NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|124487437|ref|NP_001074579|]
View 

T-cell surface glycoprotein CD8 alpha chain isoform 1 precursor [Mus musculus]

Protein Classification

Ig_CD8_alpha domain-containing protein (domain architecture ID 10146086)

Ig_CD8_alpha domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
IgV_CD8_alpha cd05720
Immunoglobulin (Ig)-like variable (V) domain of Cluster of Differentiation (CD) 8 alpha chain; ...
34-147 2.49e-54

Immunoglobulin (Ig)-like variable (V) domain of Cluster of Differentiation (CD) 8 alpha chain; The members here are composed of the immunoglobulin (Ig)-like variable domain of the Cluster of Differentiation (CD) 8 alpha. The CD8 glycoprotein plays an essential role in the control of T-cell selection, maturation, and the T-cell receptor (TCR)-mediated response to peptide antigen. CD8 is comprised of alpha and beta subunits and is expressed as either an alpha/alpha or alpha/beta dimer. Both dimeric isoforms can serve as a coreceptor for T cell activation and differentiation, however they have distinct physiological roles, different cellular distributions, unique binding partners, etc. Each CD8 subunit is comprised of an extracellular domain containing a V-type Ig-like domain, a single pass transmembrane portion, and a short intracellular domain. The Ig domain of CD8 alpha binds to antibodies. Members of this group contain standard Ig superfamily V-set AGFCC'C"/DEB domain topology.


:

Pssm-ID: 409385  Cd Length: 110  Bit Score: 170.36  E-value: 2.49e-54
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 124487437  34 LRIFPKKMDAELGQKVDLVCEVLGSVSQGCSWLFQNSSSkLPQPTFVVYMASShNKITWDEKLNSsKLFSAMRDTNnKYV 113
Cdd:cd05720    1 FRMSPRKRDAQLGQKVELVCEVLNSVPQGCSWLFQPRGS-APQPTFLLYLSSS-NKTKWAEGLDS-KRFSGSRSGS-SYV 76
                         90       100       110
                 ....*....|....*....|....*....|....
gi 124487437 114 LTLNKFSKENEGYYFCSVISNSVMYFSSVVPVLQ 147
Cdd:cd05720   77 LTLKDFRKEDEGYYFCSVISNSVLYFSSFVPVFL 110
 
Name Accession Description Interval E-value
IgV_CD8_alpha cd05720
Immunoglobulin (Ig)-like variable (V) domain of Cluster of Differentiation (CD) 8 alpha chain; ...
34-147 2.49e-54

Immunoglobulin (Ig)-like variable (V) domain of Cluster of Differentiation (CD) 8 alpha chain; The members here are composed of the immunoglobulin (Ig)-like variable domain of the Cluster of Differentiation (CD) 8 alpha. The CD8 glycoprotein plays an essential role in the control of T-cell selection, maturation, and the T-cell receptor (TCR)-mediated response to peptide antigen. CD8 is comprised of alpha and beta subunits and is expressed as either an alpha/alpha or alpha/beta dimer. Both dimeric isoforms can serve as a coreceptor for T cell activation and differentiation, however they have distinct physiological roles, different cellular distributions, unique binding partners, etc. Each CD8 subunit is comprised of an extracellular domain containing a V-type Ig-like domain, a single pass transmembrane portion, and a short intracellular domain. The Ig domain of CD8 alpha binds to antibodies. Members of this group contain standard Ig superfamily V-set AGFCC'C"/DEB domain topology.


Pssm-ID: 409385  Cd Length: 110  Bit Score: 170.36  E-value: 2.49e-54
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 124487437  34 LRIFPKKMDAELGQKVDLVCEVLGSVSQGCSWLFQNSSSkLPQPTFVVYMASShNKITWDEKLNSsKLFSAMRDTNnKYV 113
Cdd:cd05720    1 FRMSPRKRDAQLGQKVELVCEVLNSVPQGCSWLFQPRGS-APQPTFLLYLSSS-NKTKWAEGLDS-KRFSGSRSGS-SYV 76
                         90       100       110
                 ....*....|....*....|....*....|....
gi 124487437 114 LTLNKFSKENEGYYFCSVISNSVMYFSSVVPVLQ 147
Cdd:cd05720   77 LTLKDFRKEDEGYYFCSVISNSVLYFSSFVPVFL 110
V-set pfam07686
Immunoglobulin V-set domain; This domain is found in antibodies as well as neural protein P0 ...
36-145 2.14e-12

Immunoglobulin V-set domain; This domain is found in antibodies as well as neural protein P0 and CTL4 amongst others.


Pssm-ID: 400157  Cd Length: 109  Bit Score: 61.70  E-value: 2.14e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 124487437   36 IFPKKMDAELGQKVDLVCEVLGSVS---QGCSWLFQNSSSklpQPTFVVYMASSHNKITWDeklnsSKLFSAMRDT-NNK 111
Cdd:pfam07686   1 QTPRSVTVALGGSVTLPCTYSSSMSeasTSVYWYRQPPGK---GPTFLIAYYSNGSEEGKK-----KGRFSLRGDPsNSD 72
                          90       100       110
                  ....*....|....*....|....*....|....
gi 124487437  112 YVLTLNKFSKENEGYYFCSVISNSVMYFSSVVPV 145
Cdd:pfam07686  73 GSLTIQNLTLSDSGTYTCAVIPSGEGVFGKGTRL 106
IG smart00409
Immunoglobulin;
38-142 9.44e-08

Immunoglobulin;


Pssm-ID: 214652  Cd Length: 85  Bit Score: 48.27  E-value: 9.44e-08
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 124487437    38 PKKMDAELGQKVDLVCEVLGSVSQGCSWLFQNSSSKLPQPTFVVymasshnkitwdeklnssklfsamRDTNNKYVLTLN 117
Cdd:smart00409   1 PPSVTVKEGESVTLSCEASGSPPPEVTWYKQGGKLLAESGRFSV------------------------SRSGSTSTLTIS 56
                           90       100
                   ....*....|....*....|....*
gi 124487437   118 KFSKENEGYYFCSVISNSVMYFSSV 142
Cdd:smart00409  57 NVTPEDSGTYTCAATNSSGSASSGT 81
 
Name Accession Description Interval E-value
IgV_CD8_alpha cd05720
Immunoglobulin (Ig)-like variable (V) domain of Cluster of Differentiation (CD) 8 alpha chain; ...
34-147 2.49e-54

Immunoglobulin (Ig)-like variable (V) domain of Cluster of Differentiation (CD) 8 alpha chain; The members here are composed of the immunoglobulin (Ig)-like variable domain of the Cluster of Differentiation (CD) 8 alpha. The CD8 glycoprotein plays an essential role in the control of T-cell selection, maturation, and the T-cell receptor (TCR)-mediated response to peptide antigen. CD8 is comprised of alpha and beta subunits and is expressed as either an alpha/alpha or alpha/beta dimer. Both dimeric isoforms can serve as a coreceptor for T cell activation and differentiation, however they have distinct physiological roles, different cellular distributions, unique binding partners, etc. Each CD8 subunit is comprised of an extracellular domain containing a V-type Ig-like domain, a single pass transmembrane portion, and a short intracellular domain. The Ig domain of CD8 alpha binds to antibodies. Members of this group contain standard Ig superfamily V-set AGFCC'C"/DEB domain topology.


Pssm-ID: 409385  Cd Length: 110  Bit Score: 170.36  E-value: 2.49e-54
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 124487437  34 LRIFPKKMDAELGQKVDLVCEVLGSVSQGCSWLFQNSSSkLPQPTFVVYMASShNKITWDEKLNSsKLFSAMRDTNnKYV 113
Cdd:cd05720    1 FRMSPRKRDAQLGQKVELVCEVLNSVPQGCSWLFQPRGS-APQPTFLLYLSSS-NKTKWAEGLDS-KRFSGSRSGS-SYV 76
                         90       100       110
                 ....*....|....*....|....*....|....
gi 124487437 114 LTLNKFSKENEGYYFCSVISNSVMYFSSVVPVLQ 147
Cdd:cd05720   77 LTLKDFRKEDEGYYFCSVISNSVLYFSSFVPVFL 110
IgV cd00099
Immunoglobulin variable domain (IgV); The members here are composed of the immunoglobulin ...
34-141 1.39e-16

Immunoglobulin variable domain (IgV); The members here are composed of the immunoglobulin variable domain (IgV). The IgV family contains the standard Ig superfamily V-set AGFCC'C"/DEB domain topology, and are components of immunoglobulin (Ig) and T cell receptors. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. In Ig, each chain is composed of one variable domain (IgV) and one or more constant domains (IgC); these names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. Within the variable domain, there are regions of even more variability called the hypervariable or complementarity-determining regions (CDRs) which are responsible for antigen binding. A predominant feature of most Ig domains is the disulfide bridge connecting 2 beta-sheets with a tryptophan residue packed against the disulfide bond. Ig superfamily (IgSF) domains can be divided into 4 main classes based on their structures and sequences: the Variable (V), Constant 1 (C1), Constant 2 (C2), and Intermediate (I) sets. Typically, the V-set domains have A, B, E and, D strands in one sheet and A', G, F, C, C', and C" strands in the other.


Pssm-ID: 409355  Cd Length: 111  Bit Score: 73.14  E-value: 1.39e-16
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 124487437  34 LRIFPKKMDAELGQKVDLVCEVLGSVSQ-GCSWLFQNSSSklpQPTFVVYMASSHNKItwdeKLNSSKLFSAMRDTNNKY 112
Cdd:cd00099    1 VTQSPRSLSVQEGESVTLSCEVSSSFSStYIYWYRQKPGQ---GPEFLIYLSSSKGKT----KGGVPGRFSGSRDGTSSF 73
                         90       100       110
                 ....*....|....*....|....*....|..
gi 124487437 113 VLTLNKFSKENEGYYFCSVISNS---VMYFSS 141
Cdd:cd00099   74 SLTISNLQPEDSGTYYCAVSESGgtdKLTFGS 105
V-set pfam07686
Immunoglobulin V-set domain; This domain is found in antibodies as well as neural protein P0 ...
36-145 2.14e-12

Immunoglobulin V-set domain; This domain is found in antibodies as well as neural protein P0 and CTL4 amongst others.


Pssm-ID: 400157  Cd Length: 109  Bit Score: 61.70  E-value: 2.14e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 124487437   36 IFPKKMDAELGQKVDLVCEVLGSVS---QGCSWLFQNSSSklpQPTFVVYMASSHNKITWDeklnsSKLFSAMRDT-NNK 111
Cdd:pfam07686   1 QTPRSVTVALGGSVTLPCTYSSSMSeasTSVYWYRQPPGK---GPTFLIAYYSNGSEEGKK-----KGRFSLRGDPsNSD 72
                          90       100       110
                  ....*....|....*....|....*....|....
gi 124487437  112 YVLTLNKFSKENEGYYFCSVISNSVMYFSSVVPV 145
Cdd:pfam07686  73 GSLTIQNLTLSDSGTYTCAVIPSGEGVFGKGTRL 106
IG smart00409
Immunoglobulin;
38-142 9.44e-08

Immunoglobulin;


Pssm-ID: 214652  Cd Length: 85  Bit Score: 48.27  E-value: 9.44e-08
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 124487437    38 PKKMDAELGQKVDLVCEVLGSVSQGCSWLFQNSSSKLPQPTFVVymasshnkitwdeklnssklfsamRDTNNKYVLTLN 117
Cdd:smart00409   1 PPSVTVKEGESVTLSCEASGSPPPEVTWYKQGGKLLAESGRFSV------------------------SRSGSTSTLTIS 56
                           90       100
                   ....*....|....*....|....*
gi 124487437   118 KFSKENEGYYFCSVISNSVMYFSSV 142
Cdd:smart00409  57 NVTPEDSGTYTCAATNSSGSASSGT 81
IG_like smart00410
Immunoglobulin like; IG domains that cannot be classified into one of IGv1, IGc1, IGc2, IG.
38-142 9.44e-08

Immunoglobulin like; IG domains that cannot be classified into one of IGv1, IGc1, IGc2, IG.


Pssm-ID: 214653  Cd Length: 85  Bit Score: 48.27  E-value: 9.44e-08
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 124487437    38 PKKMDAELGQKVDLVCEVLGSVSQGCSWLFQNSSSKLPQPTFVVymasshnkitwdeklnssklfsamRDTNNKYVLTLN 117
Cdd:smart00410   1 PPSVTVKEGESVTLSCEASGSPPPEVTWYKQGGKLLAESGRFSV------------------------SRSGSTSTLTIS 56
                           90       100
                   ....*....|....*....|....*
gi 124487437   118 KFSKENEGYYFCSVISNSVMYFSSV 142
Cdd:smart00410  57 NVTPEDSGTYTCAATNSSGSASSGT 81
Ig_3 pfam13927
Immunoglobulin domain; This family contains immunoglobulin-like domains.
32-134 2.21e-04

Immunoglobulin domain; This family contains immunoglobulin-like domains.


Pssm-ID: 404760  Cd Length: 79  Bit Score: 38.66  E-value: 2.21e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 124487437   32 PELRIFPKKMDAELGQKVDLVCEVLGSvsqgcswlfqnsssklPQPTfvvymasshnkITW---DEKLNSSKLFSAMRDT 108
Cdd:pfam13927   2 PVITVSPSSVVVVEGESVTLTCEATGG----------------PPPT-----------ITWyknGEEILSGSTSDRISLS 54
                          90       100
                  ....*....|....*....|....*.
gi 124487437  109 NNKYVLTLNKFSKENEGYYFCsVISN 134
Cdd:pfam13927  55 GSNSTLTISNVTRSDSGTYTC-VASN 79
IgV_CD8_beta cd07700
Immunoglobulin (Ig) variable (V) domain of Cluster of Differentiation (CD) 8 beta chain; The ...
38-139 1.35e-03

Immunoglobulin (Ig) variable (V) domain of Cluster of Differentiation (CD) 8 beta chain; The members here are composed of the immunoglobulin (Ig)-like domain in Cluster of Differentiation (CD) 8 beta. The CD8 glycoprotein plays an essential role in the control of T-cell selection, maturation, and the T-cell receptor (TCR)-mediated response to peptide antigen. CD8 is comprised of alpha and beta subunits and is expressed as either an alpha/alpha or alpha/beta dimer. Both dimeric isoforms can serve as a coreceptor for T cell activation and differentiation, however they have distinct physiological roles, different cellular distributions, unique binding partners, etc. Each CD8 subunit is comprised of an extracellular domain containing a V-type Ig-like domain, a single pass transmembrane portion, and a short intracellular domain. Members of this group contain standard Ig superfamily V-set AGFCC'C"/DEB domain topology.


Pssm-ID: 409497  Cd Length: 116  Bit Score: 37.43  E-value: 1.35e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 124487437  38 PKKMDAELGQKVDLVCEVLGSVS-QGCSWLFQNSS-SKLPQPTFVVYMASShNKITWDEKLNSSKLFSAMRDTNNKYVLT 115
Cdd:cd07700    5 PGSLLVQTNQTVKMSCEAKTSPKnTRIYWLRQRQApSKDSHFEFLASWDPS-KGIVYGEGVDQEKLIILSDSDSSRYILS 83
                         90       100
                 ....*....|....*....|....
gi 124487437 116 LNKFSKENEGYYFCSVISNSVMYF 139
Cdd:cd07700   84 LMSVKPEDSGTYFCMTVGSPELIF 107
IGv smart00406
Immunoglobulin V-Type;
49-131 4.29e-03

Immunoglobulin V-Type;


Pssm-ID: 214650  Cd Length: 81  Bit Score: 35.05  E-value: 4.29e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 124487437    49 VDLVCEVLGS--VSQGCSWLFQNSSSklpQPTFVVYMASSHNkiTWDEKLNSSKLFSAMRDTNNKYVLTLNKFSKENEGY 126
Cdd:smart00406   2 VTLSCKFSGStfSSYYVSWVRQPPGK---GLEWLGYIGSNGS--SYYQESYKGRFTISKDTSKNDVSLTISNLRVEDTGT 76

                   ....*
gi 124487437   127 YFCSV 131
Cdd:smart00406  77 YYCAV 81
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH