NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|134254466|ref|NP_001077071|]
View 

protein patched homolog 1 isoform M [Homo sapiens]

Protein Classification

2A060602 family protein (domain architecture ID 12852140)

2A060602 family protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
2A060602 TIGR00918
The Eukaryotic (Putative) Sterol Transporter (EST) Family;
2-1140 0e+00

The Eukaryotic (Putative) Sterol Transporter (EST) Family;


:

Pssm-ID: 273338  Cd Length: 1145  Bit Score: 2072.95  E-value: 0e+00
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254466     2 GKATGRKAPLWLRAKFQRLLFKLGCYIQKNCGKFLVVGLLIFGAFAVGLKAANLETNVEELWVEVGGRVSRELNYTRQKI 81
Cdd:TIGR00918   28 GKATGRRAPLWLRAKFQRLLFTLGCYIQKHCGKVLFVGLLVFSAFAVGLRAANIETNVEQLWVEVGGRVSQELAYTRQKI 107
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254466    82 GEEAMFNPQLMIQTPKEEGANVLTTEALLQHLDSALQASRVHVYMYNRQWKLEHLCYKSGELITETGYMDQIIEYLYPCL 161
Cdd:TIGR00918  108 GEEAMFTPQLLIQTPHQEGANVLTPEALLQHLDSALKASRVHVYLYNRQWGLEHLCYKSGEPSTEGGYIEQILEKLIPCL 187
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254466   162 IITPLDCFWEGAKLQSGTAYLLGKPPLRWTNFDPLEFLEELKKINYQVDSWEEMLNKAEVGHGYMDRPCLNPADPDCPAT 241
Cdd:TIGR00918  188 IITPLDCFWEGAKLQGGTAYLPGKPPLQWTNLDPASFLEELKQKMSQVESWEEMLKKAAVGQGYMERPCLNPADPDCPDT 267
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254466   242 APNKNSTKPLDMALVLNGGCHGLSRKYMHWQEELIVGGTVKNSTGKLVSAHALQTMFQLMTPKQMYEHFKGYEYVSHINW 321
Cdd:TIGR00918  268 APNKNSTQPPDVAAVLSGGCYGLSAKYMHWQEELIVGGTKRNRSGKLLSAQALQSMFQLMTPKQMYEHFKGYYKVHHIGW 347
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254466   322 NEDKAAAILEAWQRTYVEVVHQSVAQNSTQKVLSFTTTTLDDILKSFSDVSVIRVASGYLLMLAYACLTMLRWDCSKSQG 401
Cdd:TIGR00918  348 NEEKAAAVLEAWQRNFSEEVQQSLPKNSSQKILVFSSTTLDDILKKFSDVSAIRIVSGYLLMLAYACLTMLRWDCAKSQG 427
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254466   402 AVGLAGVLLVALSVAAGLGLCSLIGISFNAATTQVLPFLALGVGVDDVFLLAHAFSETGQNkrIPFEDRTGECLKRTGAS 481
Cdd:TIGR00918  428 SVGLAGVLLVALSVAAGLGLCALLGISFNAATTQVLPFLALGVGVDDVFLLAHAFSETGQN--IPFEERTGECLKRTGAS 505
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254466   482 VALTSISNVTAFFMAALIPIPALRAFSLQAAVVVVFNFAMVLLIFPAILSMDLYRREDRRLDIFCCFTSPCVSRVIQVEP 561
Cdd:TIGR00918  506 VVLTSISNVTAFFMAALIPIPALRAFSLQAAIVVVFNFAAVLLVFPAILSLDLRRREDRRLDIFCCFFSPCSARVIQIEP 585
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254466   562 QAYTDThdntryspppPYSSHSFAHetqitMQSTVQLRTEYDPHTHVYYTTAEPRSEISVQPvtvtQDTLSCQSPESTSS 641
Cdd:TIGR00918  586 QAYADG----------SAPPVYSSH-----MQSTVQLRTEYDPGTQHYYTTNEPRSHLSVQP----SDPLSCQSPDIAGS 646
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254466   642 TRDLLSQFSDSSLHCLEPPCTKWTLSSFAEKHYAPFLLKPKAKVVVIFLFLGLLGVSLYGTTRVRDGLDLTDIVPRETRE 721
Cdd:TIGR00918  647 TRDLLSQFEDSKAACLSLPCARWTLATFAEKHYAPFLLQSWAKVVVIFLFLALLGLSLYGTTRVQDGLDLTDIVPRDTNE 726
                          730       740       750       760       770       780       790       800
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254466   722 YDFIAAQFKYFSFYNMYIVTQK-ADYPNIQHLLYDLHRSFSNVKYVMLEENKQLPKMWLHYFRDWLQGLQDAFDSDWETG 800
Cdd:TIGR00918  727 HDFLDAQFRYFSFYNMYAVTQGnFDYPTQQQLLYDLHQSFSSVKYVLKEDNGQLPRMWLHYFRDWLQGLQKAFDEDWRDG 806
                          810       820       830       840       850       860       870       880
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254466   801 KIMPNNYKNGSDDGVLAYKLLVQTGSRDKPIDISQLTKQRLVDADGIINPSAFYIYLTAWVSNDPVAYAASQANIRPHRP 880
Cdd:TIGR00918  807 RITKENYRNGSDDAVLAYKLLVQTGHRDKPVDKEQLTTQRLVNADGIINPNAFYIYLSAWVSNDPVAYAASQANIYPHPP 886
                          890       900       910       920       930       940       950       960
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254466   881 EWVHDKADYMPETrLRIPAAEPIEYAQFPFYLNGLRDTSDFVEAIEKVRTICSNYTSLGLSSYPNGYPFLFWEQYIGLRH 960
Cdd:TIGR00918  887 EWLHDKNDYDPEN-LRIPAAEPLEYAQFPFYLNGLRETSQFVEAIEHVRAICNNYEGFGLPSYPSGYPFLFWEQYMGLRH 965
                          970       980       990      1000      1010      1020      1030      1040
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254466   961 WLLLFISVVLACTFLVCAVFLLNPWTAGIIVMVLALMTVELFGMMGLIGIKLSAVPVVILIASVGIGVEFTVHVALAFLT 1040
Cdd:TIGR00918  966 WLLLSISVVLACTFLVCALLLLNPWTAGLIVLVLALMTVELFGMMGLLGIKLSAIPVVILIASVGIGVEFTVHIALGFLT 1045
                         1050      1060      1070      1080      1090      1100      1110      1120
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254466  1041 AIGDKNRRAVLALEHMFAPVLDGAVSTLLGVLMLAGSEFDFIVRYFFAVLAILTILGVLNGLVLLPVLLSFFGPYPEVSP 1120
Cdd:TIGR00918 1046 AIGDRNRRAVLALEHMFAPVLDGALSTLLGVLMLAGSEFDFIVRYFFAVLAVLTCLGVLNGLVLLPVLLSMFGPEPEVSP 1125
                         1130      1140
                   ....*....|....*....|
gi 134254466  1121 ANGLNRLPTPSPEPPPSVVR 1140
Cdd:TIGR00918 1126 AEGRSRLPTPSPEPPPGGVR 1145
PHA03377 super family cl31823
EBNA-3C; Provisional
1181-1303 4.11e-04

EBNA-3C; Provisional


The actual alignment was detected with superfamily member PHA03377:

Pssm-ID: 177614 [Multi-domain]  Cd Length: 1000  Bit Score: 45.04  E-value: 4.11e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254466 1181 AGGPahQVIVEATENPVFAHSTVVHPES-RHHPPSNPRQ-QPHLDSGSLPPGRQGQQPRRDP-----PREGLW--PPPYR 1251
Cdd:PHA03377  695 AGRA--QPSEESHLSSMSPTQPISHEEQpRYEDPDDPLDlSLHPDQAPPPSHQAPYSGHEEPqaqqaPYPGYWepRPPQA 772
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|..
gi 134254466 1252 PRRDAFEISTEGHSGPSNRARWGPRGARSHNPRNPASTAMGSSVPGYCQPIT 1303
Cdd:PHA03377  773 PYLGYQEPQAQGVQVSSYPGYAGPWGLRAQHPRYRHSWAYWSQYPGHGHPQG 824
 
Name Accession Description Interval E-value
2A060602 TIGR00918
The Eukaryotic (Putative) Sterol Transporter (EST) Family;
2-1140 0e+00

The Eukaryotic (Putative) Sterol Transporter (EST) Family;


Pssm-ID: 273338  Cd Length: 1145  Bit Score: 2072.95  E-value: 0e+00
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254466     2 GKATGRKAPLWLRAKFQRLLFKLGCYIQKNCGKFLVVGLLIFGAFAVGLKAANLETNVEELWVEVGGRVSRELNYTRQKI 81
Cdd:TIGR00918   28 GKATGRRAPLWLRAKFQRLLFTLGCYIQKHCGKVLFVGLLVFSAFAVGLRAANIETNVEQLWVEVGGRVSQELAYTRQKI 107
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254466    82 GEEAMFNPQLMIQTPKEEGANVLTTEALLQHLDSALQASRVHVYMYNRQWKLEHLCYKSGELITETGYMDQIIEYLYPCL 161
Cdd:TIGR00918  108 GEEAMFTPQLLIQTPHQEGANVLTPEALLQHLDSALKASRVHVYLYNRQWGLEHLCYKSGEPSTEGGYIEQILEKLIPCL 187
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254466   162 IITPLDCFWEGAKLQSGTAYLLGKPPLRWTNFDPLEFLEELKKINYQVDSWEEMLNKAEVGHGYMDRPCLNPADPDCPAT 241
Cdd:TIGR00918  188 IITPLDCFWEGAKLQGGTAYLPGKPPLQWTNLDPASFLEELKQKMSQVESWEEMLKKAAVGQGYMERPCLNPADPDCPDT 267
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254466   242 APNKNSTKPLDMALVLNGGCHGLSRKYMHWQEELIVGGTVKNSTGKLVSAHALQTMFQLMTPKQMYEHFKGYEYVSHINW 321
Cdd:TIGR00918  268 APNKNSTQPPDVAAVLSGGCYGLSAKYMHWQEELIVGGTKRNRSGKLLSAQALQSMFQLMTPKQMYEHFKGYYKVHHIGW 347
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254466   322 NEDKAAAILEAWQRTYVEVVHQSVAQNSTQKVLSFTTTTLDDILKSFSDVSVIRVASGYLLMLAYACLTMLRWDCSKSQG 401
Cdd:TIGR00918  348 NEEKAAAVLEAWQRNFSEEVQQSLPKNSSQKILVFSSTTLDDILKKFSDVSAIRIVSGYLLMLAYACLTMLRWDCAKSQG 427
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254466   402 AVGLAGVLLVALSVAAGLGLCSLIGISFNAATTQVLPFLALGVGVDDVFLLAHAFSETGQNkrIPFEDRTGECLKRTGAS 481
Cdd:TIGR00918  428 SVGLAGVLLVALSVAAGLGLCALLGISFNAATTQVLPFLALGVGVDDVFLLAHAFSETGQN--IPFEERTGECLKRTGAS 505
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254466   482 VALTSISNVTAFFMAALIPIPALRAFSLQAAVVVVFNFAMVLLIFPAILSMDLYRREDRRLDIFCCFTSPCVSRVIQVEP 561
Cdd:TIGR00918  506 VVLTSISNVTAFFMAALIPIPALRAFSLQAAIVVVFNFAAVLLVFPAILSLDLRRREDRRLDIFCCFFSPCSARVIQIEP 585
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254466   562 QAYTDThdntryspppPYSSHSFAHetqitMQSTVQLRTEYDPHTHVYYTTAEPRSEISVQPvtvtQDTLSCQSPESTSS 641
Cdd:TIGR00918  586 QAYADG----------SAPPVYSSH-----MQSTVQLRTEYDPGTQHYYTTNEPRSHLSVQP----SDPLSCQSPDIAGS 646
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254466   642 TRDLLSQFSDSSLHCLEPPCTKWTLSSFAEKHYAPFLLKPKAKVVVIFLFLGLLGVSLYGTTRVRDGLDLTDIVPRETRE 721
Cdd:TIGR00918  647 TRDLLSQFEDSKAACLSLPCARWTLATFAEKHYAPFLLQSWAKVVVIFLFLALLGLSLYGTTRVQDGLDLTDIVPRDTNE 726
                          730       740       750       760       770       780       790       800
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254466   722 YDFIAAQFKYFSFYNMYIVTQK-ADYPNIQHLLYDLHRSFSNVKYVMLEENKQLPKMWLHYFRDWLQGLQDAFDSDWETG 800
Cdd:TIGR00918  727 HDFLDAQFRYFSFYNMYAVTQGnFDYPTQQQLLYDLHQSFSSVKYVLKEDNGQLPRMWLHYFRDWLQGLQKAFDEDWRDG 806
                          810       820       830       840       850       860       870       880
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254466   801 KIMPNNYKNGSDDGVLAYKLLVQTGSRDKPIDISQLTKQRLVDADGIINPSAFYIYLTAWVSNDPVAYAASQANIRPHRP 880
Cdd:TIGR00918  807 RITKENYRNGSDDAVLAYKLLVQTGHRDKPVDKEQLTTQRLVNADGIINPNAFYIYLSAWVSNDPVAYAASQANIYPHPP 886
                          890       900       910       920       930       940       950       960
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254466   881 EWVHDKADYMPETrLRIPAAEPIEYAQFPFYLNGLRDTSDFVEAIEKVRTICSNYTSLGLSSYPNGYPFLFWEQYIGLRH 960
Cdd:TIGR00918  887 EWLHDKNDYDPEN-LRIPAAEPLEYAQFPFYLNGLRETSQFVEAIEHVRAICNNYEGFGLPSYPSGYPFLFWEQYMGLRH 965
                          970       980       990      1000      1010      1020      1030      1040
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254466   961 WLLLFISVVLACTFLVCAVFLLNPWTAGIIVMVLALMTVELFGMMGLIGIKLSAVPVVILIASVGIGVEFTVHVALAFLT 1040
Cdd:TIGR00918  966 WLLLSISVVLACTFLVCALLLLNPWTAGLIVLVLALMTVELFGMMGLLGIKLSAIPVVILIASVGIGVEFTVHIALGFLT 1045
                         1050      1060      1070      1080      1090      1100      1110      1120
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254466  1041 AIGDKNRRAVLALEHMFAPVLDGAVSTLLGVLMLAGSEFDFIVRYFFAVLAILTILGVLNGLVLLPVLLSFFGPYPEVSP 1120
Cdd:TIGR00918 1046 AIGDRNRRAVLALEHMFAPVLDGALSTLLGVLMLAGSEFDFIVRYFFAVLAVLTCLGVLNGLVLLPVLLSMFGPEPEVSP 1125
                         1130      1140
                   ....*....|....*....|
gi 134254466  1121 ANGLNRLPTPSPEPPPSVVR 1140
Cdd:TIGR00918 1126 AEGRSRLPTPSPEPPPGGVR 1145
Sterol-sensing pfam12349
Sterol-sensing domain of SREBP cleavage-activation; Sterol regulatory element-binding proteins ...
396-550 1.62e-50

Sterol-sensing domain of SREBP cleavage-activation; Sterol regulatory element-binding proteins (SREBPs) are membrane-bound transcription factors that promote lipid synthesis in animal cells. They are embedded in the membranes of the endoplasmic reticulum (ER) in a helical hairpin orientation and are released from the ER by a two-step proteolytic process. Proteolysis begins when the SREBPs are cleaved at Site-1, which is located at a leucine residue in the middle of the hydrophobic loop in the lumen of the ER. Upon proteolytic processing SREBP can activate the expression of genes involved in cholesterol biosynthesis and uptake. SCAP stimulates cleavage of SREBPs via fusion of the their two C-termini. This domain is the transmembrane region that traverses the membrane eight times and is the sterol-sensing domain of the cleavage protein. WD40 domains are found towards the C-terminus.


Pssm-ID: 403533 [Multi-domain]  Cd Length: 153  Bit Score: 175.47  E-value: 1.62e-50
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254466   396 CSKSQGAVGLAGVLLVALSVAAGLGLCSLIGISFNAATTQVLPFLALGVGVDDVFLLAHAFSETgqNKRIPFEDRTGECL 475
Cdd:pfam12349    1 MVKSKFGLGLAGVIIVLASVASSLGLCAYFGLTLTLIISEVIPFLVLAIGVDNIFILVKAVQRT--PRSLDVSERIAEAL 78
                           90       100       110       120       130       140       150
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 134254466   476 KRTGASVALTSISNVTAFFMAALIPIPALRAFSLQAAVVVVFNFAMVLLIFPAILSMDLYRREDRRLDIFCCFTS 550
Cdd:pfam12349   79 GQVGPSILLTSLTEILAFLIGALTDMPAVQEFCLFAAVALLFDFLLQMTFFVAVLSLDIRRLESNRLDVLCCVRS 153
COG1033 COG1033
Predicted exporter protein, RND superfamily [General function prediction only];
403-540 4.62e-09

Predicted exporter protein, RND superfamily [General function prediction only];


Pssm-ID: 223964 [Multi-domain]  Cd Length: 727  Bit Score: 60.78  E-value: 4.62e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254466  403 VGLAGVLLVALSVAAGLGLCSLIGISFNAATtQVLPFLALGVGVDDVFLLAHAFSETGQNKriPFEDRTGECLKRTGASV 482
Cdd:COG1033   594 KAIIPLIPIAIVVGWNFGLMGLLGIPLTPAT-ATLGAIILGIGVDYSIHITERYREERKKG--GPKEAIETTVERTGKAI 670
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254466  483 ALTSISnvTAFFMAALI--PIPALRAFSLQAAVVVVFNFAMVLLIFPAILSMdLYRREDR 540
Cdd:COG1033   671 LASALT--TAIGFLALIfsPFPIISNFGLLTVIGILLSLLASLVLLPALLVL-LDGRRKR 727
PHA03377 PHA03377
EBNA-3C; Provisional
1181-1303 4.11e-04

EBNA-3C; Provisional


Pssm-ID: 177614 [Multi-domain]  Cd Length: 1000  Bit Score: 45.04  E-value: 4.11e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254466 1181 AGGPahQVIVEATENPVFAHSTVVHPES-RHHPPSNPRQ-QPHLDSGSLPPGRQGQQPRRDP-----PREGLW--PPPYR 1251
Cdd:PHA03377  695 AGRA--QPSEESHLSSMSPTQPISHEEQpRYEDPDDPLDlSLHPDQAPPPSHQAPYSGHEEPqaqqaPYPGYWepRPPQA 772
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|..
gi 134254466 1252 PRRDAFEISTEGHSGPSNRARWGPRGARSHNPRNPASTAMGSSVPGYCQPIT 1303
Cdd:PHA03377  773 PYLGYQEPQAQGVQVSSYPGYAGPWGLRAQHPRYRHSWAYWSQYPGHGHPQG 824
 
Name Accession Description Interval E-value
2A060602 TIGR00918
The Eukaryotic (Putative) Sterol Transporter (EST) Family;
2-1140 0e+00

The Eukaryotic (Putative) Sterol Transporter (EST) Family;


Pssm-ID: 273338  Cd Length: 1145  Bit Score: 2072.95  E-value: 0e+00
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254466     2 GKATGRKAPLWLRAKFQRLLFKLGCYIQKNCGKFLVVGLLIFGAFAVGLKAANLETNVEELWVEVGGRVSRELNYTRQKI 81
Cdd:TIGR00918   28 GKATGRRAPLWLRAKFQRLLFTLGCYIQKHCGKVLFVGLLVFSAFAVGLRAANIETNVEQLWVEVGGRVSQELAYTRQKI 107
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254466    82 GEEAMFNPQLMIQTPKEEGANVLTTEALLQHLDSALQASRVHVYMYNRQWKLEHLCYKSGELITETGYMDQIIEYLYPCL 161
Cdd:TIGR00918  108 GEEAMFTPQLLIQTPHQEGANVLTPEALLQHLDSALKASRVHVYLYNRQWGLEHLCYKSGEPSTEGGYIEQILEKLIPCL 187
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254466   162 IITPLDCFWEGAKLQSGTAYLLGKPPLRWTNFDPLEFLEELKKINYQVDSWEEMLNKAEVGHGYMDRPCLNPADPDCPAT 241
Cdd:TIGR00918  188 IITPLDCFWEGAKLQGGTAYLPGKPPLQWTNLDPASFLEELKQKMSQVESWEEMLKKAAVGQGYMERPCLNPADPDCPDT 267
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254466   242 APNKNSTKPLDMALVLNGGCHGLSRKYMHWQEELIVGGTVKNSTGKLVSAHALQTMFQLMTPKQMYEHFKGYEYVSHINW 321
Cdd:TIGR00918  268 APNKNSTQPPDVAAVLSGGCYGLSAKYMHWQEELIVGGTKRNRSGKLLSAQALQSMFQLMTPKQMYEHFKGYYKVHHIGW 347
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254466   322 NEDKAAAILEAWQRTYVEVVHQSVAQNSTQKVLSFTTTTLDDILKSFSDVSVIRVASGYLLMLAYACLTMLRWDCSKSQG 401
Cdd:TIGR00918  348 NEEKAAAVLEAWQRNFSEEVQQSLPKNSSQKILVFSSTTLDDILKKFSDVSAIRIVSGYLLMLAYACLTMLRWDCAKSQG 427
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254466   402 AVGLAGVLLVALSVAAGLGLCSLIGISFNAATTQVLPFLALGVGVDDVFLLAHAFSETGQNkrIPFEDRTGECLKRTGAS 481
Cdd:TIGR00918  428 SVGLAGVLLVALSVAAGLGLCALLGISFNAATTQVLPFLALGVGVDDVFLLAHAFSETGQN--IPFEERTGECLKRTGAS 505
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254466   482 VALTSISNVTAFFMAALIPIPALRAFSLQAAVVVVFNFAMVLLIFPAILSMDLYRREDRRLDIFCCFTSPCVSRVIQVEP 561
Cdd:TIGR00918  506 VVLTSISNVTAFFMAALIPIPALRAFSLQAAIVVVFNFAAVLLVFPAILSLDLRRREDRRLDIFCCFFSPCSARVIQIEP 585
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254466   562 QAYTDThdntryspppPYSSHSFAHetqitMQSTVQLRTEYDPHTHVYYTTAEPRSEISVQPvtvtQDTLSCQSPESTSS 641
Cdd:TIGR00918  586 QAYADG----------SAPPVYSSH-----MQSTVQLRTEYDPGTQHYYTTNEPRSHLSVQP----SDPLSCQSPDIAGS 646
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254466   642 TRDLLSQFSDSSLHCLEPPCTKWTLSSFAEKHYAPFLLKPKAKVVVIFLFLGLLGVSLYGTTRVRDGLDLTDIVPRETRE 721
Cdd:TIGR00918  647 TRDLLSQFEDSKAACLSLPCARWTLATFAEKHYAPFLLQSWAKVVVIFLFLALLGLSLYGTTRVQDGLDLTDIVPRDTNE 726
                          730       740       750       760       770       780       790       800
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254466   722 YDFIAAQFKYFSFYNMYIVTQK-ADYPNIQHLLYDLHRSFSNVKYVMLEENKQLPKMWLHYFRDWLQGLQDAFDSDWETG 800
Cdd:TIGR00918  727 HDFLDAQFRYFSFYNMYAVTQGnFDYPTQQQLLYDLHQSFSSVKYVLKEDNGQLPRMWLHYFRDWLQGLQKAFDEDWRDG 806
                          810       820       830       840       850       860       870       880
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254466   801 KIMPNNYKNGSDDGVLAYKLLVQTGSRDKPIDISQLTKQRLVDADGIINPSAFYIYLTAWVSNDPVAYAASQANIRPHRP 880
Cdd:TIGR00918  807 RITKENYRNGSDDAVLAYKLLVQTGHRDKPVDKEQLTTQRLVNADGIINPNAFYIYLSAWVSNDPVAYAASQANIYPHPP 886
                          890       900       910       920       930       940       950       960
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254466   881 EWVHDKADYMPETrLRIPAAEPIEYAQFPFYLNGLRDTSDFVEAIEKVRTICSNYTSLGLSSYPNGYPFLFWEQYIGLRH 960
Cdd:TIGR00918  887 EWLHDKNDYDPEN-LRIPAAEPLEYAQFPFYLNGLRETSQFVEAIEHVRAICNNYEGFGLPSYPSGYPFLFWEQYMGLRH 965
                          970       980       990      1000      1010      1020      1030      1040
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254466   961 WLLLFISVVLACTFLVCAVFLLNPWTAGIIVMVLALMTVELFGMMGLIGIKLSAVPVVILIASVGIGVEFTVHVALAFLT 1040
Cdd:TIGR00918  966 WLLLSISVVLACTFLVCALLLLNPWTAGLIVLVLALMTVELFGMMGLLGIKLSAIPVVILIASVGIGVEFTVHIALGFLT 1045
                         1050      1060      1070      1080      1090      1100      1110      1120
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254466  1041 AIGDKNRRAVLALEHMFAPVLDGAVSTLLGVLMLAGSEFDFIVRYFFAVLAILTILGVLNGLVLLPVLLSFFGPYPEVSP 1120
Cdd:TIGR00918 1046 AIGDRNRRAVLALEHMFAPVLDGALSTLLGVLMLAGSEFDFIVRYFFAVLAVLTCLGVLNGLVLLPVLLSMFGPEPEVSP 1125
                         1130      1140
                   ....*....|....*....|
gi 134254466  1121 ANGLNRLPTPSPEPPPSVVR 1140
Cdd:TIGR00918 1126 AEGRSRLPTPSPEPPPGGVR 1145
2A060601 TIGR00917
Niemann-Pick C type protein family; The model describes Niemann-Pick C type protein in ...
332-1113 2.00e-66

Niemann-Pick C type protein family; The model describes Niemann-Pick C type protein in eukaryotes. The defective protein has been associated with Niemann-Pick disease which is described in humans as autosomal recessive lipidosis. It is characterized by the lysosomal accumulation of unestrified cholesterol. It is an integral membrane protein, which indicates that this protein is most likely involved in cholesterol transport or acts as some component of cholesterol homeostasis. [Transport and binding proteins, Other]


Pssm-ID: 273337 [Multi-domain]  Cd Length: 1205  Bit Score: 246.74  E-value: 2.00e-66
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254466   332 AWQRTYVEVVhQSVAQNSTQKVLSFTT-TTLDDILKSFSDVSVIRVASGYLLMLAYACLTM-----LRWDCSKSQGAVGL 405
Cdd:TIGR00917  533 AWEKAFIQLA-KDELLPMVQATISFSAeRSIEDELKRESTADVITIAISYLVMFAYISLTLgdsprLKSLYVTSKVLLGL 611
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254466   406 AGVLLVALSVAAGLGLCSLIGISFNAATTQVLPFLALGVGVDDVFLLAHAF---------SETGQNKRIPFEDRTGECLK 476
Cdd:TIGR00917  612 SGILIVMLSVLGSVGVFSAVGLKSTLIIMEVIPFLVLAVGVDNIFILVFFYfyleyfyrqVGVDNEQELTLERRLSRALM 691
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254466   477 RTGASVALTSISNVTAFFMAALIPIPALRAFSLQAAVVVVFNFAMVLLIFPAILSMDLYRREDRRLDIFCCftspcvsrv 556
Cdd:TIGR00917  692 EVGPSITLASLSEILAFALGALIKMPAVRVFSMFAVLAVFLDFLLQITAFVALLVLDFKRTEDKRVDCFPC--------- 762
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254466   557 IQVEPQAYTDThdntrysppppysshsfahetqitmqstvqlrteydphthvyyTTAEPRSEisvqpvtvtqdtlSCqsp 636
Cdd:TIGR00917  763 IKTSKSSISAE-------------------------------------------KGSGQRKA-------------GL--- 783
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254466   637 estsstrdllsqfsdsslhcleppctkwtLSSFAEKHYAPFLLKPKAKVVVIFLFLGLLGVSLYGTTRVRDGLDLTDIVP 716
Cdd:TIGR00917  784 -----------------------------LTRYFKEVYAPVLLHWIVKIVVIAFFVGLLMAGIALSTRVEIGLDQQIVLP 834
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254466   717 RETREYDFIAAQFKYFSFYNMYIVTQKADYPniqhllYDLHRSFSNVKYVMLEENKQL-------------PKMWLHYFR 783
Cdd:TIGR00917  835 QDSYLQIYFASLTPLLEVGPPFYIVIKGDYN------YTDFESQNKLCTMGGCDKDSIvnvfnnlsyiakpASSWLDDYL 908
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254466   784 DWLQGLQDAFDSDWETGKimpnnYKNGSDDGVLAYKllvqtgsrdkpiDISQLTKQRlvdadgiINPSAFYIYLTAWVSN 863
Cdd:TIGR00917  909 VWLSPQASCCCRKFTNGT-----FCNGPDPQCFRCA------------DLSSDAQGR-------PSTTQFKEKLPWFLNA 964
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254466   864 DP--------VAYAASQANIRPHrpewvhdkadympetrlripaAEPIEYAQFPFYLNGLRDTSDFVEAIEKVRTICSNY 935
Cdd:TIGR00917  965 LPsadcakggHAAYSSAVDLQGY---------------------ATIIQASSFRTYHTPLNTQVDFINAMRAAQEFAAKV 1023
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254466   936 T-SLGLSSYPNGYPFLFWEQYIGLRHWLLLFISVVLACTFLVCAVFL-LNPWTAGIIVMVLALMTVELFGMMGLIGIKLS 1013
Cdd:TIGR00917 1024 SrSSKMEVYPYSVFYVFFEQYLTIWKTAIINLSIALGAIFIVCLFLLqLNALSVVNLIMSVGMAVVFCVGIMHLWSISLN 1103
                          730       740       750       760       770       780       790       800
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254466  1014 AVPVVILIASVGIGVEFTVHVALAFLTAI-GDKNRRAVLALEHMFAPVLDGAVST-LLGVLMLAGSEFDFIVRYFFAVLA 1091
Cdd:TIGR00917 1104 AVSVVNSVMHKGIAIEFCTHINAQFSTGKhFSRNHRAKEALGGMGSSVFSGITLTkLVGVVVLGFSRSEIFVVYYFRMYL 1183
                          810       820
                   ....*....|....*....|..
gi 134254466  1092 ILTILGVLNGLVLLPVLLSFFG 1113
Cdd:TIGR00917 1184 ALVLLGFLHGLVFLPVLLSVLG 1205
Sterol-sensing pfam12349
Sterol-sensing domain of SREBP cleavage-activation; Sterol regulatory element-binding proteins ...
396-550 1.62e-50

Sterol-sensing domain of SREBP cleavage-activation; Sterol regulatory element-binding proteins (SREBPs) are membrane-bound transcription factors that promote lipid synthesis in animal cells. They are embedded in the membranes of the endoplasmic reticulum (ER) in a helical hairpin orientation and are released from the ER by a two-step proteolytic process. Proteolysis begins when the SREBPs are cleaved at Site-1, which is located at a leucine residue in the middle of the hydrophobic loop in the lumen of the ER. Upon proteolytic processing SREBP can activate the expression of genes involved in cholesterol biosynthesis and uptake. SCAP stimulates cleavage of SREBPs via fusion of the their two C-termini. This domain is the transmembrane region that traverses the membrane eight times and is the sterol-sensing domain of the cleavage protein. WD40 domains are found towards the C-terminus.


Pssm-ID: 403533 [Multi-domain]  Cd Length: 153  Bit Score: 175.47  E-value: 1.62e-50
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254466   396 CSKSQGAVGLAGVLLVALSVAAGLGLCSLIGISFNAATTQVLPFLALGVGVDDVFLLAHAFSETgqNKRIPFEDRTGECL 475
Cdd:pfam12349    1 MVKSKFGLGLAGVIIVLASVASSLGLCAYFGLTLTLIISEVIPFLVLAIGVDNIFILVKAVQRT--PRSLDVSERIAEAL 78
                           90       100       110       120       130       140       150
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 134254466   476 KRTGASVALTSISNVTAFFMAALIPIPALRAFSLQAAVVVVFNFAMVLLIFPAILSMDLYRREDRRLDIFCCFTS 550
Cdd:pfam12349   79 GQVGPSILLTSLTEILAFLIGALTDMPAVQEFCLFAAVALLFDFLLQMTFFVAVLSLDIRRLESNRLDVLCCVRS 153
Patched pfam02460
Patched family; The transmembrane protein Patched is a receptor for the morphogene Sonic ...
318-1112 2.81e-46

Patched family; The transmembrane protein Patched is a receptor for the morphogene Sonic Hedgehog. This protein associates with the smoothened protein to transduce hedgehog signals.


Pssm-ID: 308203  Cd Length: 793  Bit Score: 179.86  E-value: 2.81e-46
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254466   318 HINWNEDKAAAILEAWQRTYVEVVHQSVAQNSTQkVLSFTTTTLDDILKSFSDVSVIRVASGYLLMLAYACLT-----ML 392
Cdd:pfam02460  162 FLKFDEEEVEEDSKEWEDELSQLLHNKYASEHIQ-FTIFHDQILNDELVRNALTLTPFFVIGFFLLLTFSIIVsvtlsSY 240
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254466   393 RWDCSKSQGAVGLAGVLLVALSVAAGLGLCSLIGISFNAATTqVLPFLALGVGVDDVFLLAHAFSETgqNKRIPFEDRTG 472
Cdd:pfam02460  241 TIDWVRSKPILAALGLLSPVMAIVSSFGLLFWMGFPFNSIVC-VTPFLVLAIGVDDMFLMVAAWQRT--TATLSVKKRMG 317
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254466   473 ECLKRTGASVALTSISNVTAFFMAALIPIPALRAFSLQAAVVVVFNFAMVLLIFPAILSMdlyrredrrldifccftspc 552
Cdd:pfam02460  318 EALSEAGVSITITSLTDVLSFGIGTYTPTPAIQLFCAYTAVAIFFDFIYQITFFAAIMAI-------------------- 377
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254466   553 vsrviqvepqaytdthdntrysppppysshsfahetqitmqstvqlrteydphthvyytTAEPrsEISVQPVTVTQDTLS 632
Cdd:pfam02460  378 -----------------------------------------------------------CAKP--EAEGRHCLFVWATSS 396
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254466   633 CQSPESTSSTRDllsqfsdsSLHCLEPPctkwtLSSFAEKHYAPFLLKPKAKVVVIFLFLGLLGVSLYGTTRVRDGLDLT 712
Cdd:pfam02460  397 PQRIDSEGSEPD--------KSHNIEQL-----KSRFFLDIYCPFLLNPSVRVCMLVLFVVYIAIAIYGCVNIKEGLEPD 463
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254466   713 DIVPRETREYDFIAAQFKYFSFY--NMYIVTQKAdyPNIQ-HLLYD----LHRSFSNVKYVMleeNKQLPKMWLHYFRDW 785
Cdd:pfam02460  464 KLVLEDSPLVEYLSLREKHFWPEglQIQVAVNNP--PNLTiPESRDrmneMVDEFENTPYSL---GPNSTLFWLREYENF 538
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254466   786 LQGLQDAFDSDWEtgkimpnnykngsddgvlaykllvqtgsrdkpidisqltkqrlvdadgiinPSAFYIYLTAWVSNdp 865
Cdd:pfam02460  539 LSTLNMEEEEDEE---------------------------------------------------KEWSYGNLPSFLKA-- 565
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254466   866 vayaasqanirPHRPEW----VHDKADYMpetrlripaaepIEYAQFPFYLNGLRDTSDFVEAIEKVRTICSNYTSLGLS 941
Cdd:pfam02460  566 -----------PGNSHWagdlVWDDNTTM------------VTKFRFTLAGKGLSTWNDRTRALQEWRSIADQYPEFNVT 622
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254466   942 SYPNGYPFLfwEQYIGLRHWLLLFISVVLACTFLVCAVFLLNPWTAGIIVMVLALMTVELFGMMGLIGIKLSAVPVVILI 1021
Cdd:pfam02460  623 VFDEDAPFA--DQYLTILPSTIQNIVITLICMFIVCFLFIPNPPCVFVITLAIASIDIGVFGFLSLWGVDLDPISMITII 700
                          730       740       750       760       770       780       790       800
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254466  1022 ASVGIGVEFTVHVALAFLTAIG-DKNRRAVLALEHMFAPVLDGAVSTLLGVLMLAgseF--DFIVRYFFAVLAILTILGV 1098
Cdd:pfam02460  701 MSIGFSVDFSAHIAYHFVRSRGdTPAERVVDALEALGWPVFQGGLSTILGVLVLL---FvpSYMVVVFFKTVFLVVAIGL 777
                          810
                   ....*....|....
gi 134254466  1099 LNGLVLLPVLLSFF 1112
Cdd:pfam02460  778 LHGLFILPIILSLF 791
COG1033 COG1033
Predicted exporter protein, RND superfamily [General function prediction only];
403-540 4.62e-09

Predicted exporter protein, RND superfamily [General function prediction only];


Pssm-ID: 223964 [Multi-domain]  Cd Length: 727  Bit Score: 60.78  E-value: 4.62e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254466  403 VGLAGVLLVALSVAAGLGLCSLIGISFNAATtQVLPFLALGVGVDDVFLLAHAFSETGQNKriPFEDRTGECLKRTGASV 482
Cdd:COG1033   594 KAIIPLIPIAIVVGWNFGLMGLLGIPLTPAT-ATLGAIILGIGVDYSIHITERYREERKKG--GPKEAIETTVERTGKAI 670
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254466  483 ALTSISnvTAFFMAALI--PIPALRAFSLQAAVVVVFNFAMVLLIFPAILSMdLYRREDR 540
Cdd:COG1033   671 LASALT--TAIGFLALIfsPFPIISNFGLLTVIGILLSLLASLVLLPALLVL-LDGRRKR 727
COG1033 COG1033
Predicted exporter protein, RND superfamily [General function prediction only];
334-531 1.04e-08

Predicted exporter protein, RND superfamily [General function prediction only];


Pssm-ID: 223964 [Multi-domain]  Cd Length: 727  Bit Score: 59.62  E-value: 1.04e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254466  334 QRTYVEVVHQSVAQNSTQKVLSFTTTTL-------DDILKSF-SDVSVIRVASGYLLMLA-YACLTMLRWdcsksqgavG 404
Cdd:COG1033   153 DAQKEEIYEEIERIIEIAKFPSGVKLYLtgdpairYQILREIqKDMVVLLALAVILMVIVlYYVFRSVRR---------A 223
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254466  405 LAGVLLVALSVAAGLGLCSLIGISFNAATTQVLPFLaLGVGVDDVFLLAHAFSETGQNKRIPFEdRTGECLKRTGASVAL 484
Cdd:COG1033   224 LLPLIIVLVSVLWTLGAMGLLGIPLTITTSAVPPLL-IGIGIDYGVHFHNRYEEERRKGRTVEE-AVVEAIKHTGPAVLI 301
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|....*..
gi 134254466  485 TSISNVTAFFMAALIPIPALRAFSLQAAVVVVFNFAMVLLIFPAILS 531
Cdd:COG1033   302 AALTTAAGFLSLLTSSIPAIKEFGILLSIGIILAFLSSLTVLPALLI 348
COG1033 COG1033
Predicted exporter protein, RND superfamily [General function prediction only];
968-1092 4.12e-08

Predicted exporter protein, RND superfamily [General function prediction only];


Pssm-ID: 223964 [Multi-domain]  Cd Length: 727  Bit Score: 57.70  E-value: 4.12e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254466  968 VVLACTFLVCAVFLLNPWTAGIIVMVLALMTVELFGMMGLIGIKLSavPVVILIAS--VGIGVEFTVHVALAFLTAI-GD 1044
Cdd:COG1033   576 LGIILVFALLLIIFRSPLKAIIPLIPIAIVVGWNFGLMGLLGIPLT--PATATLGAiiLGIGVDYSIHITERYREERkKG 653
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*....
gi 134254466 1045 KNRRAVL-ALEHMFAPVLDGAVSTLLGVLMLAGSEFDFIvRYFFAVLAI 1092
Cdd:COG1033   654 GPKEAIEtTVERTGKAILASALTTAIGFLALIFSPFPII-SNFGLLTVI 701
2A067 TIGR00921
The (Largely Archaeal Putative) Hydrophobe/Amphiphile Efflux-3 (HAE3) Family; Characterized ...
363-546 2.32e-07

The (Largely Archaeal Putative) Hydrophobe/Amphiphile Efflux-3 (HAE3) Family; Characterized members of the RND superfamily all probably catalyze substrate efflux via an H+ antiport mechanism. These proteins are found ubiquitously in bacteria, archaea and eukaryotes. They fall into seven phylogenetic families, this family (2.A.6.7) consists of uncharacterised putative transporters, largely in the Archaea. [Transport and binding proteins, Unknown substrate]


Pssm-ID: 273340 [Multi-domain]  Cd Length: 719  Bit Score: 55.23  E-value: 2.32e-07
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254466   363 DILKSFSDVSVIRVASGYLLMLAYACLTMLRWdcsksqgAVGLAGVLLVALSVAAGLGLCSLIGISFNAATTQVLPFLaL 442
Cdd:TIGR00921  186 DIEREFGKDMGTTMAISGILVVLVLLLDFKRW-------WRPLLPLVIILFGVAWVLGIMGWLGIPLYATTLLAVPML-I 257
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254466   443 GVGVDDVFLLAHAFSETGQNKRiPFEDRTGECLKRTGASVALTSISNVtAFFMAALIPI-PALRAFSLQAAVVVVFNFAM 521
Cdd:TIGR00921  258 GVGIDYGIQTLNRYEEERDIGR-AKGEAIVTAVRRTGRAVLIALLTTS-AGFAALALSEfPMVSEFGLGLVAGLITAYLL 335
                          170       180
                   ....*....|....*....|....*.
gi 134254466   522 VLLIFPAIL-SMDLYRREDRRLDIFC 546
Cdd:TIGR00921  336 TLLVLPALLqSIDIGREKVKKEIIAI 361
2A067 TIGR00921
The (Largely Archaeal Putative) Hydrophobe/Amphiphile Efflux-3 (HAE3) Family; Characterized ...
403-530 3.30e-06

The (Largely Archaeal Putative) Hydrophobe/Amphiphile Efflux-3 (HAE3) Family; Characterized members of the RND superfamily all probably catalyze substrate efflux via an H+ antiport mechanism. These proteins are found ubiquitously in bacteria, archaea and eukaryotes. They fall into seven phylogenetic families, this family (2.A.6.7) consists of uncharacterised putative transporters, largely in the Archaea. [Transport and binding proteins, Unknown substrate]


Pssm-ID: 273340 [Multi-domain]  Cd Length: 719  Bit Score: 51.76  E-value: 3.30e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254466   403 VGLAGVLLVALSVAAGLGLCSLIGISFNAaTTQVLPFLALGVGVDDVFLLAHAFSETgQNKRIPFEDRTgECLKRTGASV 482
Cdd:TIGR00921  593 KAVFPLIAIGSGILWAIGLMGLRGIPSFL-AMATTISIILGLGMDYSIHLAERYFEE-RKEHGPKEAIT-HTMERTGPGI 669
                           90       100       110       120
                   ....*....|....*....|....*....|....*....|....*...
gi 134254466   483 ALTSISNVTAFFMAALIPIPALRAFSLQAAVVVVFNFAMVLLIFPAIL 530
Cdd:TIGR00921  670 LFSGLTTAGGFLSLLLSHFPIMRNFGLVQGIGVLSSLTAALVVFPALL 717
COG1033 COG1033
Predicted exporter protein, RND superfamily [General function prediction only];
964-1095 7.09e-06

Predicted exporter protein, RND superfamily [General function prediction only];


Pssm-ID: 223964 [Multi-domain]  Cd Length: 727  Bit Score: 50.38  E-value: 7.09e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254466  964 LFISVVLACTFLVCAVFL-LNPWTAGIIVMVLALMTVEL-FGMMGLIGIKLSAVPVVILIASVGIGVEFTVHVALAFL-- 1039
Cdd:COG1033   198 MVVLLALAVILMVIVLYYvFRSVRRALLPLIIVLVSVLWtLGAMGLLGIPLTITTSAVPPLLIGIGIDYGVHFHNRYEee 277
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....*..
gi 134254466 1040 TAIGDKNRRAVL-ALEHMFAPVLDGAVSTLLGVLMLAGSEFDFIVRyfFAVLAILTI 1095
Cdd:COG1033   278 RRKGRTVEEAVVeAIKHTGPAVLIAALTTAAGFLSLLTSSIPAIKE--FGILLSIGI 332
AcrB COG0841
Multidrug efflux pump subunit AcrB [Defense mechanisms];
964-1092 1.52e-04

Multidrug efflux pump subunit AcrB [Defense mechanisms];


Pssm-ID: 223911 [Multi-domain]  Cd Length: 1009  Bit Score: 46.45  E-value: 1.52e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254466  964 LFISVVLActFLVCAVFLLNpWTAGIIVMV---LALMTVelFGMMGLIGIKLSAVPVVILIASVGIGVEFTVHVALAFLT 1040
Cdd:COG0841   335 LFEAIVLV--VLVMYLFLGN-LRATLIPALavpVSLLGT--FAVMYAFGFSLNTLTLFALVLAIGLLVDDAIVVVENIER 409
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....*....
gi 134254466 1041 AIGDKNRR--AVLALEHMFAPVLDGAVSTLLG---VLMLAGS--EFdfiVRYFFAVLAI 1092
Cdd:COG0841   410 HMRGLPPReaAEKAMGEIGGAVIAITLVLIAVflpMAFMGGStgEL---FRQFAITIAV 465
2A067 TIGR00921
The (Largely Archaeal Putative) Hydrophobe/Amphiphile Efflux-3 (HAE3) Family; Characterized ...
975-1085 2.22e-04

The (Largely Archaeal Putative) Hydrophobe/Amphiphile Efflux-3 (HAE3) Family; Characterized members of the RND superfamily all probably catalyze substrate efflux via an H+ antiport mechanism. These proteins are found ubiquitously in bacteria, archaea and eukaryotes. They fall into seven phylogenetic families, this family (2.A.6.7) consists of uncharacterised putative transporters, largely in the Archaea. [Transport and binding proteins, Unknown substrate]


Pssm-ID: 273340 [Multi-domain]  Cd Length: 719  Bit Score: 45.60  E-value: 2.22e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254466   975 LVCAVFLL--NPWTAGIIVMVLALMTVEL-FGMMGLIGIKLSAVPVVILIASVGIGVEFTVHVALAFLTAIG---DKNRR 1048
Cdd:TIGR00921  205 LVVLVLLLdfKRWWRPLLPLVIILFGVAWvLGIMGWLGIPLYATTLLAVPMLIGVGIDYGIQTLNRYEEERDigrAKGEA 284
                           90       100       110
                   ....*....|....*....|....*....|....*..
gi 134254466  1049 AVLALEHMFAPVLDGAVSTLLGVLMLAGSEFDFIVRY 1085
Cdd:TIGR00921  285 IVTAVRRTGRAVLIALLTTSAGFAALALSEFPMVSEF 321
YdfJ COG2409
Uncharacterized membrane protein YdfJ, MMPL/SSD domain [Function unknown];
401-532 3.05e-04

Uncharacterized membrane protein YdfJ, MMPL/SSD domain [Function unknown];


Pssm-ID: 225272 [Multi-domain]  Cd Length: 937  Bit Score: 45.10  E-value: 3.05e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254466  401 GAVGLAGVLL--VALSVAAGLGLCSLIGISFNAAT-TQVLPF---LALGVGVD-DVFLLA---HAFSEtGQNKripfEDR 470
Cdd:COG2409   206 RSVITAFLPLitVGLSLLVAQGIVALLAYAFGLGVsTFALSLlvaLGIGAGTDyALFLVSryrEELRE-GQDR----EAA 280
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 134254466  471 TGECLKRTGASVALTSISNVTAFFMAALIPIPALRAFSLQAAVVVVFNFAMVLLIFPAILSM 532
Cdd:COG2409   281 VGTAYRTAGKTVAFSGLTVAIALLGLSFARLPFLKTLGIAAAIGVAVAVLAALTLLPALLAL 342
PHA03377 PHA03377
EBNA-3C; Provisional
1181-1303 4.11e-04

EBNA-3C; Provisional


Pssm-ID: 177614 [Multi-domain]  Cd Length: 1000  Bit Score: 45.04  E-value: 4.11e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254466 1181 AGGPahQVIVEATENPVFAHSTVVHPES-RHHPPSNPRQ-QPHLDSGSLPPGRQGQQPRRDP-----PREGLW--PPPYR 1251
Cdd:PHA03377  695 AGRA--QPSEESHLSSMSPTQPISHEEQpRYEDPDDPLDlSLHPDQAPPPSHQAPYSGHEEPqaqqaPYPGYWepRPPQA 772
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|..
gi 134254466 1252 PRRDAFEISTEGHSGPSNRARWGPRGARSHNPRNPASTAMGSSVPGYCQPIT 1303
Cdd:PHA03377  773 PYLGYQEPQAQGVQVSSYPGYAGPWGLRAQHPRYRHSWAYWSQYPGHGHPQG 824
HpnN TIGR03480
hopanoid biosynthesis associated RND transporter like protein HpnN; The genomes containing ...
335-530 4.75e-04

hopanoid biosynthesis associated RND transporter like protein HpnN; The genomes containing members of this family share the machinery for the biosynthesis of hopanoid lipids. Furthermore, the genes of this family are usually located proximal to other components of this biological process. The proteins appear to be related to the RND family of export proteins, particularly the hydrophobe/amphiphile efflux-3 (HAE3) family represented by TIGR00921.


Pssm-ID: 274598 [Multi-domain]  Cd Length: 862  Bit Score: 44.60  E-value: 4.75e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254466   335 RTYVEVVhQSVAQNSTQKVLSFTTTTlDDILKSFsdvsvIRVASGYLLMLAYACLTMLRwdcSKSQGAVGLAGVLLVALS 414
Cdd:TIGR03480  683 RRFVRAV-RKVAPDATGAPVSILESG-DTVVGAF-----LQAFIYALVAITVLLLLTLR---RVRDVLLVLAPLLLAGLL 752
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254466   415 VAAglgLCSLIGISFNAATTQVLPFLaLGVGVDDVFLLAHAFSEtGQNKRIPFEDRTGEclkrtgaSVALTSISNVTAFF 494
Cdd:TIGR03480  753 TVA---AMVLLGIPFNFANIIALPLL-LGLGVDFGIYMVHRWRN-GVDSGNLLQSSTAR-------AVFFSALTTATAFG 820
                          170       180       190
                   ....*....|....*....|....*....|....*.
gi 134254466   495 MAALIPIPALRAFSLQAAVVVVFNFAMVLLIFPAIL 530
Cdd:TIGR03480  821 SLAVSSHPGTASMGILLSLGLGLTLLCTLIFLPALL 856
COG4258 COG4258
Predicted exporter [General function prediction only];
365-528 8.23e-04

Predicted exporter [General function prediction only];


Pssm-ID: 226709 [Multi-domain]  Cd Length: 788  Bit Score: 43.71  E-value: 8.23e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254466  365 LKSFSD---VSVIRVASGYLL--MLAYACLTMLRWDCSKsqGAVGLAGVLLVALSVAAGLGLCsliGISFNAATTQVLpF 439
Cdd:COG4258   633 RKSTFDrlfAAYRYVLAGLLAgaLALVLCLAVARRGWRR--GLRVLLPSVLALGCGLAVLAMA---GVPLNLFHLLAL-V 706
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254466  440 LALGVGVDdvflLAHAFSETGQNKRIPFedrtgeclkRTGASVALTSISNVTAFFMAALIPIPALRAFSLQAAVVVVFNF 519
Cdd:COG4258   707 LVLGVGIN----YALFFSNAGDPRAEPL---------TTLLALALAMLTTLLTFGLLAFSATPVLSSFGITLASGIILAF 773

                  ....*....
gi 134254466  520 AMVLLIFPA 528
Cdd:COG4258   774 VLAPLAMPD 782
MMPL pfam03176
MMPL family; Members of this family are putative integral membrane proteins from bacteria. ...
401-532 3.83e-03

MMPL family; Members of this family are putative integral membrane proteins from bacteria. Several of the members are mycobacterial proteins. Many of the proteins contain two copies of this aligned region. The function of these proteins is not known, although it has been suggested that they may be involved in lipid transport.


Pssm-ID: 308676 [Multi-domain]  Cd Length: 332  Bit Score: 41.12  E-value: 3.83e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254466   401 GAVGLAGVLL--VALSVAAGLGLCS-LIGISFNAATTQVLPF---LALGVGVD-DVFLLA--HAFSETGQNKripfEDRT 471
Cdd:pfam03176  164 RSVVAALLPLltVGLSLGAAQGLVAiLAHILGIGLSTFALNLlvvLLIAVGTDyALFLVSryREELRAGEDR----EEAV 239
                           90       100       110       120       130       140
                   ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 134254466   472 GECLKRTGASVALTSISNVTAFFMAALIPIPALRAFSLQAAVVVVFNFAMVLLIFPAILSM 532
Cdd:pfam03176  240 IRAVRGTGKVVTAAGLTVAIAMLALSFARLPVFAQVGPTIAIGVLVDVLAALTLLPALLAL 300
2A067 TIGR00921
The (Largely Archaeal Putative) Hydrophobe/Amphiphile Efflux-3 (HAE3) Family; Characterized ...
970-1095 5.61e-03

The (Largely Archaeal Putative) Hydrophobe/Amphiphile Efflux-3 (HAE3) Family; Characterized members of the RND superfamily all probably catalyze substrate efflux via an H+ antiport mechanism. These proteins are found ubiquitously in bacteria, archaea and eukaryotes. They fall into seven phylogenetic families, this family (2.A.6.7) consists of uncharacterised putative transporters, largely in the Archaea. [Transport and binding proteins, Unknown substrate]


Pssm-ID: 273340 [Multi-domain]  Cd Length: 719  Bit Score: 40.98  E-value: 5.61e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254466   970 LACTFLVCAVFLL---NPWTAgiIVMVLALMTVELF--GMMGLIGIKLSAVPVVILIASVGIGVEFTVHVALAFL---TA 1041
Cdd:TIGR00921  574 IAGAILVLMILLAvfrNPIKA--VFPLIAIGSGILWaiGLMGLRGIPSFLAMATTISIILGLGMDYSIHLAERYFeerKE 651
                           90       100       110       120       130       140
                   ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 134254466  1042 IGDKNrrAVL-ALEHMFAPVLDGAVSTLLGVLMLAGSEFDFI--------VRYFFAVLAILTI 1095
Cdd:TIGR00921  652 HGPKE--AIThTMERTGPGILFSGLTTAGGFLSLLLSHFPIMrnfglvqgIGVLSSLTAALVV 712
PHA03307 PHA03307
transcriptional regulator ICP4; Provisional
1163-1297 6.66e-03

transcriptional regulator ICP4; Provisional


Pssm-ID: 223039 [Multi-domain]  Cd Length: 1352  Bit Score: 40.92  E-value: 6.66e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254466 1163 TTVSGLSEELRhyeAQQGAGGPAHQVIVEATENPVFAHSTVVHP----------ESRHHPPSNPRQQPHLDSGslPPGRQ 1232
Cdd:PHA03307  129 SPAPDLSEMLR---PVGSPGPPPAASPPAAGASPAAVASDAASSrqaalplsspEETARAPSSPPAEPPPSTP--PAAAS 203
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 134254466 1233 GQQPRRDPPR--EGLWPPPYRPRRDAFEISTE---GHSGPSNRARWGPRGA--RSHNPRNPASTAMGSSVPG 1297
Cdd:PHA03307  204 PRPPRRSSPIsaSASSPAPAPGRSAADDAGASssdSSSSESSGCGWGPENEcpLPRPAPITLPTRIWEASGW 275
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH