRKELEELEEELEQLRKELEELSRQISALRKDLARLEAEVE---------QL 745
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85702055    323 YKQQGPRRDRQARSAVRSENESEWMVQADNPEIRGLAKMDKVQAQAEHLKQcQVQSLREQERVLQS-VRDLNRLQLQKRL 401
Cdd:TIGR02168  746 EERIAQLSKELTELEAEIEELEERLEEAEEELAEAEAEIEELEAQIEQLKE-ELKALREALDELRAeLTLLNEEAANLRE 824
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85702055    402 EIAGHKREHVMMEspKKLQESNLSTVVNFQARKVLMDCQAKAEELLRKLSLEqssqssqsyqdiQKGLVKEQRHREQQAK 481
Cdd:TIGR02168  825 RLESLERRIAATE--RRLEDLEEQIEELSEDIESLAAEIEELEELIEELESE------------LEALLNERASLEEALA 890
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85702055    482 AQTEAEQfqrrrwhaEEAEELLQVSKRVLAelAEQKSRQARSHAHKTTRDRAQHLQELNILRERNHHILKLTAEKEEKCH 561
Cdd:TIGR02168  891 LLRSELE--------ELSEELRELESKRSE--LRRELEELREKLAQLELRLEGLEVRIDNLQERLSEEYSLTLEEAEALE 960
                          330
                   ....*....|....*..
gi 85702055    562 iKGIKEAIKKKEQRLAQ 578
Cdd:TIGR02168  961 -NKIEDDEEEARRRLKR 976
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH