NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|134254435|ref|NP_001077075|]
View 

protein patched homolog 1 isoform S [Homo sapiens]

Protein Classification

2A060602 family protein (domain architecture ID 12852140)

2A060602 family protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
2A060602 TIGR00918
The Eukaryotic (Putative) Sterol Transporter (EST) Family;
1-1055 0e+00

The Eukaryotic (Putative) Sterol Transporter (EST) Family;


:

Pssm-ID: 273338  Cd Length: 1145  Bit Score: 1900.76  E-value: 0e+00
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254435     1 MFNPQLMIQTPKEEGANVLTTEALLQHLDSALQASRVHVYMYNRQWKLEHLCYKSGELITETGYMDQIIEYLYPCLIITP 80
Cdd:TIGR00918  112 MFTPQLLIQTPHQEGANVLTPEALLQHLDSALKASRVHVYLYNRQWGLEHLCYKSGEPSTEGGYIEQILEKLIPCLIITP 191
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254435    81 LDCFWEGAKLQSGTAYLLGKPPLRWTNFDPLEFLEELKKINYQVDSWEEMLNKAEVGHGYMDRPCLNPADPDCPATAPNK 160
Cdd:TIGR00918  192 LDCFWEGAKLQGGTAYLPGKPPLQWTNLDPASFLEELKQKMSQVESWEEMLKKAAVGQGYMERPCLNPADPDCPDTAPNK 271
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254435   161 NSTKPLDMALVLNGGCHGLSRKYMHWQEELIVGGTVKNSTGKLVSAHALQTMFQLMTPKQMYEHFKGYEYVSHINWNEDK 240
Cdd:TIGR00918  272 NSTQPPDVAAVLSGGCYGLSAKYMHWQEELIVGGTKRNRSGKLLSAQALQSMFQLMTPKQMYEHFKGYYKVHHIGWNEEK 351
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254435   241 AAAILEAWQRTYVEVVHQSVAQNSTQKVLSFTTTTLDDILKSFSDVSVIRVASGYLLMLAYACLTMLRWDCSKSQGAVGL 320
Cdd:TIGR00918  352 AAAVLEAWQRNFSEEVQQSLPKNSSQKILVFSSTTLDDILKKFSDVSAIRIVSGYLLMLAYACLTMLRWDCAKSQGSVGL 431
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254435   321 AGVLLVALSVAAGLGLCSLIGISFNAATTQVLPFLALGVGVDDVFLLAHAFSETGQNkrIPFEDRTGECLKRTGASVALT 400
Cdd:TIGR00918  432 AGVLLVALSVAAGLGLCALLGISFNAATTQVLPFLALGVGVDDVFLLAHAFSETGQN--IPFEERTGECLKRTGASVVLT 509
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254435   401 SISNVTAFFMAALIPIPALRAFSLQAAVVVVFNFAMVLLIFPAILSMDLYRREDRRLDIFCCFTSPCVSRVIQVEPQAYT 480
Cdd:TIGR00918  510 SISNVTAFFMAALIPIPALRAFSLQAAIVVVFNFAAVLLVFPAILSLDLRRREDRRLDIFCCFFSPCSARVIQIEPQAYA 589
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254435   481 DThdntryspppPYSSHSFAHetqitMQSTVQLRTEYDPHTHVYYTTAEPRSEISVQPvtvtQDTLSCQSPESTSSTRDL 560
Cdd:TIGR00918  590 DG----------SAPPVYSSH-----MQSTVQLRTEYDPGTQHYYTTNEPRSHLSVQP----SDPLSCQSPDIAGSTRDL 650
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254435   561 LSQFSDSSLHCLEPPCTKWTLSSFAEKHYAPFLLKPKAKVVVIFLFLGLLGVSLYGTTRVRDGLDLTDIVPRETREYDFI 640
Cdd:TIGR00918  651 LSQFEDSKAACLSLPCARWTLATFAEKHYAPFLLQSWAKVVVIFLFLALLGLSLYGTTRVQDGLDLTDIVPRDTNEHDFL 730
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254435   641 AAQFKYFSFYNMYIVTQK-ADYPNIQHLLYDLHRSFSNVKYVMLEENKQLPKMWLHYFRDWLQGLQDAFDSDWETGKIMP 719
Cdd:TIGR00918  731 DAQFRYFSFYNMYAVTQGnFDYPTQQQLLYDLHQSFSSVKYVLKEDNGQLPRMWLHYFRDWLQGLQKAFDEDWRDGRITK 810
                          730       740       750       760       770       780       790       800
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254435   720 NNYKNGSDDGVLAYKLLVQTGSRDKPIDISQLTKQRLVDADGIINPSAFYIYLTAWVSNDPVAYAASQANIRPHRPEWVH 799
Cdd:TIGR00918  811 ENYRNGSDDAVLAYKLLVQTGHRDKPVDKEQLTTQRLVNADGIINPNAFYIYLSAWVSNDPVAYAASQANIYPHPPEWLH 890
                          810       820       830       840       850       860       870       880
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254435   800 DKADYMPETrLRIPAAEPIEYAQFPFYLNGLRDTSDFVEAIEKVRTICSNYTSLGLSSYPNGYPFLFWEQYIGLRHWLLL 879
Cdd:TIGR00918  891 DKNDYDPEN-LRIPAAEPLEYAQFPFYLNGLRETSQFVEAIEHVRAICNNYEGFGLPSYPSGYPFLFWEQYMGLRHWLLL 969
                          890       900       910       920       930       940       950       960
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254435   880 FISVVLACTFLVCAVFLLNPWTAGIIVMVLALMTVELFGMMGLIGIKLSAVPVVILIASVGIGVEFTVHVALAFLTAIGD 959
Cdd:TIGR00918  970 SISVVLACTFLVCALLLLNPWTAGLIVLVLALMTVELFGMMGLLGIKLSAIPVVILIASVGIGVEFTVHIALGFLTAIGD 1049
                          970       980       990      1000      1010      1020      1030      1040
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254435   960 KNRRAVLALEHMFAPVLDGAVSTLLGVLMLAGSEFDFIVRYFFAVLAILTILGVLNGLVLLPVLLSFFGPYPEVSPANGL 1039
Cdd:TIGR00918 1050 RNRRAVLALEHMFAPVLDGALSTLLGVLMLAGSEFDFIVRYFFAVLAVLTCLGVLNGLVLLPVLLSMFGPEPEVSPAEGR 1129
                         1050
                   ....*....|....*.
gi 134254435  1040 NRLPTPSPEPPPSVVR 1055
Cdd:TIGR00918 1130 SRLPTPSPEPPPGGVR 1145
PHA03377 super family cl31823
EBNA-3C; Provisional
1102-1218 6.03e-04

EBNA-3C; Provisional


The actual alignment was detected with superfamily member PHA03377:

Pssm-ID: 177614 [Multi-domain]  Cd Length: 1000  Bit Score: 44.27  E-value: 6.03e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254435 1102 QVIVEATENPVFAHSTVVHPES-RHHPPSNPRQ-QPHLDSGSLPPGRQGQQPRRDP-----PREGLW--PPPYRPRRDAF 1172
Cdd:PHA03377  699 QPSEESHLSSMSPTQPISHEEQpRYEDPDDPLDlSLHPDQAPPPSHQAPYSGHEEPqaqqaPYPGYWepRPPQAPYLGYQ 778
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*.
gi 134254435 1173 EISTEGHSGPSNRARWGPRGARSHNPRNPASTAMGSSVPGYCQPIT 1218
Cdd:PHA03377  779 EPQAQGVQVSSYPGYAGPWGLRAQHPRYRHSWAYWSQYPGHGHPQG 824
 
Name Accession Description Interval E-value
2A060602 TIGR00918
The Eukaryotic (Putative) Sterol Transporter (EST) Family;
1-1055 0e+00

The Eukaryotic (Putative) Sterol Transporter (EST) Family;


Pssm-ID: 273338  Cd Length: 1145  Bit Score: 1900.76  E-value: 0e+00
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254435     1 MFNPQLMIQTPKEEGANVLTTEALLQHLDSALQASRVHVYMYNRQWKLEHLCYKSGELITETGYMDQIIEYLYPCLIITP 80
Cdd:TIGR00918  112 MFTPQLLIQTPHQEGANVLTPEALLQHLDSALKASRVHVYLYNRQWGLEHLCYKSGEPSTEGGYIEQILEKLIPCLIITP 191
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254435    81 LDCFWEGAKLQSGTAYLLGKPPLRWTNFDPLEFLEELKKINYQVDSWEEMLNKAEVGHGYMDRPCLNPADPDCPATAPNK 160
Cdd:TIGR00918  192 LDCFWEGAKLQGGTAYLPGKPPLQWTNLDPASFLEELKQKMSQVESWEEMLKKAAVGQGYMERPCLNPADPDCPDTAPNK 271
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254435   161 NSTKPLDMALVLNGGCHGLSRKYMHWQEELIVGGTVKNSTGKLVSAHALQTMFQLMTPKQMYEHFKGYEYVSHINWNEDK 240
Cdd:TIGR00918  272 NSTQPPDVAAVLSGGCYGLSAKYMHWQEELIVGGTKRNRSGKLLSAQALQSMFQLMTPKQMYEHFKGYYKVHHIGWNEEK 351
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254435   241 AAAILEAWQRTYVEVVHQSVAQNSTQKVLSFTTTTLDDILKSFSDVSVIRVASGYLLMLAYACLTMLRWDCSKSQGAVGL 320
Cdd:TIGR00918  352 AAAVLEAWQRNFSEEVQQSLPKNSSQKILVFSSTTLDDILKKFSDVSAIRIVSGYLLMLAYACLTMLRWDCAKSQGSVGL 431
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254435   321 AGVLLVALSVAAGLGLCSLIGISFNAATTQVLPFLALGVGVDDVFLLAHAFSETGQNkrIPFEDRTGECLKRTGASVALT 400
Cdd:TIGR00918  432 AGVLLVALSVAAGLGLCALLGISFNAATTQVLPFLALGVGVDDVFLLAHAFSETGQN--IPFEERTGECLKRTGASVVLT 509
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254435   401 SISNVTAFFMAALIPIPALRAFSLQAAVVVVFNFAMVLLIFPAILSMDLYRREDRRLDIFCCFTSPCVSRVIQVEPQAYT 480
Cdd:TIGR00918  510 SISNVTAFFMAALIPIPALRAFSLQAAIVVVFNFAAVLLVFPAILSLDLRRREDRRLDIFCCFFSPCSARVIQIEPQAYA 589
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254435   481 DThdntryspppPYSSHSFAHetqitMQSTVQLRTEYDPHTHVYYTTAEPRSEISVQPvtvtQDTLSCQSPESTSSTRDL 560
Cdd:TIGR00918  590 DG----------SAPPVYSSH-----MQSTVQLRTEYDPGTQHYYTTNEPRSHLSVQP----SDPLSCQSPDIAGSTRDL 650
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254435   561 LSQFSDSSLHCLEPPCTKWTLSSFAEKHYAPFLLKPKAKVVVIFLFLGLLGVSLYGTTRVRDGLDLTDIVPRETREYDFI 640
Cdd:TIGR00918  651 LSQFEDSKAACLSLPCARWTLATFAEKHYAPFLLQSWAKVVVIFLFLALLGLSLYGTTRVQDGLDLTDIVPRDTNEHDFL 730
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254435   641 AAQFKYFSFYNMYIVTQK-ADYPNIQHLLYDLHRSFSNVKYVMLEENKQLPKMWLHYFRDWLQGLQDAFDSDWETGKIMP 719
Cdd:TIGR00918  731 DAQFRYFSFYNMYAVTQGnFDYPTQQQLLYDLHQSFSSVKYVLKEDNGQLPRMWLHYFRDWLQGLQKAFDEDWRDGRITK 810
                          730       740       750       760       770       780       790       800
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254435   720 NNYKNGSDDGVLAYKLLVQTGSRDKPIDISQLTKQRLVDADGIINPSAFYIYLTAWVSNDPVAYAASQANIRPHRPEWVH 799
Cdd:TIGR00918  811 ENYRNGSDDAVLAYKLLVQTGHRDKPVDKEQLTTQRLVNADGIINPNAFYIYLSAWVSNDPVAYAASQANIYPHPPEWLH 890
                          810       820       830       840       850       860       870       880
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254435   800 DKADYMPETrLRIPAAEPIEYAQFPFYLNGLRDTSDFVEAIEKVRTICSNYTSLGLSSYPNGYPFLFWEQYIGLRHWLLL 879
Cdd:TIGR00918  891 DKNDYDPEN-LRIPAAEPLEYAQFPFYLNGLRETSQFVEAIEHVRAICNNYEGFGLPSYPSGYPFLFWEQYMGLRHWLLL 969
                          890       900       910       920       930       940       950       960
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254435   880 FISVVLACTFLVCAVFLLNPWTAGIIVMVLALMTVELFGMMGLIGIKLSAVPVVILIASVGIGVEFTVHVALAFLTAIGD 959
Cdd:TIGR00918  970 SISVVLACTFLVCALLLLNPWTAGLIVLVLALMTVELFGMMGLLGIKLSAIPVVILIASVGIGVEFTVHIALGFLTAIGD 1049
                          970       980       990      1000      1010      1020      1030      1040
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254435   960 KNRRAVLALEHMFAPVLDGAVSTLLGVLMLAGSEFDFIVRYFFAVLAILTILGVLNGLVLLPVLLSFFGPYPEVSPANGL 1039
Cdd:TIGR00918 1050 RNRRAVLALEHMFAPVLDGALSTLLGVLMLAGSEFDFIVRYFFAVLAVLTCLGVLNGLVLLPVLLSMFGPEPEVSPAEGR 1129
                         1050
                   ....*....|....*.
gi 134254435  1040 NRLPTPSPEPPPSVVR 1055
Cdd:TIGR00918 1130 SRLPTPSPEPPPGGVR 1145
Sterol-sensing pfam12349
Sterol-sensing domain of SREBP cleavage-activation; Sterol regulatory element-binding proteins ...
311-465 1.41e-50

Sterol-sensing domain of SREBP cleavage-activation; Sterol regulatory element-binding proteins (SREBPs) are membrane-bound transcription factors that promote lipid synthesis in animal cells. They are embedded in the membranes of the endoplasmic reticulum (ER) in a helical hairpin orientation and are released from the ER by a two-step proteolytic process. Proteolysis begins when the SREBPs are cleaved at Site-1, which is located at a leucine residue in the middle of the hydrophobic loop in the lumen of the ER. Upon proteolytic processing SREBP can activate the expression of genes involved in cholesterol biosynthesis and uptake. SCAP stimulates cleavage of SREBPs via fusion of the their two C-termini. This domain is the transmembrane region that traverses the membrane eight times and is the sterol-sensing domain of the cleavage protein. WD40 domains are found towards the C-terminus.


Pssm-ID: 403533 [Multi-domain]  Cd Length: 153  Bit Score: 175.47  E-value: 1.41e-50
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254435   311 CSKSQGAVGLAGVLLVALSVAAGLGLCSLIGISFNAATTQVLPFLALGVGVDDVFLLAHAFSETgqNKRIPFEDRTGECL 390
Cdd:pfam12349    1 MVKSKFGLGLAGVIIVLASVASSLGLCAYFGLTLTLIISEVIPFLVLAIGVDNIFILVKAVQRT--PRSLDVSERIAEAL 78
                           90       100       110       120       130       140       150
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 134254435   391 KRTGASVALTSISNVTAFFMAALIPIPALRAFSLQAAVVVVFNFAMVLLIFPAILSMDLYRREDRRLDIFCCFTS 465
Cdd:pfam12349   79 GQVGPSILLTSLTEILAFLIGALTDMPAVQEFCLFAAVALLFDFLLQMTFFVAVLSLDIRRLESNRLDVLCCVRS 153
COG1033 COG1033
Predicted exporter protein, RND superfamily [General function prediction only];
318-455 4.06e-09

Predicted exporter protein, RND superfamily [General function prediction only];


Pssm-ID: 223964 [Multi-domain]  Cd Length: 727  Bit Score: 60.78  E-value: 4.06e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254435  318 VGLAGVLLVALSVAAGLGLCSLIGISFNAATtQVLPFLALGVGVDDVFLLAHAFSETGQNKriPFEDRTGECLKRTGASV 397
Cdd:COG1033   594 KAIIPLIPIAIVVGWNFGLMGLLGIPLTPAT-ATLGAIILGIGVDYSIHITERYREERKKG--GPKEAIETTVERTGKAI 670
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254435  398 ALTSISnvTAFFMAALI--PIPALRAFSLQAAVVVVFNFAMVLLIFPAILSMdLYRREDR 455
Cdd:COG1033   671 LASALT--TAIGFLALIfsPFPIISNFGLLTVIGILLSLLASLVLLPALLVL-LDGRRKR 727
PHA03377 PHA03377
EBNA-3C; Provisional
1102-1218 6.03e-04

EBNA-3C; Provisional


Pssm-ID: 177614 [Multi-domain]  Cd Length: 1000  Bit Score: 44.27  E-value: 6.03e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254435 1102 QVIVEATENPVFAHSTVVHPES-RHHPPSNPRQ-QPHLDSGSLPPGRQGQQPRRDP-----PREGLW--PPPYRPRRDAF 1172
Cdd:PHA03377  699 QPSEESHLSSMSPTQPISHEEQpRYEDPDDPLDlSLHPDQAPPPSHQAPYSGHEEPqaqqaPYPGYWepRPPQAPYLGYQ 778
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*.
gi 134254435 1173 EISTEGHSGPSNRARWGPRGARSHNPRNPASTAMGSSVPGYCQPIT 1218
Cdd:PHA03377  779 EPQAQGVQVSSYPGYAGPWGLRAQHPRYRHSWAYWSQYPGHGHPQG 824
 
Name Accession Description Interval E-value
2A060602 TIGR00918
The Eukaryotic (Putative) Sterol Transporter (EST) Family;
1-1055 0e+00

The Eukaryotic (Putative) Sterol Transporter (EST) Family;


Pssm-ID: 273338  Cd Length: 1145  Bit Score: 1900.76  E-value: 0e+00
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254435     1 MFNPQLMIQTPKEEGANVLTTEALLQHLDSALQASRVHVYMYNRQWKLEHLCYKSGELITETGYMDQIIEYLYPCLIITP 80
Cdd:TIGR00918  112 MFTPQLLIQTPHQEGANVLTPEALLQHLDSALKASRVHVYLYNRQWGLEHLCYKSGEPSTEGGYIEQILEKLIPCLIITP 191
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254435    81 LDCFWEGAKLQSGTAYLLGKPPLRWTNFDPLEFLEELKKINYQVDSWEEMLNKAEVGHGYMDRPCLNPADPDCPATAPNK 160
Cdd:TIGR00918  192 LDCFWEGAKLQGGTAYLPGKPPLQWTNLDPASFLEELKQKMSQVESWEEMLKKAAVGQGYMERPCLNPADPDCPDTAPNK 271
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254435   161 NSTKPLDMALVLNGGCHGLSRKYMHWQEELIVGGTVKNSTGKLVSAHALQTMFQLMTPKQMYEHFKGYEYVSHINWNEDK 240
Cdd:TIGR00918  272 NSTQPPDVAAVLSGGCYGLSAKYMHWQEELIVGGTKRNRSGKLLSAQALQSMFQLMTPKQMYEHFKGYYKVHHIGWNEEK 351
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254435   241 AAAILEAWQRTYVEVVHQSVAQNSTQKVLSFTTTTLDDILKSFSDVSVIRVASGYLLMLAYACLTMLRWDCSKSQGAVGL 320
Cdd:TIGR00918  352 AAAVLEAWQRNFSEEVQQSLPKNSSQKILVFSSTTLDDILKKFSDVSAIRIVSGYLLMLAYACLTMLRWDCAKSQGSVGL 431
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254435   321 AGVLLVALSVAAGLGLCSLIGISFNAATTQVLPFLALGVGVDDVFLLAHAFSETGQNkrIPFEDRTGECLKRTGASVALT 400
Cdd:TIGR00918  432 AGVLLVALSVAAGLGLCALLGISFNAATTQVLPFLALGVGVDDVFLLAHAFSETGQN--IPFEERTGECLKRTGASVVLT 509
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254435   401 SISNVTAFFMAALIPIPALRAFSLQAAVVVVFNFAMVLLIFPAILSMDLYRREDRRLDIFCCFTSPCVSRVIQVEPQAYT 480
Cdd:TIGR00918  510 SISNVTAFFMAALIPIPALRAFSLQAAIVVVFNFAAVLLVFPAILSLDLRRREDRRLDIFCCFFSPCSARVIQIEPQAYA 589
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254435   481 DThdntryspppPYSSHSFAHetqitMQSTVQLRTEYDPHTHVYYTTAEPRSEISVQPvtvtQDTLSCQSPESTSSTRDL 560
Cdd:TIGR00918  590 DG----------SAPPVYSSH-----MQSTVQLRTEYDPGTQHYYTTNEPRSHLSVQP----SDPLSCQSPDIAGSTRDL 650
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254435   561 LSQFSDSSLHCLEPPCTKWTLSSFAEKHYAPFLLKPKAKVVVIFLFLGLLGVSLYGTTRVRDGLDLTDIVPRETREYDFI 640
Cdd:TIGR00918  651 LSQFEDSKAACLSLPCARWTLATFAEKHYAPFLLQSWAKVVVIFLFLALLGLSLYGTTRVQDGLDLTDIVPRDTNEHDFL 730
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254435   641 AAQFKYFSFYNMYIVTQK-ADYPNIQHLLYDLHRSFSNVKYVMLEENKQLPKMWLHYFRDWLQGLQDAFDSDWETGKIMP 719
Cdd:TIGR00918  731 DAQFRYFSFYNMYAVTQGnFDYPTQQQLLYDLHQSFSSVKYVLKEDNGQLPRMWLHYFRDWLQGLQKAFDEDWRDGRITK 810
                          730       740       750       760       770       780       790       800
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254435   720 NNYKNGSDDGVLAYKLLVQTGSRDKPIDISQLTKQRLVDADGIINPSAFYIYLTAWVSNDPVAYAASQANIRPHRPEWVH 799
Cdd:TIGR00918  811 ENYRNGSDDAVLAYKLLVQTGHRDKPVDKEQLTTQRLVNADGIINPNAFYIYLSAWVSNDPVAYAASQANIYPHPPEWLH 890
                          810       820       830       840       850       860       870       880
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254435   800 DKADYMPETrLRIPAAEPIEYAQFPFYLNGLRDTSDFVEAIEKVRTICSNYTSLGLSSYPNGYPFLFWEQYIGLRHWLLL 879
Cdd:TIGR00918  891 DKNDYDPEN-LRIPAAEPLEYAQFPFYLNGLRETSQFVEAIEHVRAICNNYEGFGLPSYPSGYPFLFWEQYMGLRHWLLL 969
                          890       900       910       920       930       940       950       960
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254435   880 FISVVLACTFLVCAVFLLNPWTAGIIVMVLALMTVELFGMMGLIGIKLSAVPVVILIASVGIGVEFTVHVALAFLTAIGD 959
Cdd:TIGR00918  970 SISVVLACTFLVCALLLLNPWTAGLIVLVLALMTVELFGMMGLLGIKLSAIPVVILIASVGIGVEFTVHIALGFLTAIGD 1049
                          970       980       990      1000      1010      1020      1030      1040
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254435   960 KNRRAVLALEHMFAPVLDGAVSTLLGVLMLAGSEFDFIVRYFFAVLAILTILGVLNGLVLLPVLLSFFGPYPEVSPANGL 1039
Cdd:TIGR00918 1050 RNRRAVLALEHMFAPVLDGALSTLLGVLMLAGSEFDFIVRYFFAVLAVLTCLGVLNGLVLLPVLLSMFGPEPEVSPAEGR 1129
                         1050
                   ....*....|....*.
gi 134254435  1040 NRLPTPSPEPPPSVVR 1055
Cdd:TIGR00918 1130 SRLPTPSPEPPPGGVR 1145
2A060601 TIGR00917
Niemann-Pick C type protein family; The model describes Niemann-Pick C type protein in ...
247-1028 3.24e-66

Niemann-Pick C type protein family; The model describes Niemann-Pick C type protein in eukaryotes. The defective protein has been associated with Niemann-Pick disease which is described in humans as autosomal recessive lipidosis. It is characterized by the lysosomal accumulation of unestrified cholesterol. It is an integral membrane protein, which indicates that this protein is most likely involved in cholesterol transport or acts as some component of cholesterol homeostasis. [Transport and binding proteins, Other]


Pssm-ID: 273337 [Multi-domain]  Cd Length: 1205  Bit Score: 245.59  E-value: 3.24e-66
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254435   247 AWQRTYVEVVhQSVAQNSTQKVLSFTT-TTLDDILKSFSDVSVIRVASGYLLMLAYACLTM-----LRWDCSKSQGAVGL 320
Cdd:TIGR00917  533 AWEKAFIQLA-KDELLPMVQATISFSAeRSIEDELKRESTADVITIAISYLVMFAYISLTLgdsprLKSLYVTSKVLLGL 611
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254435   321 AGVLLVALSVAAGLGLCSLIGISFNAATTQVLPFLALGVGVDDVFLLAHAF---------SETGQNKRIPFEDRTGECLK 391
Cdd:TIGR00917  612 SGILIVMLSVLGSVGVFSAVGLKSTLIIMEVIPFLVLAVGVDNIFILVFFYfyleyfyrqVGVDNEQELTLERRLSRALM 691
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254435   392 RTGASVALTSISNVTAFFMAALIPIPALRAFSLQAAVVVVFNFAMVLLIFPAILSMDLYRREDRRLDIFCCftspcvsrv 471
Cdd:TIGR00917  692 EVGPSITLASLSEILAFALGALIKMPAVRVFSMFAVLAVFLDFLLQITAFVALLVLDFKRTEDKRVDCFPC--------- 762
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254435   472 IQVEPQAYTDThdntrysppppysshsfahetqitmqstvqlrteydphthvyyTTAEPRSEisvqpvtvtqdtlSCqsp 551
Cdd:TIGR00917  763 IKTSKSSISAE-------------------------------------------KGSGQRKA-------------GL--- 783
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254435   552 estsstrdllsqfsdsslhcleppctkwtLSSFAEKHYAPFLLKPKAKVVVIFLFLGLLGVSLYGTTRVRDGLDLTDIVP 631
Cdd:TIGR00917  784 -----------------------------LTRYFKEVYAPVLLHWIVKIVVIAFFVGLLMAGIALSTRVEIGLDQQIVLP 834
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254435   632 RETREYDFIAAQFKYFSFYNMYIVTQKADYPniqhllYDLHRSFSNVKYVMLEENKQL-------------PKMWLHYFR 698
Cdd:TIGR00917  835 QDSYLQIYFASLTPLLEVGPPFYIVIKGDYN------YTDFESQNKLCTMGGCDKDSIvnvfnnlsyiakpASSWLDDYL 908
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254435   699 DWLQGLQDAFDSDWETGKimpnnYKNGSDDGVLAYKllvqtgsrdkpiDISQLTKQRlvdadgiINPSAFYIYLTAWVSN 778
Cdd:TIGR00917  909 VWLSPQASCCCRKFTNGT-----FCNGPDPQCFRCA------------DLSSDAQGR-------PSTTQFKEKLPWFLNA 964
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254435   779 DP--------VAYAASQANIRPHrpewvhdkadympetrlripaAEPIEYAQFPFYLNGLRDTSDFVEAIEKVRTICSNY 850
Cdd:TIGR00917  965 LPsadcakggHAAYSSAVDLQGY---------------------ATIIQASSFRTYHTPLNTQVDFINAMRAAQEFAAKV 1023
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254435   851 T-SLGLSSYPNGYPFLFWEQYIGLRHWLLLFISVVLACTFLVCAVFL-LNPWTAGIIVMVLALMTVELFGMMGLIGIKLS 928
Cdd:TIGR00917 1024 SrSSKMEVYPYSVFYVFFEQYLTIWKTAIINLSIALGAIFIVCLFLLqLNALSVVNLIMSVGMAVVFCVGIMHLWSISLN 1103
                          730       740       750       760       770       780       790       800
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254435   929 AVPVVILIASVGIGVEFTVHVALAFLTAI-GDKNRRAVLALEHMFAPVLDGAVST-LLGVLMLAGSEFDFIVRYFFAVLA 1006
Cdd:TIGR00917 1104 AVSVVNSVMHKGIAIEFCTHINAQFSTGKhFSRNHRAKEALGGMGSSVFSGITLTkLVGVVVLGFSRSEIFVVYYFRMYL 1183
                          810       820
                   ....*....|....*....|..
gi 134254435  1007 ILTILGVLNGLVLLPVLLSFFG 1028
Cdd:TIGR00917 1184 ALVLLGFLHGLVFLPVLLSVLG 1205
Sterol-sensing pfam12349
Sterol-sensing domain of SREBP cleavage-activation; Sterol regulatory element-binding proteins ...
311-465 1.41e-50

Sterol-sensing domain of SREBP cleavage-activation; Sterol regulatory element-binding proteins (SREBPs) are membrane-bound transcription factors that promote lipid synthesis in animal cells. They are embedded in the membranes of the endoplasmic reticulum (ER) in a helical hairpin orientation and are released from the ER by a two-step proteolytic process. Proteolysis begins when the SREBPs are cleaved at Site-1, which is located at a leucine residue in the middle of the hydrophobic loop in the lumen of the ER. Upon proteolytic processing SREBP can activate the expression of genes involved in cholesterol biosynthesis and uptake. SCAP stimulates cleavage of SREBPs via fusion of the their two C-termini. This domain is the transmembrane region that traverses the membrane eight times and is the sterol-sensing domain of the cleavage protein. WD40 domains are found towards the C-terminus.


Pssm-ID: 403533 [Multi-domain]  Cd Length: 153  Bit Score: 175.47  E-value: 1.41e-50
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254435   311 CSKSQGAVGLAGVLLVALSVAAGLGLCSLIGISFNAATTQVLPFLALGVGVDDVFLLAHAFSETgqNKRIPFEDRTGECL 390
Cdd:pfam12349    1 MVKSKFGLGLAGVIIVLASVASSLGLCAYFGLTLTLIISEVIPFLVLAIGVDNIFILVKAVQRT--PRSLDVSERIAEAL 78
                           90       100       110       120       130       140       150
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 134254435   391 KRTGASVALTSISNVTAFFMAALIPIPALRAFSLQAAVVVVFNFAMVLLIFPAILSMDLYRREDRRLDIFCCFTS 465
Cdd:pfam12349   79 GQVGPSILLTSLTEILAFLIGALTDMPAVQEFCLFAAVALLFDFLLQMTFFVAVLSLDIRRLESNRLDVLCCVRS 153
Patched pfam02460
Patched family; The transmembrane protein Patched is a receptor for the morphogene Sonic ...
233-990 6.03e-46

Patched family; The transmembrane protein Patched is a receptor for the morphogene Sonic Hedgehog. This protein associates with the smoothened protein to transduce hedgehog signals.


Pssm-ID: 308203  Cd Length: 793  Bit Score: 178.70  E-value: 6.03e-46
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254435   233 HINWNEDKAAAILEAWQRTYVEVVHQSVAQNSTQkVLSFTTTTLDDILKSFSDVSVIRVASGYLLMLAYACLT-----ML 307
Cdd:pfam02460  162 FLKFDEEEVEEDSKEWEDELSQLLHNKYASEHIQ-FTIFHDQILNDELVRNALTLTPFFVIGFFLLLTFSIIVsvtlsSY 240
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254435   308 RWDCSKSQGAVGLAGVLLVALSVAAGLGLCSLIGISFNAATTqVLPFLALGVGVDDVFLLAHAFSETgqNKRIPFEDRTG 387
Cdd:pfam02460  241 TIDWVRSKPILAALGLLSPVMAIVSSFGLLFWMGFPFNSIVC-VTPFLVLAIGVDDMFLMVAAWQRT--TATLSVKKRMG 317
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254435   388 ECLKRTGASVALTSISNVTAFFMAALIPIPALRAFSLQAAVVVVFNFAMVLLIFPAILSMdlyrredrrldifccftspc 467
Cdd:pfam02460  318 EALSEAGVSITITSLTDVLSFGIGTYTPTPAIQLFCAYTAVAIFFDFIYQITFFAAIMAI-------------------- 377
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254435   468 vsrviqvepqaytdthdntrysppppysshsfahetqitmqstvqlrteydphthvyytTAEPrsEISVQPVTVTQDTLS 547
Cdd:pfam02460  378 -----------------------------------------------------------CAKP--EAEGRHCLFVWATSS 396
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254435   548 CQSPESTSSTRDllsqfsdsSLHCLEPPctkwtLSSFAEKHYAPFLLKPKAKVVVIFLFLGLLGVSLYGTTRVRDGLDLT 627
Cdd:pfam02460  397 PQRIDSEGSEPD--------KSHNIEQL-----KSRFFLDIYCPFLLNPSVRVCMLVLFVVYIAIAIYGCVNIKEGLEPD 463
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254435   628 DIVPRETREYDFIAAQFKYFSFY--NMYIVTQKAdyPNIQ-HLLYD----LHRSFSNVKYVMleeNKQLPKMWLHYFRDW 700
Cdd:pfam02460  464 KLVLEDSPLVEYLSLREKHFWPEglQIQVAVNNP--PNLTiPESRDrmneMVDEFENTPYSL---GPNSTLFWLREYENF 538
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254435   701 LQGLQDAFDSDWEtgkimpnnykngsddgvlaykllvqtgsrdkpidisqltkqrlvdadgiinPSAFYIYLTAWVSndp 780
Cdd:pfam02460  539 LSTLNMEEEEDEE---------------------------------------------------KEWSYGNLPSFLK--- 564
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254435   781 vayaasqaniRPHRPEW----VHDKADYMpetrlripaaepIEYAQFPFYLNGLRDTSDFVEAIEKVRTICSNYTSLGLS 856
Cdd:pfam02460  565 ----------APGNSHWagdlVWDDNTTM------------VTKFRFTLAGKGLSTWNDRTRALQEWRSIADQYPEFNVT 622
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254435   857 SYPNGYPFLfwEQYIGLRHWLLLFISVVLACTFLVCAVFLLNPWTAGIIVMVLALMTVELFGMMGLIGIKLSAVPVVILI 936
Cdd:pfam02460  623 VFDEDAPFA--DQYLTILPSTIQNIVITLICMFIVCFLFIPNPPCVFVITLAIASIDIGVFGFLSLWGVDLDPISMITII 700
                          730       740       750       760       770
                   ....*....|....*....|....*....|....*....|....*....|....*
gi 134254435   937 ASVGIGVEFTVHVALAFLTAIG-DKNRRAVLALEHMFAPVLDGAVSTLLGVLMLA 990
Cdd:pfam02460  701 MSIGFSVDFSAHIAYHFVRSRGdTPAERVVDALEALGWPVFQGGLSTILGVLVLL 755
COG1033 COG1033
Predicted exporter protein, RND superfamily [General function prediction only];
318-455 4.06e-09

Predicted exporter protein, RND superfamily [General function prediction only];


Pssm-ID: 223964 [Multi-domain]  Cd Length: 727  Bit Score: 60.78  E-value: 4.06e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254435  318 VGLAGVLLVALSVAAGLGLCSLIGISFNAATtQVLPFLALGVGVDDVFLLAHAFSETGQNKriPFEDRTGECLKRTGASV 397
Cdd:COG1033   594 KAIIPLIPIAIVVGWNFGLMGLLGIPLTPAT-ATLGAIILGIGVDYSIHITERYREERKKG--GPKEAIETTVERTGKAI 670
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254435  398 ALTSISnvTAFFMAALI--PIPALRAFSLQAAVVVVFNFAMVLLIFPAILSMdLYRREDR 455
Cdd:COG1033   671 LASALT--TAIGFLALIfsPFPIISNFGLLTVIGILLSLLASLVLLPALLVL-LDGRRKR 727
COG1033 COG1033
Predicted exporter protein, RND superfamily [General function prediction only];
249-446 8.97e-09

Predicted exporter protein, RND superfamily [General function prediction only];


Pssm-ID: 223964 [Multi-domain]  Cd Length: 727  Bit Score: 60.01  E-value: 8.97e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254435  249 QRTYVEVVHQSVAQNSTQKVLSFTTTTL-------DDILKSF-SDVSVIRVASGYLLMLA-YACLTMLRWdcsksqgavG 319
Cdd:COG1033   153 DAQKEEIYEEIERIIEIAKFPSGVKLYLtgdpairYQILREIqKDMVVLLALAVILMVIVlYYVFRSVRR---------A 223
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254435  320 LAGVLLVALSVAAGLGLCSLIGISFNAATTQVLPFLaLGVGVDDVFLLAHAFSETGQNKRIPFEdRTGECLKRTGASVAL 399
Cdd:COG1033   224 LLPLIIVLVSVLWTLGAMGLLGIPLTITTSAVPPLL-IGIGIDYGVHFHNRYEEERRKGRTVEE-AVVEAIKHTGPAVLI 301
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|....*..
gi 134254435  400 TSISNVTAFFMAALIPIPALRAFSLQAAVVVVFNFAMVLLIFPAILS 446
Cdd:COG1033   302 AALTTAAGFLSLLTSSIPAIKEFGILLSIGIILAFLSSLTVLPALLI 348
COG1033 COG1033
Predicted exporter protein, RND superfamily [General function prediction only];
883-1007 3.75e-08

Predicted exporter protein, RND superfamily [General function prediction only];


Pssm-ID: 223964 [Multi-domain]  Cd Length: 727  Bit Score: 57.70  E-value: 3.75e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254435  883 VVLACTFLVCAVFLLNPWTAGIIVMVLALMTVELFGMMGLIGIKLSavPVVILIAS--VGIGVEFTVHVALAFLTAI-GD 959
Cdd:COG1033   576 LGIILVFALLLIIFRSPLKAIIPLIPIAIVVGWNFGLMGLLGIPLT--PATATLGAiiLGIGVDYSIHITERYREERkKG 653
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*....
gi 134254435  960 KNRRAVL-ALEHMFAPVLDGAVSTLLGVLMLAGSEFDFIvRYFFAVLAI 1007
Cdd:COG1033   654 GPKEAIEtTVERTGKAILASALTTAIGFLALIFSPFPII-SNFGLLTVI 701
2A067 TIGR00921
The (Largely Archaeal Putative) Hydrophobe/Amphiphile Efflux-3 (HAE3) Family; Characterized ...
278-461 2.15e-07

The (Largely Archaeal Putative) Hydrophobe/Amphiphile Efflux-3 (HAE3) Family; Characterized members of the RND superfamily all probably catalyze substrate efflux via an H+ antiport mechanism. These proteins are found ubiquitously in bacteria, archaea and eukaryotes. They fall into seven phylogenetic families, this family (2.A.6.7) consists of uncharacterised putative transporters, largely in the Archaea. [Transport and binding proteins, Unknown substrate]


Pssm-ID: 273340 [Multi-domain]  Cd Length: 719  Bit Score: 55.23  E-value: 2.15e-07
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254435   278 DILKSFSDVSVIRVASGYLLMLAYACLTMLRWdcsksqgAVGLAGVLLVALSVAAGLGLCSLIGISFNAATTQVLPFLaL 357
Cdd:TIGR00921  186 DIEREFGKDMGTTMAISGILVVLVLLLDFKRW-------WRPLLPLVIILFGVAWVLGIMGWLGIPLYATTLLAVPML-I 257
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254435   358 GVGVDDVFLLAHAFSETGQNKRiPFEDRTGECLKRTGASVALTSISNVtAFFMAALIPI-PALRAFSLQAAVVVVFNFAM 436
Cdd:TIGR00921  258 GVGIDYGIQTLNRYEEERDIGR-AKGEAIVTAVRRTGRAVLIALLTTS-AGFAALALSEfPMVSEFGLGLVAGLITAYLL 335
                          170       180
                   ....*....|....*....|....*.
gi 134254435   437 VLLIFPAIL-SMDLYRREDRRLDIFC 461
Cdd:TIGR00921  336 TLLVLPALLqSIDIGREKVKKEIIAI 361
2A067 TIGR00921
The (Largely Archaeal Putative) Hydrophobe/Amphiphile Efflux-3 (HAE3) Family; Characterized ...
318-445 3.06e-06

The (Largely Archaeal Putative) Hydrophobe/Amphiphile Efflux-3 (HAE3) Family; Characterized members of the RND superfamily all probably catalyze substrate efflux via an H+ antiport mechanism. These proteins are found ubiquitously in bacteria, archaea and eukaryotes. They fall into seven phylogenetic families, this family (2.A.6.7) consists of uncharacterised putative transporters, largely in the Archaea. [Transport and binding proteins, Unknown substrate]


Pssm-ID: 273340 [Multi-domain]  Cd Length: 719  Bit Score: 51.76  E-value: 3.06e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254435   318 VGLAGVLLVALSVAAGLGLCSLIGISFNAaTTQVLPFLALGVGVDDVFLLAHAFSETgQNKRIPFEDRTgECLKRTGASV 397
Cdd:TIGR00921  593 KAVFPLIAIGSGILWAIGLMGLRGIPSFL-AMATTISIILGLGMDYSIHLAERYFEE-RKEHGPKEAIT-HTMERTGPGI 669
                           90       100       110       120
                   ....*....|....*....|....*....|....*....|....*...
gi 134254435   398 ALTSISNVTAFFMAALIPIPALRAFSLQAAVVVVFNFAMVLLIFPAIL 445
Cdd:TIGR00921  670 LFSGLTTAGGFLSLLLSHFPIMRNFGLVQGIGVLSSLTAALVVFPALL 717
COG1033 COG1033
Predicted exporter protein, RND superfamily [General function prediction only];
879-1010 6.15e-06

Predicted exporter protein, RND superfamily [General function prediction only];


Pssm-ID: 223964 [Multi-domain]  Cd Length: 727  Bit Score: 50.77  E-value: 6.15e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254435  879 LFISVVLACTFLVCAVFL-LNPWTAGIIVMVLALMTVEL-FGMMGLIGIKLSAVPVVILIASVGIGVEFTVHVALAFL-- 954
Cdd:COG1033   198 MVVLLALAVILMVIVLYYvFRSVRRALLPLIIVLVSVLWtLGAMGLLGIPLTITTSAVPPLLIGIGIDYGVHFHNRYEee 277
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....*..
gi 134254435  955 TAIGDKNRRAVL-ALEHMFAPVLDGAVSTLLGVLMLAGSEFDFIVRyfFAVLAILTI 1010
Cdd:COG1033   278 RRKGRTVEEAVVeAIKHTGPAVLIAALTTAAGFLSLLTSSIPAIKE--FGILLSIGI 332
AcrB COG0841
Multidrug efflux pump subunit AcrB [Defense mechanisms];
879-1007 1.41e-04

Multidrug efflux pump subunit AcrB [Defense mechanisms];


Pssm-ID: 223911 [Multi-domain]  Cd Length: 1009  Bit Score: 46.45  E-value: 1.41e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254435  879 LFISVVLActFLVCAVFLLNpWTAGIIVMV---LALMTVelFGMMGLIGIKLSAVPVVILIASVGIGVEFTVHVALAFLT 955
Cdd:COG0841   335 LFEAIVLV--VLVMYLFLGN-LRATLIPALavpVSLLGT--FAVMYAFGFSLNTLTLFALVLAIGLLVDDAIVVVENIER 409
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....*....
gi 134254435  956 AIGDKNRR--AVLALEHMFAPVLDGAVSTLLG---VLMLAGS--EFdfiVRYFFAVLAI 1007
Cdd:COG0841   410 HMRGLPPReaAEKAMGEIGGAVIAITLVLIAVflpMAFMGGStgEL---FRQFAITIAV 465
2A067 TIGR00921
The (Largely Archaeal Putative) Hydrophobe/Amphiphile Efflux-3 (HAE3) Family; Characterized ...
890-1000 2.07e-04

The (Largely Archaeal Putative) Hydrophobe/Amphiphile Efflux-3 (HAE3) Family; Characterized members of the RND superfamily all probably catalyze substrate efflux via an H+ antiport mechanism. These proteins are found ubiquitously in bacteria, archaea and eukaryotes. They fall into seven phylogenetic families, this family (2.A.6.7) consists of uncharacterised putative transporters, largely in the Archaea. [Transport and binding proteins, Unknown substrate]


Pssm-ID: 273340 [Multi-domain]  Cd Length: 719  Bit Score: 45.60  E-value: 2.07e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254435   890 LVCAVFLL--NPWTAGIIVMVLALMTVEL-FGMMGLIGIKLSAVPVVILIASVGIGVEFTVHVALAFLTAIG---DKNRR 963
Cdd:TIGR00921  205 LVVLVLLLdfKRWWRPLLPLVIILFGVAWvLGIMGWLGIPLYATTLLAVPMLIGVGIDYGIQTLNRYEEERDigrAKGEA 284
                           90       100       110
                   ....*....|....*....|....*....|....*..
gi 134254435   964 AVLALEHMFAPVLDGAVSTLLGVLMLAGSEFDFIVRY 1000
Cdd:TIGR00921  285 IVTAVRRTGRAVLIALLTTSAGFAALALSEFPMVSEF 321
YdfJ COG2409
Uncharacterized membrane protein YdfJ, MMPL/SSD domain [Function unknown];
316-447 2.91e-04

Uncharacterized membrane protein YdfJ, MMPL/SSD domain [Function unknown];


Pssm-ID: 225272 [Multi-domain]  Cd Length: 937  Bit Score: 45.10  E-value: 2.91e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254435  316 GAVGLAGVLL--VALSVAAGLGLCSLIGISFNAAT-TQVLPF---LALGVGVD-DVFLLA---HAFSEtGQNKripfEDR 385
Cdd:COG2409   206 RSVITAFLPLitVGLSLLVAQGIVALLAYAFGLGVsTFALSLlvaLGIGAGTDyALFLVSryrEELRE-GQDR----EAA 280
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 134254435  386 TGECLKRTGASVALTSISNVTAFFMAALIPIPALRAFSLQAAVVVVFNFAMVLLIFPAILSM 447
Cdd:COG2409   281 VGTAYRTAGKTVAFSGLTVAIALLGLSFARLPFLKTLGIAAAIGVAVAVLAALTLLPALLAL 342
HpnN TIGR03480
hopanoid biosynthesis associated RND transporter like protein HpnN; The genomes containing ...
250-445 4.30e-04

hopanoid biosynthesis associated RND transporter like protein HpnN; The genomes containing members of this family share the machinery for the biosynthesis of hopanoid lipids. Furthermore, the genes of this family are usually located proximal to other components of this biological process. The proteins appear to be related to the RND family of export proteins, particularly the hydrophobe/amphiphile efflux-3 (HAE3) family represented by TIGR00921.


Pssm-ID: 274598 [Multi-domain]  Cd Length: 862  Bit Score: 44.60  E-value: 4.30e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254435   250 RTYVEVVhQSVAQNSTQKVLSFTTTTlDDILKSFsdvsvIRVASGYLLMLAYACLTMLRwdcSKSQGAVGLAGVLLVALS 329
Cdd:TIGR03480  683 RRFVRAV-RKVAPDATGAPVSILESG-DTVVGAF-----LQAFIYALVAITVLLLLTLR---RVRDVLLVLAPLLLAGLL 752
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254435   330 VAAglgLCSLIGISFNAATTQVLPFLaLGVGVDDVFLLAHAFSEtGQNKRIPFEDRTGEclkrtgaSVALTSISNVTAFF 409
Cdd:TIGR03480  753 TVA---AMVLLGIPFNFANIIALPLL-LGLGVDFGIYMVHRWRN-GVDSGNLLQSSTAR-------AVFFSALTTATAFG 820
                          170       180       190
                   ....*....|....*....|....*....|....*.
gi 134254435   410 MAALIPIPALRAFSLQAAVVVVFNFAMVLLIFPAIL 445
Cdd:TIGR03480  821 SLAVSSHPGTASMGILLSLGLGLTLLCTLIFLPALL 856
PHA03377 PHA03377
EBNA-3C; Provisional
1102-1218 6.03e-04

EBNA-3C; Provisional


Pssm-ID: 177614 [Multi-domain]  Cd Length: 1000  Bit Score: 44.27  E-value: 6.03e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254435 1102 QVIVEATENPVFAHSTVVHPES-RHHPPSNPRQ-QPHLDSGSLPPGRQGQQPRRDP-----PREGLW--PPPYRPRRDAF 1172
Cdd:PHA03377  699 QPSEESHLSSMSPTQPISHEEQpRYEDPDDPLDlSLHPDQAPPPSHQAPYSGHEEPqaqqaPYPGYWepRPPQAPYLGYQ 778
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*.
gi 134254435 1173 EISTEGHSGPSNRARWGPRGARSHNPRNPASTAMGSSVPGYCQPIT 1218
Cdd:PHA03377  779 EPQAQGVQVSSYPGYAGPWGLRAQHPRYRHSWAYWSQYPGHGHPQG 824
COG4258 COG4258
Predicted exporter [General function prediction only];
280-443 7.46e-04

Predicted exporter [General function prediction only];


Pssm-ID: 226709 [Multi-domain]  Cd Length: 788  Bit Score: 43.71  E-value: 7.46e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254435  280 LKSFSD---VSVIRVASGYLL--MLAYACLTMLRWDCSKsqGAVGLAGVLLVALSVAAGLGLCsliGISFNAATTQVLpF 354
Cdd:COG4258   633 RKSTFDrlfAAYRYVLAGLLAgaLALVLCLAVARRGWRR--GLRVLLPSVLALGCGLAVLAMA---GVPLNLFHLLAL-V 706
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254435  355 LALGVGVDdvflLAHAFSETGQNKRIPFedrtgeclkRTGASVALTSISNVTAFFMAALIPIPALRAFSLQAAVVVVFNF 434
Cdd:COG4258   707 LVLGVGIN----YALFFSNAGDPRAEPL---------TTLLALALAMLTTLLTFGLLAFSATPVLSSFGITLASGIILAF 773

                  ....*....
gi 134254435  435 AMVLLIFPA 443
Cdd:COG4258   774 VLAPLAMPD 782
MMPL pfam03176
MMPL family; Members of this family are putative integral membrane proteins from bacteria. ...
316-447 3.51e-03

MMPL family; Members of this family are putative integral membrane proteins from bacteria. Several of the members are mycobacterial proteins. Many of the proteins contain two copies of this aligned region. The function of these proteins is not known, although it has been suggested that they may be involved in lipid transport.


Pssm-ID: 308676 [Multi-domain]  Cd Length: 332  Bit Score: 41.12  E-value: 3.51e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254435   316 GAVGLAGVLL--VALSVAAGLGLCS-LIGISFNAATTQVLPF---LALGVGVD-DVFLLA--HAFSETGQNKripfEDRT 386
Cdd:pfam03176  164 RSVVAALLPLltVGLSLGAAQGLVAiLAHILGIGLSTFALNLlvvLLIAVGTDyALFLVSryREELRAGEDR----EEAV 239
                           90       100       110       120       130       140
                   ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 134254435   387 GECLKRTGASVALTSISNVTAFFMAALIPIPALRAFSLQAAVVVVFNFAMVLLIFPAILSM 447
Cdd:pfam03176  240 IRAVRGTGKVVTAAGLTVAIAMLALSFARLPVFAQVGPTIAIGVLVDVLAALTLLPALLAL 300
2A067 TIGR00921
The (Largely Archaeal Putative) Hydrophobe/Amphiphile Efflux-3 (HAE3) Family; Characterized ...
885-1010 5.22e-03

The (Largely Archaeal Putative) Hydrophobe/Amphiphile Efflux-3 (HAE3) Family; Characterized members of the RND superfamily all probably catalyze substrate efflux via an H+ antiport mechanism. These proteins are found ubiquitously in bacteria, archaea and eukaryotes. They fall into seven phylogenetic families, this family (2.A.6.7) consists of uncharacterised putative transporters, largely in the Archaea. [Transport and binding proteins, Unknown substrate]


Pssm-ID: 273340 [Multi-domain]  Cd Length: 719  Bit Score: 40.98  E-value: 5.22e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254435   885 LACTFLVCAVFLL---NPWTAgiIVMVLALMTVELF--GMMGLIGIKLSAVPVVILIASVGIGVEFTVHVALAFL---TA 956
Cdd:TIGR00921  574 IAGAILVLMILLAvfrNPIKA--VFPLIAIGSGILWaiGLMGLRGIPSFLAMATTISIILGLGMDYSIHLAERYFeerKE 651
                           90       100       110       120       130       140
                   ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 134254435   957 IGDKNrrAVL-ALEHMFAPVLDGAVSTLLGVLMLAGSEFDFI--------VRYFFAVLAILTI 1010
Cdd:TIGR00921  652 HGPKE--AIThTMERTGPGILFSGLTTAGGFLSLLLSHFPIMrnfglvqgIGVLSSLTAALVV 712
PHA03307 PHA03307
transcriptional regulator ICP4; Provisional
1078-1212 8.69e-03

transcriptional regulator ICP4; Provisional


Pssm-ID: 223039 [Multi-domain]  Cd Length: 1352  Bit Score: 40.54  E-value: 8.69e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 134254435 1078 TTVSGLSEELRhyeAQQGAGGPAHQVIVEATENPVFAHSTVVHP----------ESRHHPPSNPRQQPHLDSGslPPGRQ 1147
Cdd:PHA03307  129 SPAPDLSEMLR---PVGSPGPPPAASPPAAGASPAAVASDAASSrqaalplsspEETARAPSSPPAEPPPSTP--PAAAS 203
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 134254435 1148 GQQPRRDPPR--EGLWPPPYRPRRDAFEISTE---GHSGPSNRARWGPRGA--RSHNPRNPASTAMGSSVPG 1212
Cdd:PHA03307  204 PRPPRRSSPIsaSASSPAPAPGRSAADDAGASssdSSSSESSGCGWGPENEcpLPRPAPITLPTRIWEASGW 275
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH