NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|117414174|ref|NP_001070967|]
View 

sodium channel protein type 8 subunit alpha isoform 1 [Mus musculus]

Protein Classification

sodium channel protein subunit alpha (domain architecture ID 11999299)

sodium channel protein subunit alpha mediates the voltage-dependent sodium ion permeability of excitable membranes

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Na_trans_cytopl pfam11933
Cytoplasmic domain of voltage-gated Na+ ion channel; This is a large cytoplasmic domain ...
504-700 1.50e-90

Cytoplasmic domain of voltage-gated Na+ ion channel; This is a large cytoplasmic domain towards the start of voltage-dependent sodium ion channel proteins in eukaryotes. It is found closely associated with pfam06512 and pfam00520.


:

Pssm-ID: 403218  Cd Length: 205  Bit Score: 292.89  E-value: 1.50e-90
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117414174   504 SEGEEKGDPEKVFKSESEDGMRRKAFRLPDNRIGR--KFSIMNQSLLSIPGSPFLSRHNSKSSIFSFRGpgRFRDPGSEN 581
Cdd:pfam11933    1 SEGEEKGDDEKVPKSESEDSIRRKGFRFSVDRLAYkkKFSSPNQSLLSIPGSPFSPRRNSRGSIFSFRG--RGRDAGSEN 78
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117414174   582 EFADDEHSTVEESEGRRDSLFIPiRARERRssysgYSGYSQCSRSSRIFPSLRRSVKRNSTVDCNGVVSLIG----PGSH 657
Cdd:pfam11933   79 DFADDENSTFEDSESRRGSLFVP-RRHERR-----SSYTSQASRSSRSHPGLPQNGKRHSTVDCNGVVSLVGggpePTSP 152
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|...
gi 117414174   658 IGRLLPE----------ATTEVEIKKKGPGSLLVSMEQLASYGRKDRINSIMS 700
Cdd:pfam11933  153 GGLLLPEviidgsddgtTTTESEIRKKRSGSLQVSMDFLEEPGQRQRAVSAVS 205
Na_trans_assoc pfam06512
Sodium ion transport-associated; Members of this family contain a region found exclusively in ...
989-1190 1.17e-68

Sodium ion transport-associated; Members of this family contain a region found exclusively in eukaryotic sodium channels or their subunits, many of which are voltage-gated. Members very often also contain between one and four copies of pfam00520 and, less often, one copy of pfam00612.


:

Pssm-ID: 399489  Cd Length: 201  Bit Score: 229.94  E-value: 1.17e-68
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117414174   989 DGEMNNLQISVIRIKKGVAWAKVKVHAFMQAHF--KQREADEVKPLDELYE--KKANCIANHTGVdiHRNGDFQKNGngt 1064
Cdd:pfam06512    1 DGEMNNLQIALARIQRGIRFVKRTLRDFCCRLCllEPQKLPEKKPLDESKDasKKTNQIANHTSA--PKELKKAPGG--- 75
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117414174  1065 tsgigssveKYIIDEDHMSFINNPNLTVRVPIAVGESDFENLNTEDVSSE-SDPEGSKDKL-----DDTSSSEGSTIDIK 1138
Cdd:pfam06512   76 ---------KYGVDEDHMSFITNPNLTVCVPIAEGESDLENEEDEDESSQsSDEEKSKQQEqlqqvDDSSSSEGSTVDLT 146
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|....
gi 117414174  1139 PEVEEVPVEQPEE--YLDPDACFTEGCVQRFKCCQVNIEEGLGKSWWILRKTCF 1190
Cdd:pfam06512  147 DPEEELEQIPEEAedLKEPEDCFPEGCVRRFPCCAVDITKGPWKIWWNLRKTCY 200
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
1195-1471 5.63e-64

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


:

Pssm-ID: 395416 [Multi-domain]  Cd Length: 238  Bit Score: 217.91  E-value: 5.63e-64
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117414174  1195 HNWFETFIIFMILLSSGALAFEDIYIEQRKTIrTILEYADKVFTYIFILEMLLKWTAYGFVK-FFTNAWCWLDFLIVAVS 1273
Cdd:pfam00520    1 SRYFELFILLLILLNTIFLALETYFQPEEPLT-TVLEILDYVFTGIFTLEMLLKIIAAGFKKrYFRSPWNILDFVVVLPS 79
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117414174  1274 LVSLIANalGYSELGAIKSLRTLRALRPLRALSRFEGMRVVVNALVGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKYhy 1353
Cdd:pfam00520   80 LISLVLS--SVGSLSGLRVLRLLRLLRLLRLIRRLEGLRTLVNSLIRSLKSLGNLLLLLLLFLFIFAIIGYQLFGGKL-- 155
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117414174  1354 cfnetseirfeidevnnktdceklmegnNTEIRWKNVKINFDNVGAGYLALLQVATFKGWMDIMYAAVDSRkpdeqpdye 1433
Cdd:pfam00520  156 ----------------------------KTWENPDNGRTNFDNFPNAFLWLFQTMTTEGWGDIMYDTIDGK--------- 198
                          250       260       270
                   ....*....|....*....|....*....|....*...
gi 117414174  1434 GNIYMYIYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKK 1471
Cdd:pfam00520  199 GEFWAYIYFVSFIILGGFLLLNLFIAVIIDNFQELTER 236
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
1520-1774 2.88e-57

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


:

Pssm-ID: 395416 [Multi-domain]  Cd Length: 238  Bit Score: 198.65  E-value: 2.88e-57
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117414174  1520 QAFDIVIMMLICLNMVTMMVETDTQSKQ-MENILYWINLVFVIFFTCECVLKMFALR--HYYFTIGWNIFDFVVVILSIV 1596
Cdd:pfam00520    2 RYFELFILLLILLNTIFLALETYFQPEEpLTTVLEILDYVFTGIFTLEMLLKIIAAGfkKRYFRSPWNILDFVVVLPSLI 81
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117414174  1597 GMFLADIiekyfVSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIFSIFGMSNFAYV-- 1674
Cdd:pfam00520   82 SLVLSSV-----GSLSGLRVLRLLRLLRLLRLIRRLEGLRTLVNSLIRSLKSLGNLLLLLLLFLFIFAIIGYQLFGGKlk 156
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117414174  1675 KHEAGIDDMFNFETFGNSMICLFQITTSAGWDGLLLPILNRPPdcsldkehpgsgfkgdcgnPSVGIFFFVSYIIISFLI 1754
Cdd:pfam00520  157 TWENPDNGRTNFDNFPNAFLWLFQTMTTEGWGDIMYDTIDGKG-------------------EFWAYIYFVSFIILGGFL 217
                          250       260
                   ....*....|....*....|
gi 117414174  1755 VVNMYIAIILENFSVATEES 1774
Cdd:pfam00520  218 LLNLFIAVIIDNFQELTERT 237
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
750-963 3.23e-55

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


:

Pssm-ID: 395416 [Multi-domain]  Cd Length: 238  Bit Score: 192.87  E-value: 3.23e-55
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117414174   750 DPFVDLAITICIVLNTLFMAMEHHPMTPQ-FEHVLAVGNLVFTGIFTAEMFLKLIAMDP-YYYFQEGWNIFDGFIVSLSL 827
Cdd:pfam00520    1 SRYFELFILLLILLNTIFLALETYFQPEEpLTTVLEILDYVFTGIFTLEMLLKIIAAGFkKRYFRSPWNILDFVVVLPSL 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117414174   828 MELGLADVE---GLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYkecvc 904
Cdd:pfam00520   81 ISLVLSSVGslsGLRVLRLLRLLRLLRLIRRLEGLRTLVNSLIRSLKSLGNLLLLLLLFLFIFAIIGYQLFGGKL----- 155
                          170       180       190       200       210       220
                   ....*....|....*....|....*....|....*....|....*....|....*....|
gi 117414174   905 KISQECKLPRWHMNDFFHSFLIVFRVLCGE-WIETMWDCMEVAGQAMCLIVFMMVMVIGN 963
Cdd:pfam00520  156 KTWENPDNGRTNFDNFPNAFLWLFQTMTTEgWGDIMYDTIDGKGEFWAYIYFVSFIILGG 215
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
131-421 4.59e-50

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


:

Pssm-ID: 395416 [Multi-domain]  Cd Length: 238  Bit Score: 177.84  E-value: 4.59e-50
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117414174   131 HSVFSMIIMCTILTNCVFMTFSNPPE-------WSKNVEYTFTGIYTFESLVKIIARGFCidgFTFLRDPWNWLDFSVIM 203
Cdd:pfam00520    1 SRYFELFILLLILLNTIFLALETYFQpeeplttVLEILDYVFTGIFTLEMLLKIIAAGFK---KRYFRSPWNILDFVVVL 77
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117414174   204 MAYIT----EFVNLGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRN 279
Cdd:pfam00520   78 PSLISlvlsSVGSLSGLRVLRLLRLLRLLRLIRRLEGLRTLVNSLIRSLKSLGNLLLLLLLFLFIFAIIGYQLFGGKLKT 157
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117414174   280 kcvvwpinfnesylengtrgfdweeyinnktnfymvpgmlepllcgnssdagqcpegfqcmkaGRNPNYGYTSFDTFSWA 359
Cdd:pfam00520  158 ---------------------------------------------------------------WENPDNGRTNFDNFPNA 174
                          250       260       270       280       290       300
                   ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 117414174   360 FLALFRLMTQDYWENLYQLTLRAAGKTYM-IFFVLVIFVGSFYLVNLILAVVAMAYEEQNQAT 421
Cdd:pfam00520  175 FLWLFQTMTTEGWGDIMYDTIDGKGEFWAyIYFVSFIILGGFLLLNLFIAVIIDNFQELTERT 237
Na_channel_gate cd13433
Inactivation gate of the voltage-gated sodium channel alpha subunits; This region is part of ...
1463-1515 3.14e-31

Inactivation gate of the voltage-gated sodium channel alpha subunits; This region is part of the intracellular linker between domains III and IV of the alpha subunits of voltage-gated sodium channels. It is responsible for fast inactivation of the channel and essential for proper physiological function.


:

Pssm-ID: 240441  Cd Length: 54  Bit Score: 116.90  E-value: 3.14e-31
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....
gi 117414174 1463 DNFNQQKKKFGG-QDIFMTEEQKKYYNAMKKLGSKKPQKPIPRPLNKIQGIVFD 1515
Cdd:cd13433     1 DNFNQLKKKYGGgLDIFLTESQKKYYNAMKKLGSKKPQKPIPRPKNKFQGFIFD 54
IQ smart00015
Calmodulin-binding motif; Short calmodulin-binding motif containing conserved Ile and Gln ...
1892-1913 1.43e-03

Calmodulin-binding motif; Short calmodulin-binding motif containing conserved Ile and Gln residues.


:

Pssm-ID: 197470  Cd Length: 23  Bit Score: 37.69  E-value: 1.43e-03
                            10        20
                    ....*....|....*....|..
gi 117414174   1892 QEEVSAVVLQRAYRGHLARRGF 1913
Cdd:smart00015    1 RLTRAAIIIQAAWRGYLARKRY 22
GPHH super family cl25190
Voltage-dependent L-type calcium channel, IQ-associated; GPHH is a sequence motif found in ...
1786-1833 4.76e-03

Voltage-dependent L-type calcium channel, IQ-associated; GPHH is a sequence motif found in this short domain on voltage-dependent L-type calcium channel proteins in eukaryotes. The domain is closely associated with the IQ-domain, pfam08763.


The actual alignment was detected with superfamily member pfam16905:

Pssm-ID: 407139  Cd Length: 54  Bit Score: 36.86  E-value: 4.76e-03
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|...
gi 117414174  1786 FYEIWEKFDPDATQFIEYCKLADFADALEHPLRVPK--PNTI---ELIAMDLP 1833
Cdd:pfam16905    2 FVRIWAEYDPAATGRISYQDMYELLRRISPPLGFGKkcPARVaykRLVRMNMP 54
 
Name Accession Description Interval E-value
Na_trans_cytopl pfam11933
Cytoplasmic domain of voltage-gated Na+ ion channel; This is a large cytoplasmic domain ...
504-700 1.50e-90

Cytoplasmic domain of voltage-gated Na+ ion channel; This is a large cytoplasmic domain towards the start of voltage-dependent sodium ion channel proteins in eukaryotes. It is found closely associated with pfam06512 and pfam00520.


Pssm-ID: 403218  Cd Length: 205  Bit Score: 292.89  E-value: 1.50e-90
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117414174   504 SEGEEKGDPEKVFKSESEDGMRRKAFRLPDNRIGR--KFSIMNQSLLSIPGSPFLSRHNSKSSIFSFRGpgRFRDPGSEN 581
Cdd:pfam11933    1 SEGEEKGDDEKVPKSESEDSIRRKGFRFSVDRLAYkkKFSSPNQSLLSIPGSPFSPRRNSRGSIFSFRG--RGRDAGSEN 78
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117414174   582 EFADDEHSTVEESEGRRDSLFIPiRARERRssysgYSGYSQCSRSSRIFPSLRRSVKRNSTVDCNGVVSLIG----PGSH 657
Cdd:pfam11933   79 DFADDENSTFEDSESRRGSLFVP-RRHERR-----SSYTSQASRSSRSHPGLPQNGKRHSTVDCNGVVSLVGggpePTSP 152
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|...
gi 117414174   658 IGRLLPE----------ATTEVEIKKKGPGSLLVSMEQLASYGRKDRINSIMS 700
Cdd:pfam11933  153 GGLLLPEviidgsddgtTTTESEIRKKRSGSLQVSMDFLEEPGQRQRAVSAVS 205
Na_trans_assoc pfam06512
Sodium ion transport-associated; Members of this family contain a region found exclusively in ...
989-1190 1.17e-68

Sodium ion transport-associated; Members of this family contain a region found exclusively in eukaryotic sodium channels or their subunits, many of which are voltage-gated. Members very often also contain between one and four copies of pfam00520 and, less often, one copy of pfam00612.


Pssm-ID: 399489  Cd Length: 201  Bit Score: 229.94  E-value: 1.17e-68
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117414174   989 DGEMNNLQISVIRIKKGVAWAKVKVHAFMQAHF--KQREADEVKPLDELYE--KKANCIANHTGVdiHRNGDFQKNGngt 1064
Cdd:pfam06512    1 DGEMNNLQIALARIQRGIRFVKRTLRDFCCRLCllEPQKLPEKKPLDESKDasKKTNQIANHTSA--PKELKKAPGG--- 75
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117414174  1065 tsgigssveKYIIDEDHMSFINNPNLTVRVPIAVGESDFENLNTEDVSSE-SDPEGSKDKL-----DDTSSSEGSTIDIK 1138
Cdd:pfam06512   76 ---------KYGVDEDHMSFITNPNLTVCVPIAEGESDLENEEDEDESSQsSDEEKSKQQEqlqqvDDSSSSEGSTVDLT 146
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|....
gi 117414174  1139 PEVEEVPVEQPEE--YLDPDACFTEGCVQRFKCCQVNIEEGLGKSWWILRKTCF 1190
Cdd:pfam06512  147 DPEEELEQIPEEAedLKEPEDCFPEGCVRRFPCCAVDITKGPWKIWWNLRKTCY 200
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
1195-1471 5.63e-64

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


Pssm-ID: 395416 [Multi-domain]  Cd Length: 238  Bit Score: 217.91  E-value: 5.63e-64
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117414174  1195 HNWFETFIIFMILLSSGALAFEDIYIEQRKTIrTILEYADKVFTYIFILEMLLKWTAYGFVK-FFTNAWCWLDFLIVAVS 1273
Cdd:pfam00520    1 SRYFELFILLLILLNTIFLALETYFQPEEPLT-TVLEILDYVFTGIFTLEMLLKIIAAGFKKrYFRSPWNILDFVVVLPS 79
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117414174  1274 LVSLIANalGYSELGAIKSLRTLRALRPLRALSRFEGMRVVVNALVGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKYhy 1353
Cdd:pfam00520   80 LISLVLS--SVGSLSGLRVLRLLRLLRLLRLIRRLEGLRTLVNSLIRSLKSLGNLLLLLLLFLFIFAIIGYQLFGGKL-- 155
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117414174  1354 cfnetseirfeidevnnktdceklmegnNTEIRWKNVKINFDNVGAGYLALLQVATFKGWMDIMYAAVDSRkpdeqpdye 1433
Cdd:pfam00520  156 ----------------------------KTWENPDNGRTNFDNFPNAFLWLFQTMTTEGWGDIMYDTIDGK--------- 198
                          250       260       270
                   ....*....|....*....|....*....|....*...
gi 117414174  1434 GNIYMYIYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKK 1471
Cdd:pfam00520  199 GEFWAYIYFVSFIILGGFLLLNLFIAVIIDNFQELTER 236
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
1520-1774 2.88e-57

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


Pssm-ID: 395416 [Multi-domain]  Cd Length: 238  Bit Score: 198.65  E-value: 2.88e-57
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117414174  1520 QAFDIVIMMLICLNMVTMMVETDTQSKQ-MENILYWINLVFVIFFTCECVLKMFALR--HYYFTIGWNIFDFVVVILSIV 1596
Cdd:pfam00520    2 RYFELFILLLILLNTIFLALETYFQPEEpLTTVLEILDYVFTGIFTLEMLLKIIAAGfkKRYFRSPWNILDFVVVLPSLI 81
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117414174  1597 GMFLADIiekyfVSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIFSIFGMSNFAYV-- 1674
Cdd:pfam00520   82 SLVLSSV-----GSLSGLRVLRLLRLLRLLRLIRRLEGLRTLVNSLIRSLKSLGNLLLLLLLFLFIFAIIGYQLFGGKlk 156
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117414174  1675 KHEAGIDDMFNFETFGNSMICLFQITTSAGWDGLLLPILNRPPdcsldkehpgsgfkgdcgnPSVGIFFFVSYIIISFLI 1754
Cdd:pfam00520  157 TWENPDNGRTNFDNFPNAFLWLFQTMTTEGWGDIMYDTIDGKG-------------------EFWAYIYFVSFIILGGFL 217
                          250       260
                   ....*....|....*....|
gi 117414174  1755 VVNMYIAIILENFSVATEES 1774
Cdd:pfam00520  218 LLNLFIAVIIDNFQELTERT 237
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
750-963 3.23e-55

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


Pssm-ID: 395416 [Multi-domain]  Cd Length: 238  Bit Score: 192.87  E-value: 3.23e-55
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117414174   750 DPFVDLAITICIVLNTLFMAMEHHPMTPQ-FEHVLAVGNLVFTGIFTAEMFLKLIAMDP-YYYFQEGWNIFDGFIVSLSL 827
Cdd:pfam00520    1 SRYFELFILLLILLNTIFLALETYFQPEEpLTTVLEILDYVFTGIFTLEMLLKIIAAGFkKRYFRSPWNILDFVVVLPSL 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117414174   828 MELGLADVE---GLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYkecvc 904
Cdd:pfam00520   81 ISLVLSSVGslsGLRVLRLLRLLRLLRLIRRLEGLRTLVNSLIRSLKSLGNLLLLLLLFLFIFAIIGYQLFGGKL----- 155
                          170       180       190       200       210       220
                   ....*....|....*....|....*....|....*....|....*....|....*....|
gi 117414174   905 KISQECKLPRWHMNDFFHSFLIVFRVLCGE-WIETMWDCMEVAGQAMCLIVFMMVMVIGN 963
Cdd:pfam00520  156 KTWENPDNGRTNFDNFPNAFLWLFQTMTTEgWGDIMYDTIDGKGEFWAYIYFVSFIILGG 215
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
131-421 4.59e-50

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


Pssm-ID: 395416 [Multi-domain]  Cd Length: 238  Bit Score: 177.84  E-value: 4.59e-50
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117414174   131 HSVFSMIIMCTILTNCVFMTFSNPPE-------WSKNVEYTFTGIYTFESLVKIIARGFCidgFTFLRDPWNWLDFSVIM 203
Cdd:pfam00520    1 SRYFELFILLLILLNTIFLALETYFQpeeplttVLEILDYVFTGIFTLEMLLKIIAAGFK---KRYFRSPWNILDFVVVL 77
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117414174   204 MAYIT----EFVNLGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRN 279
Cdd:pfam00520   78 PSLISlvlsSVGSLSGLRVLRLLRLLRLLRLIRRLEGLRTLVNSLIRSLKSLGNLLLLLLLFLFIFAIIGYQLFGGKLKT 157
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117414174   280 kcvvwpinfnesylengtrgfdweeyinnktnfymvpgmlepllcgnssdagqcpegfqcmkaGRNPNYGYTSFDTFSWA 359
Cdd:pfam00520  158 ---------------------------------------------------------------WENPDNGRTNFDNFPNA 174
                          250       260       270       280       290       300
                   ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 117414174   360 FLALFRLMTQDYWENLYQLTLRAAGKTYM-IFFVLVIFVGSFYLVNLILAVVAMAYEEQNQAT 421
Cdd:pfam00520  175 FLWLFQTMTTEGWGDIMYDTIDGKGEFWAyIYFVSFIILGGFLLLNLFIAVIIDNFQELTERT 237
Na_channel_gate cd13433
Inactivation gate of the voltage-gated sodium channel alpha subunits; This region is part of ...
1463-1515 3.14e-31

Inactivation gate of the voltage-gated sodium channel alpha subunits; This region is part of the intracellular linker between domains III and IV of the alpha subunits of voltage-gated sodium channels. It is responsible for fast inactivation of the channel and essential for proper physiological function.


Pssm-ID: 240441  Cd Length: 54  Bit Score: 116.90  E-value: 3.14e-31
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....
gi 117414174 1463 DNFNQQKKKFGG-QDIFMTEEQKKYYNAMKKLGSKKPQKPIPRPLNKIQGIVFD 1515
Cdd:cd13433     1 DNFNQLKKKYGGgLDIFLTESQKKYYNAMKKLGSKKPQKPIPRPKNKFQGFIFD 54
IQ smart00015
Calmodulin-binding motif; Short calmodulin-binding motif containing conserved Ile and Gln ...
1892-1913 1.43e-03

Calmodulin-binding motif; Short calmodulin-binding motif containing conserved Ile and Gln residues.


Pssm-ID: 197470  Cd Length: 23  Bit Score: 37.69  E-value: 1.43e-03
                            10        20
                    ....*....|....*....|..
gi 117414174   1892 QEEVSAVVLQRAYRGHLARRGF 1913
Cdd:smart00015    1 RLTRAAIIIQAAWRGYLARKRY 22
GPHH pfam16905
Voltage-dependent L-type calcium channel, IQ-associated; GPHH is a sequence motif found in ...
1786-1833 4.76e-03

Voltage-dependent L-type calcium channel, IQ-associated; GPHH is a sequence motif found in this short domain on voltage-dependent L-type calcium channel proteins in eukaryotes. The domain is closely associated with the IQ-domain, pfam08763.


Pssm-ID: 407139  Cd Length: 54  Bit Score: 36.86  E-value: 4.76e-03
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|...
gi 117414174  1786 FYEIWEKFDPDATQFIEYCKLADFADALEHPLRVPK--PNTI---ELIAMDLP 1833
Cdd:pfam16905    2 FVRIWAEYDPAATGRISYQDMYELLRRISPPLGFGKkcPARVaykRLVRMNMP 54
 
Name Accession Description Interval E-value
Na_trans_cytopl pfam11933
Cytoplasmic domain of voltage-gated Na+ ion channel; This is a large cytoplasmic domain ...
504-700 1.50e-90

Cytoplasmic domain of voltage-gated Na+ ion channel; This is a large cytoplasmic domain towards the start of voltage-dependent sodium ion channel proteins in eukaryotes. It is found closely associated with pfam06512 and pfam00520.


Pssm-ID: 403218  Cd Length: 205  Bit Score: 292.89  E-value: 1.50e-90
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117414174   504 SEGEEKGDPEKVFKSESEDGMRRKAFRLPDNRIGR--KFSIMNQSLLSIPGSPFLSRHNSKSSIFSFRGpgRFRDPGSEN 581
Cdd:pfam11933    1 SEGEEKGDDEKVPKSESEDSIRRKGFRFSVDRLAYkkKFSSPNQSLLSIPGSPFSPRRNSRGSIFSFRG--RGRDAGSEN 78
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117414174   582 EFADDEHSTVEESEGRRDSLFIPiRARERRssysgYSGYSQCSRSSRIFPSLRRSVKRNSTVDCNGVVSLIG----PGSH 657
Cdd:pfam11933   79 DFADDENSTFEDSESRRGSLFVP-RRHERR-----SSYTSQASRSSRSHPGLPQNGKRHSTVDCNGVVSLVGggpePTSP 152
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|...
gi 117414174   658 IGRLLPE----------ATTEVEIKKKGPGSLLVSMEQLASYGRKDRINSIMS 700
Cdd:pfam11933  153 GGLLLPEviidgsddgtTTTESEIRKKRSGSLQVSMDFLEEPGQRQRAVSAVS 205
Na_trans_assoc pfam06512
Sodium ion transport-associated; Members of this family contain a region found exclusively in ...
989-1190 1.17e-68

Sodium ion transport-associated; Members of this family contain a region found exclusively in eukaryotic sodium channels or their subunits, many of which are voltage-gated. Members very often also contain between one and four copies of pfam00520 and, less often, one copy of pfam00612.


Pssm-ID: 399489  Cd Length: 201  Bit Score: 229.94  E-value: 1.17e-68
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117414174   989 DGEMNNLQISVIRIKKGVAWAKVKVHAFMQAHF--KQREADEVKPLDELYE--KKANCIANHTGVdiHRNGDFQKNGngt 1064
Cdd:pfam06512    1 DGEMNNLQIALARIQRGIRFVKRTLRDFCCRLCllEPQKLPEKKPLDESKDasKKTNQIANHTSA--PKELKKAPGG--- 75
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117414174  1065 tsgigssveKYIIDEDHMSFINNPNLTVRVPIAVGESDFENLNTEDVSSE-SDPEGSKDKL-----DDTSSSEGSTIDIK 1138
Cdd:pfam06512   76 ---------KYGVDEDHMSFITNPNLTVCVPIAEGESDLENEEDEDESSQsSDEEKSKQQEqlqqvDDSSSSEGSTVDLT 146
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|....
gi 117414174  1139 PEVEEVPVEQPEE--YLDPDACFTEGCVQRFKCCQVNIEEGLGKSWWILRKTCF 1190
Cdd:pfam06512  147 DPEEELEQIPEEAedLKEPEDCFPEGCVRRFPCCAVDITKGPWKIWWNLRKTCY 200
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
1195-1471 5.63e-64

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


Pssm-ID: 395416 [Multi-domain]  Cd Length: 238  Bit Score: 217.91  E-value: 5.63e-64
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117414174  1195 HNWFETFIIFMILLSSGALAFEDIYIEQRKTIrTILEYADKVFTYIFILEMLLKWTAYGFVK-FFTNAWCWLDFLIVAVS 1273
Cdd:pfam00520    1 SRYFELFILLLILLNTIFLALETYFQPEEPLT-TVLEILDYVFTGIFTLEMLLKIIAAGFKKrYFRSPWNILDFVVVLPS 79
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117414174  1274 LVSLIANalGYSELGAIKSLRTLRALRPLRALSRFEGMRVVVNALVGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKYhy 1353
Cdd:pfam00520   80 LISLVLS--SVGSLSGLRVLRLLRLLRLLRLIRRLEGLRTLVNSLIRSLKSLGNLLLLLLLFLFIFAIIGYQLFGGKL-- 155
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117414174  1354 cfnetseirfeidevnnktdceklmegnNTEIRWKNVKINFDNVGAGYLALLQVATFKGWMDIMYAAVDSRkpdeqpdye 1433
Cdd:pfam00520  156 ----------------------------KTWENPDNGRTNFDNFPNAFLWLFQTMTTEGWGDIMYDTIDGK--------- 198
                          250       260       270
                   ....*....|....*....|....*....|....*...
gi 117414174  1434 GNIYMYIYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKK 1471
Cdd:pfam00520  199 GEFWAYIYFVSFIILGGFLLLNLFIAVIIDNFQELTER 236
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
1520-1774 2.88e-57

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


Pssm-ID: 395416 [Multi-domain]  Cd Length: 238  Bit Score: 198.65  E-value: 2.88e-57
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117414174  1520 QAFDIVIMMLICLNMVTMMVETDTQSKQ-MENILYWINLVFVIFFTCECVLKMFALR--HYYFTIGWNIFDFVVVILSIV 1596
Cdd:pfam00520    2 RYFELFILLLILLNTIFLALETYFQPEEpLTTVLEILDYVFTGIFTLEMLLKIIAAGfkKRYFRSPWNILDFVVVLPSLI 81
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117414174  1597 GMFLADIiekyfVSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIFSIFGMSNFAYV-- 1674
Cdd:pfam00520   82 SLVLSSV-----GSLSGLRVLRLLRLLRLLRLIRRLEGLRTLVNSLIRSLKSLGNLLLLLLLFLFIFAIIGYQLFGGKlk 156
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117414174  1675 KHEAGIDDMFNFETFGNSMICLFQITTSAGWDGLLLPILNRPPdcsldkehpgsgfkgdcgnPSVGIFFFVSYIIISFLI 1754
Cdd:pfam00520  157 TWENPDNGRTNFDNFPNAFLWLFQTMTTEGWGDIMYDTIDGKG-------------------EFWAYIYFVSFIILGGFL 217
                          250       260
                   ....*....|....*....|
gi 117414174  1755 VVNMYIAIILENFSVATEES 1774
Cdd:pfam00520  218 LLNLFIAVIIDNFQELTERT 237
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
750-963 3.23e-55

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


Pssm-ID: 395416 [Multi-domain]  Cd Length: 238  Bit Score: 192.87  E-value: 3.23e-55
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117414174   750 DPFVDLAITICIVLNTLFMAMEHHPMTPQ-FEHVLAVGNLVFTGIFTAEMFLKLIAMDP-YYYFQEGWNIFDGFIVSLSL 827
Cdd:pfam00520    1 SRYFELFILLLILLNTIFLALETYFQPEEpLTTVLEILDYVFTGIFTLEMLLKIIAAGFkKRYFRSPWNILDFVVVLPSL 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117414174   828 MELGLADVE---GLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYkecvc 904
Cdd:pfam00520   81 ISLVLSSVGslsGLRVLRLLRLLRLLRLIRRLEGLRTLVNSLIRSLKSLGNLLLLLLLFLFIFAIIGYQLFGGKL----- 155
                          170       180       190       200       210       220
                   ....*....|....*....|....*....|....*....|....*....|....*....|
gi 117414174   905 KISQECKLPRWHMNDFFHSFLIVFRVLCGE-WIETMWDCMEVAGQAMCLIVFMMVMVIGN 963
Cdd:pfam00520  156 KTWENPDNGRTNFDNFPNAFLWLFQTMTTEgWGDIMYDTIDGKGEFWAYIYFVSFIILGG 215
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
131-421 4.59e-50

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


Pssm-ID: 395416 [Multi-domain]  Cd Length: 238  Bit Score: 177.84  E-value: 4.59e-50
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117414174   131 HSVFSMIIMCTILTNCVFMTFSNPPE-------WSKNVEYTFTGIYTFESLVKIIARGFCidgFTFLRDPWNWLDFSVIM 203
Cdd:pfam00520    1 SRYFELFILLLILLNTIFLALETYFQpeeplttVLEILDYVFTGIFTLEMLLKIIAAGFK---KRYFRSPWNILDFVVVL 77
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117414174   204 MAYIT----EFVNLGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRN 279
Cdd:pfam00520   78 PSLISlvlsSVGSLSGLRVLRLLRLLRLLRLIRRLEGLRTLVNSLIRSLKSLGNLLLLLLLFLFIFAIIGYQLFGGKLKT 157
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117414174   280 kcvvwpinfnesylengtrgfdweeyinnktnfymvpgmlepllcgnssdagqcpegfqcmkaGRNPNYGYTSFDTFSWA 359
Cdd:pfam00520  158 ---------------------------------------------------------------WENPDNGRTNFDNFPNA 174
                          250       260       270       280       290       300
                   ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 117414174   360 FLALFRLMTQDYWENLYQLTLRAAGKTYM-IFFVLVIFVGSFYLVNLILAVVAMAYEEQNQAT 421
Cdd:pfam00520  175 FLWLFQTMTTEGWGDIMYDTIDGKGEFWAyIYFVSFIILGGFLLLNLFIAVIIDNFQELTERT 237
Na_channel_gate cd13433
Inactivation gate of the voltage-gated sodium channel alpha subunits; This region is part of ...
1463-1515 3.14e-31

Inactivation gate of the voltage-gated sodium channel alpha subunits; This region is part of the intracellular linker between domains III and IV of the alpha subunits of voltage-gated sodium channels. It is responsible for fast inactivation of the channel and essential for proper physiological function.


Pssm-ID: 240441  Cd Length: 54  Bit Score: 116.90  E-value: 3.14e-31
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....
gi 117414174 1463 DNFNQQKKKFGG-QDIFMTEEQKKYYNAMKKLGSKKPQKPIPRPLNKIQGIVFD 1515
Cdd:cd13433     1 DNFNQLKKKYGGgLDIFLTESQKKYYNAMKKLGSKKPQKPIPRPKNKFQGFIFD 54
PKD_channel pfam08016
Polycystin cation channel; This family contains the cation channel region of PKD1 and PKD2 ...
1538-1768 3.23e-08

Polycystin cation channel; This family contains the cation channel region of PKD1 and PKD2 proteins.


Pssm-ID: 400395  Cd Length: 424  Bit Score: 58.12  E-value: 3.23e-08
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117414174  1538 MVETDTQSKQMENILYWINLVFVIFFTCECVLKMFALRHYYFTIGWNIFDFVVVILSIVGMFLAdiIEKYFVSPTLFRVI 1617
Cdd:pfam08016  198 LLRYVTNRSLFILLCEIVFVVFFLYFVVEEILKIRKHRPSYLRSVWNLLDLAIVILSVVLIVLN--IYRDFLVDRLIKSV 275
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117414174  1618 -----------RLARIGRILRLIKG----------------AKGIRTLLFALMMSLPALFNIGLLLFLVMFIFSIFGMSN 1670
Cdd:pfam08016  276 easpvtfidfdRVAQLDNLYRIILAflvfltwlklfkvlrfNKTMSLFTKTLSRAWKDLAGFALMFVIFFFAYAQFGYLL 355
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117414174  1671 FAyvKHEAgiddmfNFETFGNSMICLFQITTSA-GWDGLllpilnrppdcsldkehpgsgfkgDCGNPSVGIFFFVSYII 1749
Cdd:pfam08016  356 FG--TQAP------NFSNFVKSILTLFRTILGDfGYNEI------------------------FSGNRVLGPLLFLTFVF 403
                          250
                   ....*....|....*....
gi 117414174  1750 ISFLIVVNMYIAIILENFS 1768
Cdd:pfam08016  404 LVIFILLNLFLAIINDSYV 422
IQ smart00015
Calmodulin-binding motif; Short calmodulin-binding motif containing conserved Ile and Gln ...
1892-1913 1.43e-03

Calmodulin-binding motif; Short calmodulin-binding motif containing conserved Ile and Gln residues.


Pssm-ID: 197470  Cd Length: 23  Bit Score: 37.69  E-value: 1.43e-03
                            10        20
                    ....*....|....*....|..
gi 117414174   1892 QEEVSAVVLQRAYRGHLARRGF 1913
Cdd:smart00015    1 RLTRAAIIIQAAWRGYLARKRY 22
GPHH pfam16905
Voltage-dependent L-type calcium channel, IQ-associated; GPHH is a sequence motif found in ...
1786-1833 4.76e-03

Voltage-dependent L-type calcium channel, IQ-associated; GPHH is a sequence motif found in this short domain on voltage-dependent L-type calcium channel proteins in eukaryotes. The domain is closely associated with the IQ-domain, pfam08763.


Pssm-ID: 407139  Cd Length: 54  Bit Score: 36.86  E-value: 4.76e-03
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|...
gi 117414174  1786 FYEIWEKFDPDATQFIEYCKLADFADALEHPLRVPK--PNTI---ELIAMDLP 1833
Cdd:pfam16905    2 FVRIWAEYDPAATGRISYQDMYELLRRISPPLGFGKkcPARVaykRLVRMNMP 54
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH