NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|157909825|ref|NP_001103223|]
View 

synaptic vesicle glycoprotein 2B [Mus musculus]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
synapt_SV2 super family cl31090
synaptic vesicle protein SV2; This model describes a tightly conserved subfamily of the larger ...
8-683 0e+00

synaptic vesicle protein SV2; This model describes a tightly conserved subfamily of the larger family of sugar (and other) transporters described by pfam00083. Members of this subfamily include closely related forms SV2A and SV2B of synaptic vesicle protein from vertebrates and a more distantly related homolog (below trusted cutoff) from Drosophila melanogaster. Members are predicted to have two sets of six transmembrane helices.


The actual alignment was detected with superfamily member TIGR01299:

Pssm-ID: 130366 [Multi-domain]  Cd Length: 742  Bit Score: 1033.39  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825    8 DNYEGYAPSDGYYR--SNEQNQEEDAQSDVTEGHDEEDEIYEGEYQGIPHPDDvKSKQTKMA--PSRADGLGGQAD---- 79
Cdd:TIGR01299  54 DDDDFPAPADGYSRgeAADDEEEGEASSDATEGHDEDDEIYEGEYQGIPRAEN-GGKDEIMAdgAPKAGVRDELKDgegp 132
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825   80 ----LMAERMEDEEELAHQYETIIDECGHGRFQWTLFFVLGLALMADGVEIFVVSFALPSAEKDMCLSSSKKGMLGLIVY 155
Cdd:TIGR01299 133 pggeGEAERRADEEELAQQYELIIQECGHGRFQWALFFVLGLALMADGVEVFVVGFVLPSAEKDLCIPDSGKGMLGLIVY 212
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825  156 LGMMAGAFILGGLADKLGRKKVLSMSLAINASFASLSSFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGEH 235
Cdd:TIGR01299 213 LGMMVGAFFWGGLADKLGRKQCLLICLSVNGFFAFFSSFVQGYGFFLFCRLLSGFGIGGAIPIVFSYFAEFLAQEKRGEH 292
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825  236 LSWLGIFWMTGGIYASAMAWSIIPHYGWGFSMGTNYHFHSWRVFVIVCALPATVSMVALKFMPESPRFLLEMGKHDEAWM 315
Cdd:TIGR01299 293 LSWLCMFWMIGGIYAAAMAWAIIPHYGWSFQMGSAYQFHSWRVFVIVCAFPCVFAIGALTFMPESPRFFLENGKHDEAWM 372
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825  316 ILKQVHDTNMRAKGTPEKVFTVSHIKTPKQMDEFIEIQSSTGTWYQRWLVRFMTIFKQVWDNALYCVMGPYRMNTLILAV 395
Cdd:TIGR01299 373 ILKLIHDTNMRAKGHPEKVFSVNHIKTIHQEDELIEIESDTGTWYQRCFVRALSEGGGIWGNFLRCFNPEVREITIKLMG 452
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825  396 VWFTMALSYYGLTVWFPDMIRYFQDEEYKSKMKVFFGEHVHGATINFTMENQIHQHGKLVNDKFIKMYFKHVLFEDTFFD 475
Cdd:TIGR01299 453 VWFTLSFGYYGLSVWFPDMIKHLQADDYAALTKNFPGDKVAHFSFNFTLENQIHRGGEYDNDKFIGLKFKSVSFEDSLFE 532
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825  476 KCYFEDVTSTDTYFKNCTIESTTFYNTDLYKHKFINCRFINSTFLEQKEGCHMDFEEDND--FLIYLVSFLGSLSVLPGN 553
Cdd:TIGR01299 533 ECTFDDVTSSNTFFKNCTFIDTLFENTDFEEYKFIDSEFQNCSFLHNKEGCPIDFDGDDEgaYMIYFVNFLGTLAVLPGN 612
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825  554 IISALLMDRIGRLKMIGGSMLISAVCCFFLFFGNSESAMIGWQCLFCGTSIAAWNALDVITVELYPTNQRATAFGILNGL 633
Cdd:TIGR01299 613 IVSALLMDKIGRLRMLAGSMVLSCISCFFLSFGNSESAMIALLCLFGGLSIAAWNALDVLTVELYPSDKRATAFGFLNAL 692
                         650       660       670       680       690
                  ....*....|....*....|....*....|....*....|....*....|
gi 157909825  634 CKFGAILGNTIFASFVGITKVVPILLAAASLVGGGLIALRLPETREQVLM 683
Cdd:TIGR01299 693 CKAAAVLGILIFGSFVGITKAAPILFASAALACGGLLALKLPDTRGQVLM 742
 
Name Accession Description Interval E-value
synapt_SV2 TIGR01299
synaptic vesicle protein SV2; This model describes a tightly conserved subfamily of the larger ...
8-683 0e+00

synaptic vesicle protein SV2; This model describes a tightly conserved subfamily of the larger family of sugar (and other) transporters described by pfam00083. Members of this subfamily include closely related forms SV2A and SV2B of synaptic vesicle protein from vertebrates and a more distantly related homolog (below trusted cutoff) from Drosophila melanogaster. Members are predicted to have two sets of six transmembrane helices.


Pssm-ID: 130366 [Multi-domain]  Cd Length: 742  Bit Score: 1033.39  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825    8 DNYEGYAPSDGYYR--SNEQNQEEDAQSDVTEGHDEEDEIYEGEYQGIPHPDDvKSKQTKMA--PSRADGLGGQAD---- 79
Cdd:TIGR01299  54 DDDDFPAPADGYSRgeAADDEEEGEASSDATEGHDEDDEIYEGEYQGIPRAEN-GGKDEIMAdgAPKAGVRDELKDgegp 132
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825   80 ----LMAERMEDEEELAHQYETIIDECGHGRFQWTLFFVLGLALMADGVEIFVVSFALPSAEKDMCLSSSKKGMLGLIVY 155
Cdd:TIGR01299 133 pggeGEAERRADEEELAQQYELIIQECGHGRFQWALFFVLGLALMADGVEVFVVGFVLPSAEKDLCIPDSGKGMLGLIVY 212
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825  156 LGMMAGAFILGGLADKLGRKKVLSMSLAINASFASLSSFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGEH 235
Cdd:TIGR01299 213 LGMMVGAFFWGGLADKLGRKQCLLICLSVNGFFAFFSSFVQGYGFFLFCRLLSGFGIGGAIPIVFSYFAEFLAQEKRGEH 292
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825  236 LSWLGIFWMTGGIYASAMAWSIIPHYGWGFSMGTNYHFHSWRVFVIVCALPATVSMVALKFMPESPRFLLEMGKHDEAWM 315
Cdd:TIGR01299 293 LSWLCMFWMIGGIYAAAMAWAIIPHYGWSFQMGSAYQFHSWRVFVIVCAFPCVFAIGALTFMPESPRFFLENGKHDEAWM 372
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825  316 ILKQVHDTNMRAKGTPEKVFTVSHIKTPKQMDEFIEIQSSTGTWYQRWLVRFMTIFKQVWDNALYCVMGPYRMNTLILAV 395
Cdd:TIGR01299 373 ILKLIHDTNMRAKGHPEKVFSVNHIKTIHQEDELIEIESDTGTWYQRCFVRALSEGGGIWGNFLRCFNPEVREITIKLMG 452
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825  396 VWFTMALSYYGLTVWFPDMIRYFQDEEYKSKMKVFFGEHVHGATINFTMENQIHQHGKLVNDKFIKMYFKHVLFEDTFFD 475
Cdd:TIGR01299 453 VWFTLSFGYYGLSVWFPDMIKHLQADDYAALTKNFPGDKVAHFSFNFTLENQIHRGGEYDNDKFIGLKFKSVSFEDSLFE 532
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825  476 KCYFEDVTSTDTYFKNCTIESTTFYNTDLYKHKFINCRFINSTFLEQKEGCHMDFEEDND--FLIYLVSFLGSLSVLPGN 553
Cdd:TIGR01299 533 ECTFDDVTSSNTFFKNCTFIDTLFENTDFEEYKFIDSEFQNCSFLHNKEGCPIDFDGDDEgaYMIYFVNFLGTLAVLPGN 612
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825  554 IISALLMDRIGRLKMIGGSMLISAVCCFFLFFGNSESAMIGWQCLFCGTSIAAWNALDVITVELYPTNQRATAFGILNGL 633
Cdd:TIGR01299 613 IVSALLMDKIGRLRMLAGSMVLSCISCFFLSFGNSESAMIALLCLFGGLSIAAWNALDVLTVELYPSDKRATAFGFLNAL 692
                         650       660       670       680       690
                  ....*....|....*....|....*....|....*....|....*....|
gi 157909825  634 CKFGAILGNTIFASFVGITKVVPILLAAASLVGGGLIALRLPETREQVLM 683
Cdd:TIGR01299 693 CKAAAVLGILIFGSFVGITKAAPILFASAALACGGLLALKLPDTRGQVLM 742
MFS_SV2B cd17438
Synaptic vesicle glycoprotein 2B of the Major Facilitator Superfamily of transporters; ...
112-678 0e+00

Synaptic vesicle glycoprotein 2B of the Major Facilitator Superfamily of transporters; Synaptic vesicle glycoprotein 2 (SV2) is a transporter-like integral membrane glycoprotein, with 12 transmembrane regions, expressed in vertebrates and is localized to synaptic and endocrine secretory vesicles. Three isoforms have been identified, SV2A, SV2B, and SV2C. SV2A and SV2B are widely expressed in the brain, while SV2C is more restricted to evolutionarily older brain. SV2 isoforms have been shown to be critical for the proper function of the central nervous system. SV2 serves as the receptor for botulinum neurotoxin A (BoNT/A), one of seven neurotoxins produced by the bacterium Clostridium botulinum. BoNT/A blocks neurotransmitter release by cleaving synaptosome-associated protein of 25 kD (SNAP-25) within presynaptic nerve terminals. SV2B is a key modulator of amyloid toxicity at the synaptic site and also has an essential role in the formation and maintenance of the glomerular capillary wall. SV2B belongs to the Metazoan Synaptic Vesicle Glycoprotein 2 (SV2) and related small molecule transporter family (SV2-like) of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340996 [Multi-domain]  Cd Length: 477  Bit Score: 924.32  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 112 FFVLGLALMADGVEIFVVSFALPSAEKDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASFASL 191
Cdd:cd17438    1 FFVLGLALMADGVEVFVVGFVLPSAEKDMCLSSSNKGMLGLIVYLGMMAGAFIWGGLADKLGRKRCLIISLAINASFAFL 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 192 SSFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGIYASAMAWSIIPHYGWGFSMGTNY 271
Cdd:cd17438   81 SSFVQGYGAFLFCRLISGFGIGGSLPIVFAYFSEFLAREKRGEHLSWLCMFWMIGGLYASAMAWSIIPHYGWGFSMGTNY 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 272 HFHSWRVFVIVCALPATVSMVALKFMPESPRFLLEMGKHDEAWMILKQVHDTNMRAKGTPEKVFTVSHIKtpkqmdefie 351
Cdd:cd17438  161 HFHSWRVFVIICALPCIASIIALKFMPESPRFLLEMGKHDEAWMILKNIHDTNMRAKGTPEKVFTVSNIK---------- 230
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 352 iqsstgtwyqrwlvrfmtifkqvwdnalycvmgpyRMNTLILAVVWFTMALSYYGLTVWFPDMIRYFQdeeykskmkvff 431
Cdd:cd17438  231 -----------------------------------RKNTLFLAVVWFTMAFSYYGLTVWFPDMIRYLQ------------ 263
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 432 gehvhgatinftmenqihqhgklvndkfikmyfKHVLFEDTFFDKCYFEDVTSTDTYFKNCTIESTTFYNTDLYKHKFIN 511
Cdd:cd17438  264 ---------------------------------KHVTFEDSLFDECYFEDVTSTDTYFKNCTIESTIFYNTDLYEHKFID 310
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 512 CRFINSTFLEQKEGCHMDFEEDNDFLIYLVSFLGSLSVLPGNIISALLMDRIGRLKMIGGSMLISAVCCFFLFFGNSESA 591
Cdd:cd17438  311 CRFINSTFLEQKEGCHMDFEEDNDFLIYLVSFLGSLSVLPGNIISALLMDKIGRIKMIGGSMLISAVCCFFLFFGNSESA 390
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 592 MIGWQCLFCGTSIAAWNALDVITVELYPTNQRATAFGILNGLCKFGAILGNTIFASFVGITKVVPILLAAASLVGGGLIA 671
Cdd:cd17438  391 MIGWQCLFCGTSIAAWNALDVITVELYPTNKRATAFGILNGLCKFAAILGNSIFASFVGITKVIPILLASTALVGGGLIS 470

                 ....*..
gi 157909825 672 LRLPETR 678
Cdd:cd17438  471 LRLPETR 477
Sugar_tr pfam00083
Sugar (and other) transporter;
127-319 1.68e-21

Sugar (and other) transporter;


Pssm-ID: 395036 [Multi-domain]  Cd Length: 452  Bit Score: 97.73  E-value: 1.68e-21
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825  127 FVVSFALPSAEKDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASFASLSSFVQGYGAF---LF 203
Cdd:pfam00083  28 FFKNFGLSKSVSSLAALSVLSGLIVSIFSVGCFIGSLFAGKLGDRFGRKKSLLIANVLFVIGAVLQGAAKGKWSVyqlIV 107
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825  204 CRLISGIGIGGSLPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGIYAsamAWSiiphyGWGFSMGTNYHfhSWRVFVIVC 283
Cdd:pfam00083 108 GRVLVGIGVGGASVLAPMYISEIAPKKLRGALGSLYQLAITFGILLA---YIF-----GLGLNKTSNSD--GWRIPLGLQ 177
                         170       180       190
                  ....*....|....*....|....*....|....*.
gi 157909825  284 ALPATVSMVALKFMPESPRFLLEMGKHDEAWMILKQ 319
Cdd:pfam00083 178 LVPALLLIIGLLFLPESPRWLVEKGRLEEAREVLAK 213
PRK11551 PRK11551
putative 3-hydroxyphenylpropionic transporter MhpT; Provisional
116-304 2.15e-14

putative 3-hydroxyphenylpropionic transporter MhpT; Provisional


Pssm-ID: 236927 [Multi-domain]  Cd Length: 406  Bit Score: 75.38  E-value: 2.15e-14
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 116 GLALMADGVeifvvsfALPSAEKDMCLSsskKGMLGLIV---YLGMMAGAFILGGLADKLGRKKVLSMSLAINASFASLS 192
Cdd:PRK11551  28 GLDLQSAGV-------AAPRMAQEFGLD---VAQMGWAFsagILGLLPGALLGGRLADRIGRKRILIVSVALFGLFSLAT 97
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 193 SFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGEHLSWL--GI-FwmtGGIYASAMAWsiiphygwgFSMGT 269
Cdd:PRK11551  98 AQAWDFPSLLVARLLTGVGLGGALPNLIALTSEAVGPRLRGTAVSLMycGVpF---GGALASVIGV---------LAAGD 165
                        170       180       190
                 ....*....|....*....|....*....|....*.
gi 157909825 270 NyhfhSWR-VFVIVCALPATVSMVALKFMPESPRFL 304
Cdd:PRK11551 166 A----AWRhIFYVGGVGPLLLVPLLMRWLPESRAFA 197
AraJ COG2814
Predicted arabinose efflux permease, MFS family [Carbohydrate transport and metabolism];
106-258 1.40e-10

Predicted arabinose efflux permease, MFS family [Carbohydrate transport and metabolism];


Pssm-ID: 225371 [Multi-domain]  Cd Length: 394  Bit Score: 63.79  E-value: 1.40e-10
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 106 RFQWTLFFVLGLALMADGVEIFVVSFALPSAEKDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAIN 185
Cdd:COG2814    9 KPMWLALLALALAAFAIGTTEFVPVGLLPPIAADLGVSEGAAGQLITAYALGVALGAPLLALLTGRLERRRLLLGLLALF 88
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 186 ASFASLSSFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKR-------------------------GEHLSWLG 240
Cdd:COG2814   89 IVSNLLSALAPSFAVLLLARALAGLAHGVFWSIAAALAARLVPPGKRgralalvftgltlatvlgvplgtflGQLFGWRA 168
                        170
                 ....*....|....*...
gi 157909825 241 IFWMTGGIYASAMAWSII 258
Cdd:COG2814  169 TFLAIAVLALLALLLLWK 186
MFS_LfrA NF033896
efflux MFS transporter LfrA; This efflux transporter, as characterized in Mycolicibacterium ...
106-300 9.45e-03

efflux MFS transporter LfrA; This efflux transporter, as characterized in Mycolicibacterium (Mycobacterium) smegmatis, provides low-level fluoroquinolone resistance (lfr) when overexpressed.


Pssm-ID: 411458 [Multi-domain]  Cd Length: 504  Bit Score: 39.12  E-value: 9.45e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 106 RFQWTLFFVLGLALMADGVEIFVVSFALPSAEKDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAIN 185
Cdd:NF033896  16 RRAWLALAVLMLPVLLIAIDNTVLAFALPAIAEDFRPSAATQLWIVDVYSLVLAALLVAMGSLGDRIGRRRLLLIGAAGF 95
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 186 ASFASLSSFVQGYGAFLFCRliSGIGIGG------SLPIVFAYFSEFLSRekRGEHLSWLGIFwMTGGIYASAMAWSIIP 259
Cdd:NF033896  96 AVVSAAAAFAPSAEYLVAAR--AALGVFGamlmpsTLSLIRNIFTEASAR--RLAIAIWASCF-TAGSTLGPIVGGALLQ 170
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|.
gi 157909825 260 HYGWGfsmgtnyhfhswRVFVIVCALPATVSMVALKFMPES 300
Cdd:NF033896 171 HFHWG------------AVFLVAVPILLPLLVLGPRLVPES 199
 
Name Accession Description Interval E-value
synapt_SV2 TIGR01299
synaptic vesicle protein SV2; This model describes a tightly conserved subfamily of the larger ...
8-683 0e+00

synaptic vesicle protein SV2; This model describes a tightly conserved subfamily of the larger family of sugar (and other) transporters described by pfam00083. Members of this subfamily include closely related forms SV2A and SV2B of synaptic vesicle protein from vertebrates and a more distantly related homolog (below trusted cutoff) from Drosophila melanogaster. Members are predicted to have two sets of six transmembrane helices.


Pssm-ID: 130366 [Multi-domain]  Cd Length: 742  Bit Score: 1033.39  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825    8 DNYEGYAPSDGYYR--SNEQNQEEDAQSDVTEGHDEEDEIYEGEYQGIPHPDDvKSKQTKMA--PSRADGLGGQAD---- 79
Cdd:TIGR01299  54 DDDDFPAPADGYSRgeAADDEEEGEASSDATEGHDEDDEIYEGEYQGIPRAEN-GGKDEIMAdgAPKAGVRDELKDgegp 132
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825   80 ----LMAERMEDEEELAHQYETIIDECGHGRFQWTLFFVLGLALMADGVEIFVVSFALPSAEKDMCLSSSKKGMLGLIVY 155
Cdd:TIGR01299 133 pggeGEAERRADEEELAQQYELIIQECGHGRFQWALFFVLGLALMADGVEVFVVGFVLPSAEKDLCIPDSGKGMLGLIVY 212
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825  156 LGMMAGAFILGGLADKLGRKKVLSMSLAINASFASLSSFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGEH 235
Cdd:TIGR01299 213 LGMMVGAFFWGGLADKLGRKQCLLICLSVNGFFAFFSSFVQGYGFFLFCRLLSGFGIGGAIPIVFSYFAEFLAQEKRGEH 292
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825  236 LSWLGIFWMTGGIYASAMAWSIIPHYGWGFSMGTNYHFHSWRVFVIVCALPATVSMVALKFMPESPRFLLEMGKHDEAWM 315
Cdd:TIGR01299 293 LSWLCMFWMIGGIYAAAMAWAIIPHYGWSFQMGSAYQFHSWRVFVIVCAFPCVFAIGALTFMPESPRFFLENGKHDEAWM 372
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825  316 ILKQVHDTNMRAKGTPEKVFTVSHIKTPKQMDEFIEIQSSTGTWYQRWLVRFMTIFKQVWDNALYCVMGPYRMNTLILAV 395
Cdd:TIGR01299 373 ILKLIHDTNMRAKGHPEKVFSVNHIKTIHQEDELIEIESDTGTWYQRCFVRALSEGGGIWGNFLRCFNPEVREITIKLMG 452
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825  396 VWFTMALSYYGLTVWFPDMIRYFQDEEYKSKMKVFFGEHVHGATINFTMENQIHQHGKLVNDKFIKMYFKHVLFEDTFFD 475
Cdd:TIGR01299 453 VWFTLSFGYYGLSVWFPDMIKHLQADDYAALTKNFPGDKVAHFSFNFTLENQIHRGGEYDNDKFIGLKFKSVSFEDSLFE 532
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825  476 KCYFEDVTSTDTYFKNCTIESTTFYNTDLYKHKFINCRFINSTFLEQKEGCHMDFEEDND--FLIYLVSFLGSLSVLPGN 553
Cdd:TIGR01299 533 ECTFDDVTSSNTFFKNCTFIDTLFENTDFEEYKFIDSEFQNCSFLHNKEGCPIDFDGDDEgaYMIYFVNFLGTLAVLPGN 612
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825  554 IISALLMDRIGRLKMIGGSMLISAVCCFFLFFGNSESAMIGWQCLFCGTSIAAWNALDVITVELYPTNQRATAFGILNGL 633
Cdd:TIGR01299 613 IVSALLMDKIGRLRMLAGSMVLSCISCFFLSFGNSESAMIALLCLFGGLSIAAWNALDVLTVELYPSDKRATAFGFLNAL 692
                         650       660       670       680       690
                  ....*....|....*....|....*....|....*....|....*....|
gi 157909825  634 CKFGAILGNTIFASFVGITKVVPILLAAASLVGGGLIALRLPETREQVLM 683
Cdd:TIGR01299 693 CKAAAVLGILIFGSFVGITKAAPILFASAALACGGLLALKLPDTRGQVLM 742
MFS_SV2B cd17438
Synaptic vesicle glycoprotein 2B of the Major Facilitator Superfamily of transporters; ...
112-678 0e+00

Synaptic vesicle glycoprotein 2B of the Major Facilitator Superfamily of transporters; Synaptic vesicle glycoprotein 2 (SV2) is a transporter-like integral membrane glycoprotein, with 12 transmembrane regions, expressed in vertebrates and is localized to synaptic and endocrine secretory vesicles. Three isoforms have been identified, SV2A, SV2B, and SV2C. SV2A and SV2B are widely expressed in the brain, while SV2C is more restricted to evolutionarily older brain. SV2 isoforms have been shown to be critical for the proper function of the central nervous system. SV2 serves as the receptor for botulinum neurotoxin A (BoNT/A), one of seven neurotoxins produced by the bacterium Clostridium botulinum. BoNT/A blocks neurotransmitter release by cleaving synaptosome-associated protein of 25 kD (SNAP-25) within presynaptic nerve terminals. SV2B is a key modulator of amyloid toxicity at the synaptic site and also has an essential role in the formation and maintenance of the glomerular capillary wall. SV2B belongs to the Metazoan Synaptic Vesicle Glycoprotein 2 (SV2) and related small molecule transporter family (SV2-like) of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340996 [Multi-domain]  Cd Length: 477  Bit Score: 924.32  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 112 FFVLGLALMADGVEIFVVSFALPSAEKDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASFASL 191
Cdd:cd17438    1 FFVLGLALMADGVEVFVVGFVLPSAEKDMCLSSSNKGMLGLIVYLGMMAGAFIWGGLADKLGRKRCLIISLAINASFAFL 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 192 SSFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGIYASAMAWSIIPHYGWGFSMGTNY 271
Cdd:cd17438   81 SSFVQGYGAFLFCRLISGFGIGGSLPIVFAYFSEFLAREKRGEHLSWLCMFWMIGGLYASAMAWSIIPHYGWGFSMGTNY 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 272 HFHSWRVFVIVCALPATVSMVALKFMPESPRFLLEMGKHDEAWMILKQVHDTNMRAKGTPEKVFTVSHIKtpkqmdefie 351
Cdd:cd17438  161 HFHSWRVFVIICALPCIASIIALKFMPESPRFLLEMGKHDEAWMILKNIHDTNMRAKGTPEKVFTVSNIK---------- 230
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 352 iqsstgtwyqrwlvrfmtifkqvwdnalycvmgpyRMNTLILAVVWFTMALSYYGLTVWFPDMIRYFQdeeykskmkvff 431
Cdd:cd17438  231 -----------------------------------RKNTLFLAVVWFTMAFSYYGLTVWFPDMIRYLQ------------ 263
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 432 gehvhgatinftmenqihqhgklvndkfikmyfKHVLFEDTFFDKCYFEDVTSTDTYFKNCTIESTTFYNTDLYKHKFIN 511
Cdd:cd17438  264 ---------------------------------KHVTFEDSLFDECYFEDVTSTDTYFKNCTIESTIFYNTDLYEHKFID 310
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 512 CRFINSTFLEQKEGCHMDFEEDNDFLIYLVSFLGSLSVLPGNIISALLMDRIGRLKMIGGSMLISAVCCFFLFFGNSESA 591
Cdd:cd17438  311 CRFINSTFLEQKEGCHMDFEEDNDFLIYLVSFLGSLSVLPGNIISALLMDKIGRIKMIGGSMLISAVCCFFLFFGNSESA 390
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 592 MIGWQCLFCGTSIAAWNALDVITVELYPTNQRATAFGILNGLCKFGAILGNTIFASFVGITKVVPILLAAASLVGGGLIA 671
Cdd:cd17438  391 MIGWQCLFCGTSIAAWNALDVITVELYPTNKRATAFGILNGLCKFAAILGNSIFASFVGITKVIPILLASTALVGGGLIS 470

                 ....*..
gi 157909825 672 LRLPETR 678
Cdd:cd17438  471 LRLPETR 477
MFS_SV2 cd17363
Synaptic vesicle glycoprotein 2 of the Major Facilitator Superfamily of transporters; Synaptic ...
112-678 0e+00

Synaptic vesicle glycoprotein 2 of the Major Facilitator Superfamily of transporters; Synaptic vesicle glycoprotein 2 (SV2) is a transporter-like integral membrane glycoprotein, with 12 transmembrane regions, expressed in vertebrates and is localized to synaptic and endocrine secretory vesicles. Three isoforms have been identified, SV2A, SV2B, and SV2C. SV2A and SV2B are widely expressed in the brain, while SV2C is more restricted to evolutionarily older brain. SV2 isoforms have been shown to be critical for the proper function of the central nervous system. SV2 serves as the receptor for botulinum neurotoxin A (BoNT/A), one of seven neurotoxins produced by the bacterium Clostridium botulinum. BoNT/A blocks neurotransmitter release by cleaving synaptosome-associated protein of 25 kD (SNAP-25) within presynaptic nerve terminals. The SV2 family belongs to the Metazoan Synaptic Vesicle Glycoprotein 2 (SV2) and related small molecule transporter family (SV2-like) of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340921 [Multi-domain]  Cd Length: 474  Bit Score: 888.37  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 112 FFVLGLALMADGVEIFVVSFALPSAEKDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASFASL 191
Cdd:cd17363    1 FFVLGLALMADGVEVFVVGFVLPSAEKDMCLSNSNKGMLGLIVYLGMMVGAFVWGGLADKLGRKQCLLIALSVNGVFAFL 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 192 SSFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGIYASAMAWSIIPHYGWGFSMGTNY 271
Cdd:cd17363   81 SSFVQGYGFFLFCRLLSGIGIGGSIPIVFSYFAEFLAREKRGEHLSWLCMFWMIGGLYASAMAWAIIPHYGWGFSMGTAY 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 272 HFHSWRVFVIVCALPATVSMVALKFMPESPRFLLEMGKHDEAWMILKQVHDTNMRAKGTPEKVFTVSHIKtpkqmdefie 351
Cdd:cd17363  161 QFHSWRVFVIVCALPSVASVVALTFMPESPRFLLEVGKHDEAWMILKQVHDTNMRAKGHPERVFTVSHIK---------- 230
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 352 iqsstgtwyqrwlvrfmtifkqvwdnalycvmgpyRMNTLILAVVWFTMALSYYGLTVWFPDMIRYFQdeeykskmkvff 431
Cdd:cd17363  231 -----------------------------------RMNTLFLAIVWFTMSFSYYGLTVWFPDMIKYLQ------------ 263
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 432 gehvhgatinftmenqihqhgklvndkfikmyfkhvlFEDTFFDKCYFEDVTSTDTYFKNCTIESTTFYNTDLYKHKFIN 511
Cdd:cd17363  264 -------------------------------------FEDSLFEECYFEDVTSTNTFFENCTFINTVFYNTDLFEYKFID 306
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 512 CRFINSTFL-EQKEGCHMDFEEDNDFLIYLVSFLGSLSVLPGNIISALLMDRIGRLKMIGGSMLISAVCCFFLFFGNSES 590
Cdd:cd17363  307 SRFLNSTFFlKEKCGCHLNDDEENAYLIYLVSFLGSLSVLPGNIVSALLMDKIGRLKMIGGSMLLSAVCCFFLFFGNSES 386
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 591 AMIGWQCLFCGTSIAAWNALDVITVELYPTNQRATAFGILNGLCKFGAILGNTIFASFVGITKVVPILLAAASLVGGGLI 670
Cdd:cd17363  387 AMIGLQCLFCGVSIAAWNALDVVTVELYPTDKRATAFGFLNGLCKLAAILGNSIFGSFVGITKVIPILLASAALVCGGLL 466

                 ....*...
gi 157909825 671 ALRLPETR 678
Cdd:cd17363  467 ALKLPETR 474
MFS_SV2A cd17439
Synaptic vesicle glycoprotein 2A of the Major Facilitator Superfamily of transporters; ...
112-678 0e+00

Synaptic vesicle glycoprotein 2A of the Major Facilitator Superfamily of transporters; Synaptic vesicle glycoprotein 2 (SV2) is a transporter-like integral membrane glycoprotein, with 12 transmembrane regions, expressed in vertebrates and is localized to synaptic and endocrine secretory vesicles. Three isoforms have been identified, SV2A, SV2B, and SV2C. SV2A and SV2B are widely expressed in the brain, while SV2C is more restricted to evolutionarily older brain. SV2 isoforms have been shown to be critical for the proper function of the central nervous system. SV2 serves as the receptor for botulinum neurotoxin A (BoNT/A), one of seven neurotoxins produced by the bacterium Clostridium botulinum. BoNT/A blocks neurotransmitter release by cleaving synaptosome-associated protein of 25 kD (SNAP-25) within presynaptic nerve terminals. It is unclear how SV2A is involved in correct SV function, but it has been suggested to either act as a transporter or a regulator of exocytosis by mediating Ca2+ dynamics. SV2A has been identified as the molecular target of the antiepileptic drug levetiracetam (LEV). Its expression is decreased in patients with epilepsy and in epileptic animal models. SV2A belongs to the Metazoan Synaptic Vesicle Glycoprotein 2 (SV2) and related small molecule transporter family (SV2-like) of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340997 [Multi-domain]  Cd Length: 478  Bit Score: 705.25  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 112 FFVLGLALMADGVEIFVVSFALPSAEKDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASFASL 191
Cdd:cd17439    1 YFVLGLALMADGVEVFVVGFVLPSAEKDMCLSDSNKGMLGLIVYLGMMVGAFLWGGLADRIGRRQCLLISLSVNSVFAFF 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 192 SSFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGIYASAMAWSIIPHYGWGFSMGTNY 271
Cdd:cd17439   81 SSFVQGYGTFLFCRLLSGVGIGGSIPIVFSYFSEFLAQEKRGEHLSWLCMFWMIGGIYASAMAWAIIPHYGWSFQMGSAY 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 272 HFHSWRVFVIVCALPATVSMVALKFMPESPRFLLEMGKHDEAWMILKQVHDTNMRAKGTPEKVFTVSHIKtpkqmdefie 351
Cdd:cd17439  161 QFHSWRVFVLVCAFPSVFAIGALTTMPESPRFFLENGKHDEAWMVLKQVHDTNMRAKGHPERVFSVTHIK---------- 230
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 352 iqsstgtwyqrwlvrfmtifkqvwdnalycvmgpyRMNTLILAVVWFTMALSYYGLTVWFPDMIRYFQdeeykskmkvff 431
Cdd:cd17439  231 -----------------------------------RRITLMMMAVWFTMSFSYYGLTVWFPDMIKHLQ------------ 263
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 432 gehvhgatinftmenqihqhgklvndkfikmyfKHVLFEDTFFDKCYFEDVTSTDTYFKNCTIESTTFYNTDLYKHKFIN 511
Cdd:cd17439  264 ---------------------------------KSVVFEDSLFEECYFEDITSSNTFFKNCTFISTLFYNTDLFEYKFIN 310
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 512 CRFINSTFLEQKEGCHMDF-EEDNDFLIYLVSFLGSLSVLPGNIISALLMDRIGRLKMIGGSMLISAVCCFFLFFGNSES 590
Cdd:cd17439  311 SKLINSTFLHNKEGCLLDFsDENNAYMIYFVSFLGTLAVLPGNIVSALLMDKIGRLRMLAGSSVMSCVSCFFLSFGNSES 390
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 591 AMIGWQCLFCGTSIAAWNALDVITVELYPTNQRATAFGILNGLCKFGAILGNTIFASFVGITKVVPILLAAASLVGGGLI 670
Cdd:cd17439  391 AMIALLCLFGGVSIASWNALDVLTVELYPSDKRTTAFGFLNALCKLAAVLGISIFTSFVGITKAVPILLASAALAAGSSL 470

                 ....*...
gi 157909825 671 ALRLPETR 678
Cdd:cd17439  471 ALKLPETR 478
MFS_SV2C cd17440
Synaptic vesicle glycoprotein 2C of the Major Facilitator Superfamily of transporters; ...
112-678 0e+00

Synaptic vesicle glycoprotein 2C of the Major Facilitator Superfamily of transporters; Synaptic vesicle glycoprotein 2 (SV2) is a transporter-like integral membrane glycoprotein, with 12 transmembrane regions, expressed in vertebrates and is localized to synaptic and endocrine secretory vesicles. Three isoforms have been identified, SV2A, SV2B, and SV2C. SV2A and SV2B are widely expressed in the brain, while SV2C is more restricted to evolutionarily older brain. SV2 isoforms have been shown to be critical for the proper function of the central nervous system. SV2 serves as the receptor for botulinum neurotoxin A (BoNT/A), one of seven neurotoxins produced by the bacterium Clostridium botulinum. BoNT/A blocks neurotransmitter release by cleaving synaptosome-associated protein of 25 kD (SNAP-25) within presynaptic nerve terminals. SV2C exhibits enriched expression in several basal ganglia nuclei, and has been found to be involved in normal operation of the basal ganglia network and could be also be involved in system adaptation in basal ganglia pathological conditions. SV2C belongs to the Metazoan Synaptic Vesicle Glycoprotein 2 (SV2) and related small molecule transporter family (SV2-like) of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340998 [Multi-domain]  Cd Length: 479  Bit Score: 688.96  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 112 FFVLGLALMADGVEIFVVSFALPSAEKDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASFASL 191
Cdd:cd17440    1 FFVLGMALMADGVEVFVVGFVLPSAETDMCIPNSGSGWLGSIVYLGMMVGAFFWGGLADKVGRRQSLLICMSVNGFFAFL 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 192 SSFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGIYASAMAWSIIPHYGWGFSMGTNY 271
Cdd:cd17440   81 SSFVQGYGLFLFCRLLSGFGIGGAVPTVFSYFAEVLAREKRGEHLSWLCMFWMIGGIYASAMAWAIIPHYGWSFSMGSAY 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 272 HFHSWRVFVIVCALPATVSMVALKFMPESPRFLLEMGKHDEAWMILKQVHDTNMRAKGTPEKVFTVSHIKtpkqmdefie 351
Cdd:cd17440  161 QFHSWRVFVIVCALPCVSSVVALTFMPESPRFLLEVGKHDEAWMILKQIHDTNMRARGQPEKVFTVNRIK---------- 230
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 352 iqsstgtwyqrwlvrfmtifkqvwdnalycvmgpyRMNTLILAVVWFTMALSYYGLTVWFPDMIRYFQdeeykskmkvff 431
Cdd:cd17440  231 -----------------------------------KDNTIKLTIVWLTLSFGYYGLSVWFPDVIKHLQ------------ 263
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 432 gehvhgatinftmenqihqhgklvndkfikmyFKHVLFEDTFFDKCYFEDVTSTDTYFKNCTIESTTFYNTDLYKHKFIN 511
Cdd:cd17440  264 --------------------------------FKSVTFEDSLFKSCFFEDVTSVNTYFRNCTFIETVFYNTDLEDYKFID 311
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 512 CRFINSTFLEQKEGCHMDFEED-NDFLIYLVSFLGSLSVLPGNIISALLMDRIGRLKMIGGSMLISAVCCFFLFFGNSES 590
Cdd:cd17440  312 SDFINCTFFHNKTGCQITFDDDySAYWIYFVNFLGTLAVLPGNIVSALLMDRIGRLTMLGGSMVLSGISCFFLWFGTSES 391
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 591 AMIGWQCLFCGTSIAAWNALDVITVELYPTNQRATAFGILNGLCKFGAILGNTIFASFVGITKVVPILLAAASLVGGGLI 670
Cdd:cd17440  392 MMIGMLCLYNGLTISAWNSLDVVTVELYPTDRRATGFGFLNALCKAAAVLGNLIFGSLVGITKAIPILLASTVLVCGGLV 471

                 ....*...
gi 157909825 671 ALRLPETR 678
Cdd:cd17440  472 GLRLPDTR 479
MFS_SV2_like cd17316
Metazoan Synaptic vesicle glycoprotein 2 (SV2) and related small molecule transporters of the ...
112-672 2.68e-49

Metazoan Synaptic vesicle glycoprotein 2 (SV2) and related small molecule transporters of the Major Facilitator Superfamily; This family is composed of metazoan synaptic vesicle glycoprotein 2 (SV2) and related small molecule transporters including those that transport inorganic phosphate (Pht), aromatic compounds (PcaK and related proteins), proline/betaine (ProP), alpha-ketoglutarate (KgtP), citrate (CitA), shikimate (ShiA), and cis,cis-muconate (MucK), among others. SV2 is a transporter-like protein that serves as the receptor for botulinum neurotoxin A (BoNT/A), one of seven neurotoxins produced by the bacterium Clostridium botulinum. BoNT/A blocks neurotransmitter release by cleaving synaptosome-associated protein of 25 kD (SNAP-25) within presynaptic nerve terminals. Also included in this family is synaptic vesicle 2 (SV2)-related protein (SVOP) and similar proteins. SVOP is a transporter-like nucleotide binding protein that localizes to neurotransmitter-containing vesicles. The SV2-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340874 [Multi-domain]  Cd Length: 353  Bit Score: 176.25  E-value: 2.68e-49
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 112 FFVLGLALMADGVEIFVVSFALP--SAEKDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASFA 189
Cdd:cd17316    1 LLLAGLGWFFDAYDFFLIGFVAPvlAAEFSLGLSLLQTGLLFAAGFLGRPIGALLFGYLGDRIGRKKALILTLLLFGLAT 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 190 SLSSFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGIYASAMAWSIIPHYGWGFsmgt 269
Cdd:cd17316   81 LLIGLLPTPILLLVLRFLQGIGIGGEYPGASTYVAEFAPSKRRGFALGLLQSGWALGALLAALVASLLIPLLSGDW---- 156
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 270 nyhfhSWRVFVIVCALPATVSMVAlkfmpesprfllemgkhdeawmilkqvhdtnmrakgtpekvftvshiktpkqmdef 349
Cdd:cd17316  157 -----GWRILFLIGALPALLALLL-------------------------------------------------------- 175
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 350 ieiqsstgtwyqrwlvrfmtifkqvwdnalycvmgpyRMNTLILAVVWFTMALSYYGLTVWFPdmiryfqdeeykskmkv 429
Cdd:cd17316  176 -------------------------------------RRRTLLLILLWFFISFGYYGLTTFLP----------------- 201
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 430 ffgehvhgatinftmenqihqhgklvndkfikmyfkhvlfedtffdkcyfedvtstdtyfknctiesttfyntdlykhkf 509
Cdd:cd17316      --------------------------------------------------------------------------------
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 510 incrfinsTFLEQkeGCHMDFEEdndflIYLVSFLGSLSVLPGNIISALLMDRIGRLKMIGGSMLISAVCCFFLFF--GN 587
Cdd:cd17316  202 --------TYLQT--VLGLSPAT-----SSLYLLLISLGALVGALIAGLLSDRIGRKKTLVIGLILSGILALPLFYllSG 266
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 588 SESAMIGWQCLFCGTSIAAWNALDVITVELYPTNQRATAFGILNGLCKFGAILGNTIFASFV--GITKVVPILLAAASLV 665
Cdd:cd17316  267 SPTLLLLLLFILSFFVGGVWGALYAYLAELFPTEVRATGVGLSYNLGRLGGGGAPPLIALLLasTGGTGVPALILALLAI 346

                 ....*..
gi 157909825 666 GGGLIAL 672
Cdd:cd17316  347 VALIVAL 353
2A0115 TIGR00895
benzoate transport; [Transport and binding proteins, Carbohydrates, organic alcohols, and ...
106-432 2.51e-36

benzoate transport; [Transport and binding proteins, Carbohydrates, organic alcohols, and acids]


Pssm-ID: 273327 [Multi-domain]  Cd Length: 398  Bit Score: 140.95  E-value: 2.51e-36
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825  106 RFQWTLFFVLGLALMADGVEIFVVSFALPSAEKDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAIN 185
Cdd:TIGR00895  13 RYQWRAIILSFLIMLMDGYDLAAMGFAAPAISAEWGLDPVQLGFLFSAGLIGMAFGALFFGPLADRIGRRRVLLWSILLF 92
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825  186 ASFASLSSFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGIYASAMAWSIIPHYGWgf 265
Cdd:TIGR00895  93 SVFTLLCALATNVTQLLILRFLAGLGLGGLMPNLNALVSEYAPKRFRGTAVGLMFCGYPIGAAVGGFLAGWLIPVFGW-- 170
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825  266 smgtnyhfHSwrVFVIVCALPATVSMVALKFMPESPRFLLEmgkhdeawmilkqvhdtnmraKGTPEKVFTVSHIKTPKQ 345
Cdd:TIGR00895 171 --------RS--LFYVGGIAPLLLLLLLMRFLPESIDFLVS---------------------KRPETVRRIVNAIAPQMQ 219
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825  346 MD---EFIEIQSSTGTWYqrwlVRFMTIFKqvwdnalycvmGPYRMNTLILAVVWFTMALSYYGLTVWFPDMIRyfqDEE 422
Cdd:TIGR00895 220 AEaqsALPEQKSTQGTKR----SVFKALFQ-----------GKTARITVLLWLLYFMLLVGVYFLTNWLPKLMV---ELG 281
                         330
                  ....*....|
gi 157909825  423 YKSKMKVFFG 432
Cdd:TIGR00895 282 FSLSLAATGG 291
2A0119 TIGR00898
cation transport protein; [Transport and binding proteins, Cations and iron carrying compounds]
105-682 3.69e-35

cation transport protein; [Transport and binding proteins, Cations and iron carrying compounds]


Pssm-ID: 273328 [Multi-domain]  Cd Length: 505  Bit Score: 139.77  E-value: 3.69e-35
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825  105 GRFQWTLFfVLGLALMADGVEIFVVSFALPSA----EKDM-CLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLS 179
Cdd:TIGR00898  83 GCEPLKLS-DLGLAATEPCLDGWEYSYDTFSStivtEWDLvCEDAWKVDLTQSCFFVGVLLGSFVFGYLSDRFGRKKVLL 161
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825  180 MSLAINASFASLSSFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGIYASAMAWsIIP 259
Cdd:TIGR00898 162 LSTLVTAVSGVLTAFSPNYTVFLVFRLLVGMGIGGIWVQAVVLNTEFLPKKQRAIVGTLIQVFFSLGLVLLPLVAY-FIP 240
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825  260 HygwgfsmgtnyhfhsWRVFVIVCALPATVSMVALKFMPESPRFLLEMGKHDEAWMILKQVHDTNMRAKGTPEKVFTVS- 338
Cdd:TIGR00898 241 D---------------WRWLQLAVSLPTFLFFLLSWFVPESPRWLISQGRIEEALKILQRIAKINGKKLPAEVLSLSLEk 305
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825  339 HIKTPKQMDEFIEiqsstgtwyqrwLVRFMTIfkqvwdnalycvmgpyRMNTLILAVVWFTMALSYYGLTVwfpdmiryf 418
Cdd:TIGR00898 306 DLSSSKKQYSFLD------------LFRTPNL----------------RKTTLCLMMLWFTTAFSYYGLVL--------- 348
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825  419 qdeeyksKMKVFFGEhvhgatinftmenqihqhgklvndkfikmyfkhvlfedtffdkcyfedvtstdtyfknctiestt 498
Cdd:TIGR00898 349 -------DLGNLGGN----------------------------------------------------------------- 356
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825  499 fyntdlykhkfincrfinstfleqkegchmdfeedndflIYLVSFLGSLSVLPGNIISALLMDRIGRLKMIGGSMLISAV 578
Cdd:TIGR00898 357 ---------------------------------------IYLDLFISGLVELPAKLITLLLIDRLGRRYTMAASLLLAGV 397
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825  579 CCFFLFFGNSES-------AMIGWQCLfcgtsIAAWNALDVITVELYPTNQRATAFGILNGLCKFGAILgnTIFASFVG- 650
Cdd:TIGR00898 398 ALLLLLFVPVDLyflrtalAVLGKFGI-----TSAFQMVYLYTAELYPTVVRNLGVGVCSTMARVGSII--SPFLVYLGe 470
                         570       580       590
                  ....*....|....*....|....*....|..
gi 157909825  651 ITKVVPILLAAASLVGGGLIALRLPETREQVL 682
Cdd:TIGR00898 471 KWLFLPLVLFGGLALLAGILTLFLPETKGVPL 502
MFS_PcaK_like cd17365
4-hydroxybenzoate transporter PcaK and similar transporters of the Major Facilitator ...
113-294 5.32e-25

4-hydroxybenzoate transporter PcaK and similar transporters of the Major Facilitator Superfamily; This aromatic acid:H(+) symporter subfamily includes Acinetobacter sp. 4-hydroxybenzoate transporter PcaK, Pseudomonas putida gallate transporter (GalT), Corynebacterium glutamicum gentisate transporter (GenK), Nocardioides sp. 1-hydroxy-2-naphthoate transporter (PhdT), Escherichia coli 3-(3-hydroxy-phenyl)propionate (3HPP) transporter (MhpT), and similar proteins. These transporters are involved in the uptake across the cytoplasmic membrane of specific aromatic compounds such as 4-hydroxybenzoate, gallate, gentisate (2,5-dihydroxybenzoate), 1-hydroxy-2-naphthoate, and 3HPP, respectively. The PcaK-like aromatic acid:H(+) symporter subfamily belongs to the Metazoan Synaptic Vesicle Glycoprotein 2 (SV2) and related small molecule transporter family (SV2-like) of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340923 [Multi-domain]  Cd Length: 351  Bit Score: 106.90  E-value: 5.32e-25
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 113 FVLGLALMADGVEIFVVSFALPSAEKDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASFASLS 192
Cdd:cd17365    2 ALCFLIIVLDGFDLAVMGFVAPALAQDWGLSPAQLGPVGSAALFGMAIGALLAGPLADRFGRKRVLLVSVALFGLFTLLT 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 193 SFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGIYASAMAWSIIPHYGwgfsmgtnyh 272
Cdd:cd17365   82 AFAQSVLQLALLRFLTGLGLGAAMPNAITLVSEYAPARRRSLAVTLMFCGYPLGAALGGFLAAALIPAFG---------- 151
                        170       180
                 ....*....|....*....|..
gi 157909825 273 fhsWRVFVIVCALPATVSMVAL 294
Cdd:cd17365  152 ---WRSVFLLGGVPPLILLPLL 170
MFS_SVOP_like cd17372
Synaptic vesicle 2-related protein (SVOP) and related proteins of the Major Facilitator ...
112-640 7.99e-25

Synaptic vesicle 2-related protein (SVOP) and related proteins of the Major Facilitator Superfamily; This subfamily is composed of synaptic vesicle 2 (SV2)-related protein (SVOP), SVOP-like protein (SVOPL), and similar proteins. SVOP is a transporter-like nucleotide binding protein that localizes to neurotransmitter-containing vesicles. Like SV2, SVOP is expressed in all brain regions, with highest levels in cerebellum, hindbrain and pineal gland. Studies with knockout mice suggets that SVOP may perform a subtle function that is not necessary for survival under normal conditions, since mice lacking SVOP are viable, fertile, and phenotypically normal. SVOP and SVOPL share structural similarity to the solute carrier family 22 (SLC22), a large family of organic cation and anion transporters. The SVOP-like subfamily belongs to the Metazoan Synaptic Vesicle Glycoprotein 2 (SV2) and related small molecule transporter family (SV2-like) of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340930 [Multi-domain]  Cd Length: 367  Bit Score: 106.85  E-value: 7.99e-25
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 112 FFVLGLALMADGVEIFVVSFALPSAEKDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASFASL 191
Cdd:cd17372    1 LAYAGMGWVAEAMEMMLLSFVGPAVQCEWNLSAWQVALITSVVFAGMMIGSYLWGIVSDKYGRRKGLIISALWTFYAGFL 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 192 SSFVQGYGAFLFCRLISGIGIGGSlPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGIYASAMAWSIIPHYGwgfsmgtny 271
Cdd:cd17372   81 SAFAPNYMWLIILRCLVGLGLGGG-PQLASWYLEFLPAKSRGTWMVLFSVFWTVGTIFEASLAWLVMPRLG--------- 150
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 272 hfhsWRVFVIVCALPATVSMVALKFMPESprfllemgkhdeawmilkqvhdtnmrakgtpekvftvshiktpkqmdefie 351
Cdd:cd17372  151 ----WRWLLAFSSVPSSLLLVFYRWTPKT--------------------------------------------------- 175
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 352 iqsstgtwyqrwlvrfmtifkqvwdnalycvmgpyrmnTLILAVVWFTMALSYYGLtvwfpdmiryfqdeeykskmkvff 431
Cdd:cd17372  176 --------------------------------------TLLLWVIWFGNAFAYYGV------------------------ 193
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 432 gehvhgatINFTMEnqihqhgklvndkfikmyfkhvLFEDTffDKCYFEDVTSTDTYFKNCTiesttfyntdlykhkfin 511
Cdd:cd17372  194 --------VLLTTE----------------------LNNSH--NVCGSKSDSDSGESPTEKQ------------------ 223
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 512 crfinstfleqkegCHMDFEEDndfliYLVSFLGSLSVLPGNIISALLMDRIGRLKMIGGSMLISAVCCFFLFFGNSESA 591
Cdd:cd17372  224 --------------CRNSNDVD-----YRDVFIATFAEFPGLLISAAMIDRLGRKASMASMLFTCCIFLLLLLICQSPFI 284
                        490       500       510       520       530
                 ....*....|....*....|....*....|....*....|....*....|.
gi 157909825 592 MIGWqcLFCGTSI--AAWNALDVITVELYPTNQRATAFGILNGLCKFGAIL 640
Cdd:cd17372  285 LTVL--LFGGRACisAAFTVVYIYTPEVYPTAVRALGVGTGSSVGRIGAIL 333
MFS_MucK cd17371
Cis,cis-muconate transport protein and similar proteins of the Major Facilitator Superfamily; ...
112-310 4.01e-23

Cis,cis-muconate transport protein and similar proteins of the Major Facilitator Superfamily; This subfamily is composed of Acinetobacter sp. Cis,cis-muconate transport protein (MucK), Escherichia coli putative sialic acid transporter 1, and similar proteins. MucK functions in the uptake of muconate and allows Acinetobacter calcoaceticus ADP1 (BD413) to grow on exogenous cis,cis-muconate as the sole carbon source. The MucK subfamily belongs to the Metazoan Synaptic Vesicle Glycoprotein 2 (SV2) and related small molecule transporter family (SV2-like) of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340929 [Multi-domain]  Cd Length: 389  Bit Score: 102.00  E-value: 4.01e-23
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 112 FFVLGLALMADGVEIFVVSFALPSAEKDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASFASL 191
Cdd:cd17371    1 FWAAFLGWALDGFDLLLLGLVLPALIAEFGLDEAEAGLLGTVTLAGGAIGGILGGILADRFGRVRVLVITILLFAVFTLL 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 192 SSFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGIYASAMAWSIIPHYGwgfsmgtny 271
Cdd:cd17371   81 CGFAQNYWQLLILRALAGLGFGGEWAAGAALMAEYVPARHRGKALGYVQSGWAVGWLLATLLAALLFPLLP--------- 151
                        170       180       190
                 ....*....|....*....|....*....|....*....
gi 157909825 272 HFHSWRVFVIVCALPATVSMVALKFMPESPRFLLEMGKH 310
Cdd:cd17371  152 PEIAWRVLFLLGALPALLVLFIRRFVKEPPQWQAARAAR 190
Sugar_tr pfam00083
Sugar (and other) transporter;
127-319 1.68e-21

Sugar (and other) transporter;


Pssm-ID: 395036 [Multi-domain]  Cd Length: 452  Bit Score: 97.73  E-value: 1.68e-21
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825  127 FVVSFALPSAEKDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASFASLSSFVQGYGAF---LF 203
Cdd:pfam00083  28 FFKNFGLSKSVSSLAALSVLSGLIVSIFSVGCFIGSLFAGKLGDRFGRKKSLLIANVLFVIGAVLQGAAKGKWSVyqlIV 107
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825  204 CRLISGIGIGGSLPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGIYAsamAWSiiphyGWGFSMGTNYHfhSWRVFVIVC 283
Cdd:pfam00083 108 GRVLVGIGVGGASVLAPMYISEIAPKKLRGALGSLYQLAITFGILLA---YIF-----GLGLNKTSNSD--GWRIPLGLQ 177
                         170       180       190
                  ....*....|....*....|....*....|....*.
gi 157909825  284 ALPATVSMVALKFMPESPRFLLEMGKHDEAWMILKQ 319
Cdd:pfam00083 178 LVPALLLIIGLLFLPESPRWLVEKGRLEEAREVLAK 213
MFS_SVOP cd17441
Synaptic vesicle 2-related protein (SVOP) of the Major Facilitator Superfamily; Synaptic ...
116-304 1.19e-20

Synaptic vesicle 2-related protein (SVOP) of the Major Facilitator Superfamily; Synaptic vesicle 2 (SV2)-related protein (SVOP) is a transporter-like nucleotide binding protein that localizes to neurotransmitter-containing vesicles. Like SV2, SVOP is expressed in all brain regions, with highest levels in cerebellum, hindbrain and pineal gland. Studies with knockout mice suggets that SVOP may perform a subtle function that is not necessary for survival under normal conditions, since mice lacking SVOP are viable, fertile, and phenotypically normal. SVOP shares structural similarity to the solute carrier family 22 (SLC22), a large family of organic cation and anion transporters. This SVOP subfamily belongs to the Metazoan Synaptic Vesicle Glycoprotein 2 (SV2) and related small molecule transporter family (SV2-like) of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340999 [Multi-domain]  Cd Length: 372  Bit Score: 94.11  E-value: 1.19e-20
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 116 GLALMADGVEIFVVSFALPSAEKDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASFASLSSFV 195
Cdd:cd17441    5 GLAWMADAMEMMILSILAPQLHCEWRLPSWQVALLTSVVFIGMMLSSSLWGNISDQYGRKTGLKISVLWTLYYGILSAFA 84
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 196 QGYGAFLFCRLISGIGIGGsLPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGIYASAMAWSIIPHYGwgfsmgtnyhfhs 275
Cdd:cd17441   85 PIYSWILVLRGLVGFGIGG-VPQSVTLYAEFLPMKSRAKCILLIEVFWALGTVFEVLLAVFVMPTLG------------- 150
                        170       180
                 ....*....|....*....|....*....
gi 157909825 276 WRVFVIVCALPATVSMVALKFMPESPRFL 304
Cdd:cd17441  151 WRWLLILSALPLLIFAVLCFWLPESARYW 179
MFS cd06174
Major Facilitator Superfamily; The Major Facilitator Superfamily (MFS) is a large and diverse ...
115-672 4.02e-20

Major Facilitator Superfamily; The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of substrates including ions, sugar phosphates, drugs, neurotransmitters, nucleosides, amino acids, and peptides. They do so using the electrochemical potential of the transported substrates. Uniporters transport a single substrate, while symporters and antiporters transport two substrates in the same or in opposite directions, respectively, across membranes. MFS proteins are typically 400 to 600 amino acids in length, and the majority contain 12 transmembrane alpha helices (TMs) connected by hydrophilic loops. The N- and C-terminal halves of these proteins display weak similarity and may be the result of a gene duplication/fusion event. Based on kinetic studies and the structures of a few bacterial superfamily members, GlpT (glycerol-3-phosphate transporter), LacY (lactose permease), and EmrD (multidrug transporter), MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement. Bacterial members function primarily for nutrient uptake, and as drug-efflux pumps to confer antibiotic resistance. Some MFS proteins have medical significance in humans such as the glucose transporter Glut4, which is impaired in type II diabetes, and glucose-6-phosphate transporter (G6PT), which causes glycogen storage disease when mutated.


Pssm-ID: 349949 [Multi-domain]  Cd Length: 378  Bit Score: 92.87  E-value: 4.02e-20
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 115 LGLALMADGVEIFVVSFALPSAEKDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASFASLSSF 194
Cdd:cd06174    1 LLLGFFLTGLARGLISPLLPALLQSFGLSASQLGLLFALFSLGYALLQPLAGLLADRFGRRPVLLLGLLLFALGALLFAF 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 195 VQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGIYASAMAWSIIPHYGWGfsmgtnyhfh 274
Cdd:cd06174   81 APSFWLLLLGRFLLGLGSGLIDPAVLALIADLFPERERGRALGLLQAFGSVGGILGPLLGGILASSLGFG---------- 150
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 275 sWRVFVIVCALPATVSMVALKFMPESPRFLLEMGKHDEAWmilkqvhdtnmrakgtpekvftvshiktpkqmdefieiqs 354
Cdd:cd06174  151 -WRAVFLIAAALALLAAILLLLVVPDPPESARAKNEEASS---------------------------------------- 189
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 355 stgtwyQRWLVRFMTIFKqvwdnalycvmgpyRMNTLILAVVWFTMALSYYGLTVWFPDMIryfqdeeykskmkvffgeh 434
Cdd:cd06174  190 ------KSVLKLLKRVLK--------------NPGLWLLLLAIFLVNLAYYSFSTLLPLFL------------------- 230
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 435 vhgatinftmenqihqhgklvndkfikmyfkhvlfedtffdkcyfedvtstdtyfknctiesttfyntdlykhkfincrf 514
Cdd:cd06174      --------------------------------------------------------------------------------
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 515 instfleqkegchMDFEEDNDFLIYLVSFLGSLSVLPGNIISALLMDR-IGRLKMIGGSMLISAVCCFFLFFGNSESAMI 593
Cdd:cd06174  231 -------------LDLGGLSVAVAGLLLSLFGLAGALGSLLLGLLSDRlIGRKPLLLIGLLLMALGLALLLLAPSLLLLL 297
                        490       500       510       520       530       540       550
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 157909825 594 GWQCLFCGTSIAAWNALDVITVELYPTNQRATAFGILNglckFGAILGNTIFASFVGITKVVPILLAAASLVGGGLIAL 672
Cdd:cd06174  298 LLLLLLGFGLGGLLPLSFALIAELFPPEIRGTAFGLLN----TFGFLGGAIGPLLAGFLLAATFGLTGAFLVLAVLLLL 372
MFS_XylE_like cd17359
D-xylose-proton symporter and similar transporters of the Major Facilitator Superfamily; This ...
123-309 1.73e-19

D-xylose-proton symporter and similar transporters of the Major Facilitator Superfamily; This subfamily includes bacterial transporters such as D-xylose-proton symporter (XylE or XylT), arabinose-proton symporter (AraE), galactose-proton symporter (GalP), major myo-inositol transporter IolT, glucose transport protein, putative metabolite transport proteins YfiG, YncC, and YwtG, and similar proteins. The symporters XylE, AraE, and GalP facilitate the uptake of D-xylose, arabinose, and galactose, respectively, across the boundary membrane with the concomitant transport of protons into the cell. IolT is involved in polyol metabolism and myo-inositol degradation into acetyl-CoA. The XylE-like subfamily belongs to the Glucose transporter -like (GLUT-like) family of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340917 [Multi-domain]  Cd Length: 383  Bit Score: 91.09  E-value: 1.73e-19
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 123 GVEIFVVSFALPSAEKDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASFASLSSFVQGYGAFL 202
Cdd:cd17359   14 GYDTGVINGALPFLQTDFNLTPFLEGLVVSSALLGAAIGALFAGRLADRFGRRKTLLISAVLFFISALGSAFSPNFTIFI 93
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 203 FCRLISGIGIGGSLPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGIYASAMAWSI--IPHYGWGFSMGtnyhfhsWRVFV 280
Cdd:cd17359   94 IARIIGGLAVGGASALVPMYIAEVAPAEIRGRLVSLNQLMIVFGQLLAYIVNYLIanAGGADWLGAEG-------WRWML 166
                        170       180
                 ....*....|....*....|....*....
gi 157909825 281 IVCALPATVSMVALKFMPESPRFLLEMGK 309
Cdd:cd17359  167 GLEAIPAILFLLGMLFIPESPRWLVSKGK 195
MFS_GLUT6_8_Class3_like cd17358
Glucose transporter (GLUT) types 6 and 8, Class 3 GLUTs, and similar transporters of the Major ...
142-313 5.48e-18

Glucose transporter (GLUT) types 6 and 8, Class 3 GLUTs, and similar transporters of the Major Facilitator Superfamily; This subfamily is composed of glucose transporter type 6 (GLUT6), GLUT8, plant early dehydration-induced gene ERD6-like proteins, and similar insect proteins including facilitated trehalose transporter Tret1-1. GLUTs, also called Solute carrier family 2, facilitated glucose transporters (SLC2A), are a family of proteins that facilitate the transport of hexoses such as glucose and fructose. There are fourteen GLUTs found in humans; they display different substrate specificities and tissue expression. They have been categorized into three classes based on sequence similarity: Class 1 (GLUTs 1-4, 14); Class 2 (GLUTs 5, 7, 9, and 11); and Class 3 (GLUTs 6, 8, 10, 12, and HMIT). Insect Tret1-1 is a low-capacity facilitative transporter for trehalose that mediates the transport of trehalose synthesized in the fat body and the incorporation of trehalose into other tissues that require a carbon source. GLUT proteins are comprised of about 500 amino acid residues, possess a single N-linked oligosaccharide, and have 12 transmembrane segments. They belong to the Glucose transporter -like (GLUT-like) family of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340916 [Multi-domain]  Cd Length: 436  Bit Score: 86.86  E-value: 5.48e-18
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 142 LSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASFASLSSFVQGYGAFLFCRLISGIGIGG---SLPI 218
Cdd:cd17358   38 LTVAQFSWFGSLLTLGALIGALLSGKLADRIGRKRTLLISAIPCILGWLLIAFAKDVWMLYLGRFLAGFGGGAasvVVPV 117
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 219 vfaYFSEFLSREKRGEhLSWLGIFWMTGGIYAsamawsiiphygwGFSMGTnyhFHSWRVFVIVCALPATVSMVALKFMP 298
Cdd:cd17358  118 ---YIAEIAPKNVRGA-LGSLNQLLVNIGILL-------------GYVLGS---FLPWRTLALIGAIPPVVFLILLFFIP 177
                        170
                 ....*....|....*
gi 157909825 299 ESPRFLLEMGKHDEA 313
Cdd:cd17358  178 ESPRWLAKKGREEEA 192
MFS_1 pfam07690
Major Facilitator Superfamily;
115-302 2.78e-17

Major Facilitator Superfamily;


Pssm-ID: 369468 [Multi-domain]  Cd Length: 346  Bit Score: 83.63  E-value: 2.78e-17
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825  115 LGLALMADGVEIFVVSFALPSA-EKDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASFASLSS 193
Cdd:pfam07690   1 LFLAAFLAALGRSLLGPALPLLlAEDLGISPTEIGLLLTLFSLGYALAQPLAGRLSDRFGRRRVLLIGLLLFALGLLLLL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825  194 FVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGIYASAMAWSIIPHYGWGFsmgtnyhf 273
Cdd:pfam07690  81 FASSLWLLLVLRVLQGLGAGALFPAAAALIADWFPPEERGRALGLLSAGFGLGAALGPLLGGLLASLFGWRA-------- 152
                         170       180
                  ....*....|....*....|....*....
gi 157909825  274 hswrVFVIVCALPATVSMVALKFMPESPR 302
Cdd:pfam07690 153 ----AFLILAILSLLAAVLAALLLPRPPP 177
MFS_SVOPL cd17442
Synaptic vesicle 2 (SV2)-related protein-like (SVOPL) of the Major Facilitator Superfamily; ...
111-300 5.32e-17

Synaptic vesicle 2 (SV2)-related protein-like (SVOPL) of the Major Facilitator Superfamily; Synaptic vesicle 2 (SV2)-related protein-like (SVOPL) or SVOP-like protein is a transporter-like protein that shares structural similarity to the solute carrier family 22 (SLC22), a large family of organic cation and anion transporters. It belongs to the Metazoan Synaptic Vesicle Glycoprotein 2 (SV2) and related small molecule transporter family (SV2-like) of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 341000 [Multi-domain]  Cd Length: 375  Bit Score: 83.32  E-value: 5.32e-17
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 111 LFFVLGLALMADGVEIFVVSFALPSAEKDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASFAS 190
Cdd:cd17442    2 LFLIMGSTGVAEAMEIMLLAVVSPEIRCEWHLEDWQVALVTTMVFFGYMVFSILLGLLADRYGRWKILLLSFVWGAYFSL 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 191 LSSFVQGYGAFLFCRLISGIGIGGSLPiVFAYFSEFLSREKRGEHLSWLGIFWMTGGIYASAMAWSIIPHYGwgfsmgtn 270
Cdd:cd17442   82 LTSFAPSYIWFVFLRCMVGCGVSGHSQ-GLIIKTEFLPTKYRGYMLPLSQIFWLAGSLLIIGLASVVIPTLG-------- 152
                        170       180       190
                 ....*....|....*....|....*....|
gi 157909825 271 yhfhsWRVFVIVCALPATVSMVALKFMPES 300
Cdd:cd17442  153 -----WRWLIRFASIPGIILIVVFKFIPRT 177
MFS_GLUT_like cd17315
Glucose transporters (GLUTs) and other similar sugar transporters of the Major Facilitator ...
123-308 9.62e-17

Glucose transporters (GLUTs) and other similar sugar transporters of the Major Facilitator Superfamily; This family is composed of glucose transporters (GLUTs) and other sugar transporters including fungal hexose transporters (HXT), bacterial xylose transporter (XylE), plant sugar transport proteins (STP) and polyol transporters (PLT), H(+)-myo-inositol cotransporter (HMIT), and similar proteins. GLUTs, also called Solute carrier family 2, facilitated glucose transporters (SLC2A), are a family of proteins that facilitate the transport of hexoses such as glucose and fructose. There are fourteen GLUTs found in humans; they display different substrate specificities and tissue expression. They have been categorized into three classes based on sequence similarity: Class 1 (GLUTs 1-4, 14); Class 2 (GLUTs 5, 7, 9, and 11); and Class 3 (GLUTs 6, 8, 10, 12, and HMIT). GLUT proteins are comprised of about 500 amino acid residues, possess a single N-linked oligosaccharide, and have 12 transmembrane segments. The GLUT-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340873 [Multi-domain]  Cd Length: 365  Bit Score: 82.24  E-value: 9.62e-17
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 123 GVEIFVVSFALPSAEKDMC--LSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASFASLSSFVQGYGA 200
Cdd:cd17315   10 GYDLGVINGALLYIAKDLGfgLSTSLQGLVVSSLLLGAAIGSLFGGPLADRFGRRKSLLIAAVLYVIGALLSALAPNVWV 89
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 201 FLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGEhlswLGIFW---MTGGIYASAMAwsiiphygwGFSMGtNYHFHSWR 277
Cdd:cd17315   90 LIVGRFLLGLGVGLASVLVPLYISEIAPAKIRGA----LGTLNqlmITFGILLAYLL---------GLALS-LSPPGWWR 155
                        170       180       190
                 ....*....|....*....|....*....|.
gi 157909825 278 VFVIVCALPATVSMVALKFMPESPRFLLEMG 308
Cdd:cd17315  156 LMFALAAVPALLQLLLMFFLPESRALLVGVG 186
SP TIGR00879
MFS transporter, sugar porter (SP) family; This model represent the sugar porter subfamily of ...
142-329 1.04e-16

MFS transporter, sugar porter (SP) family; This model represent the sugar porter subfamily of the major facilitator superfamily (pfam00083) [Transport and binding proteins, Carbohydrates, organic alcohols, and acids]


Pssm-ID: 273317 [Multi-domain]  Cd Length: 481  Bit Score: 83.16  E-value: 1.04e-16
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825  142 LSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLA---INASFASLSSFVQGYGAFLFCRLISGIGIGGSLPI 218
Cdd:TIGR00879  68 YSSSLWGLVVSIFLVGGFIGALFAGWLSDRFGRKKSLLIIALlfvIGAILMGLAAFALSVEMLIVGRVLLGIGVGIASAL 147
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825  219 VFAYFSEFLSREKRGEHLSWLGIFWMTGGIYASamawsiiphygwGFSMGTNYHFHS--WRVFVIVCALPATVSMVALKF 296
Cdd:TIGR00879 148 VPMYLSEIAPKALRGALTSLYQLAITFGILVAY------------GFGSGKVSLNNTlgWRIPLGLQLIPAGLLFLGLFF 215
                         170       180       190
                  ....*....|....*....|....*....|...
gi 157909825  297 MPESPRFLLEMGKHDEAWMILKQVHDTNMRAKG 329
Cdd:TIGR00879 216 LPESPRWLVGKGRVEEARKSLARLRGTSGEDKE 248
MFS_SLC22 cd17317
Solute carrier 22 (SLC22) family of organic cation/anion/zwitterion transporters of the Major ...
137-675 2.52e-15

Solute carrier 22 (SLC22) family of organic cation/anion/zwitterion transporters of the Major Facilitator Superfamily; The Solute carrier 22 (SLC22) family of organic cation/anion/zwitterion transporters includes organic cation transporters (OCTs), organic zwitterion/cation transporters (OCTNs), and organic anion transporters (OATs). SLC22 transporters interact with a variety of compounds that include drugs of abuse, environmental toxins, opioid analgesics, antidepressant and anxiolytic agents, and neurotransmitters and their metabolites. The SLC22 family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340875 [Multi-domain]  Cd Length: 331  Bit Score: 77.62  E-value: 2.52e-15
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 137 EKDMCLSSSKKGMLGLIVY-LGMMAGAFILGGLADKLGRKKVLSMSLAINASFASLSSFVQGYGAFLFCRLISGIGIGGS 215
Cdd:cd17317   16 EWDLVCDRDWLVALVQTIFfLGVLIGSLLFGYLADRFGRRPVLLLGLVLQIVCGVLSAFSPSYELFLVLRFLVGVTSAGI 95
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 216 LPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGIYASAMAwsiiphygwgfsmgtnYHFHSWRVFVIVCALPATVSMVALK 295
Cdd:cd17317   96 FTVGFVLGMEIVGPKYRSFVGILFGLFWALGYMLLALLA----------------YLIRDWRWLQLAISLPGLLFLLLLW 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 296 FMPesprfllemgkhdeawmilkqvhdtnmrakgtpekvftvshiktpkqmdefieiqsstgtwyqrwlvrfmtifkqvw 375
Cdd:cd17317  160 WLP----------------------------------------------------------------------------- 162
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 376 dnalycvmgpyrMNTLILAVVWFTMALSYYGLTvwfpdmiryfqdeeykskmkvffgehvhgatinftmenqihqhgklv 455
Cdd:cd17317  163 ------------RRTIIVGLIWFVTSLVYYGLS----------------------------------------------- 183
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 456 ndkfikmyfkhvlfedtffdkcyfedvtstdtyfknctiesttFYNTDLYKHKFINcrfinstfleqkegchmdfeednd 535
Cdd:cd17317  184 -------------------------------------------LNSSNLGGNLYLN------------------------ 196
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 536 fliylvSFLGSLSVLPGNIISALLMDRIGRLKMIGGSMLISAVCCFF-LFFGNSES------AMIGwqcLFCGTsiAAWN 608
Cdd:cd17317  197 ------FFLSGLVEIPAYFLALLLLDRLGRRWTLSGSLLLAGLACLVtALLPDDENtlaltlALVG---KFAIS--AAFS 265
                        490       500       510       520       530       540
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 157909825 609 ALDVITVELYPTNQRATAFGILNGLCKFGAILGNTIfASFVGITKVVP-ILLAAASLVgGGLIALRLP 675
Cdd:cd17317  266 VIYLYTAELYPTVVRNTGVGLCSTVARVGAILAPFI-VLLGKIGPLLPlIIFGVLALL-GGLLTLLLP 331
MFS_SLC46_TetA_like cd17330
Eukaryotic Solute carrier 46 (SLC46) family, Bacterial Tetracycline resistance proteins, and ...
111-305 4.98e-15

Eukaryotic Solute carrier 46 (SLC46) family, Bacterial Tetracycline resistance proteins, and similar proteins of the Major Facilitator Superfamily of transporters; This family is composed of the eukaryotic proteins MFSD9, MFSD10, MFSD14, and SLC46 family proteins, as well as bacterial multidrug resistance (MDR) transporters such as tetracycline resistance protein TetA and multidrug resistance protein MdtG. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. TetA proteins confer resistance to tetracycline while MdtG confers resistance to fosfomycin and deoxycholate. The Solute carrier 46 (SLC46) family is composed of three vertebrate members (SLC46A1, SLC46A2, and SLC46A3), the best-studied of which is SLC46A1, which functions both as an intestinal proton-coupled high-affinity folate transporter involved in the absorption of folates and as an intestinal heme transporter which mediates heme uptake. MFSD10 facilitates the uptake of organic anions such as some non-steroidal anti-inflammatory drugs (NSAIDs) and confers resistance to such NSAIDs. The SLC46/TetA-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340888 [Multi-domain]  Cd Length: 349  Bit Score: 76.85  E-value: 4.98e-15
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 111 LFFVLGLALMADGVEIFVVSFALPSAeKDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASFAS 190
Cdd:cd17330    1 LFLVVFLDALGFGIVFPVLPFYVREF-NKLGASGYYVGLLQSSYSLGQFLASPLWGRLSDRYGRKPVLLLSLAGSAVSYV 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 191 LSSFVQGYGAFLFCRLISGIGiGGSLPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGIYASAMAWSIIPHYgwGFSMgtn 270
Cdd:cd17330   80 LLGLSRNLWLLFLARFLDGLT-GGNVSVAQAYIADITDEEERAKAFGIISAAFGLGFILGPALGGFLSTPY--GYAL--- 153
                        170       180       190
                 ....*....|....*....|....*....|....*
gi 157909825 271 yhfhswrVFVIVCALPATVSMVALKFMPESPRFLL 305
Cdd:cd17330  154 -------PFLVAAALALLNLVLVLFFLPPLRRLLL 181
MFS_HXT cd17356
Fungal Hexose transporter subfamily of the Major Facilitator Superfamily of transporters and ...
142-305 8.82e-15

Fungal Hexose transporter subfamily of the Major Facilitator Superfamily of transporters and similar proteins; The fungal hexose transporter (HXT) subfamily is comprised of functionally redundant proteins that function mainly in the transport of glucose, as well as other sugars such as galactose and fructose. Saccharomyces cerevisiae has 20 genes that encode proteins in this family (HXT1 to HXT17, GAL2, SNF3, and RGT2). Seven of these (HXT1-7) encode functional glucose transporters. Gal2p is a galactose transporter, while Rgt2p and Snf3p act as cell surface glucose receptors that initiate signal transduction in response to glucose, functioning in an induction pathway responsible for glucose uptake. Rgt2p is activated by high levels of glucose and stimulates expression of low affinity glucose transporters such as Hxt1p and Hxt3p, while Snf3p generates a glucose signal in response to low levels of glucose, stimulating the expression of high affinity glucose transporters such as Hxt2p and Hxt4p. Schizosaccharomyces pombe contains eight GHT genes (GHT1-8) belonging to this family. Ght1, Ght2, and Ght5 are high-affinity glucose transporters; Ght3 is a high-affinity gluconate transporter; and Ght6 high-affinity fructose transporter. The substrate specificities for Ght4, Ght7, and Ght8 remain undetermined. The HXT subfamily belongs to the Glucose transporter -like (GLUT-like) family of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340914 [Multi-domain]  Cd Length: 403  Bit Score: 76.91  E-value: 8.82e-15
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 142 LSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASFASLSSFVQGYGAFLF-CRLISGIGIGGSLPIVF 220
Cdd:cd17356   42 PSSSRQGLIVSIVNLGSFFGALISSFLSDRIGRKKSIQIGCVIYIIGAIIQVAAIGKWYQLIvGRIIAGLGVGFASVLVP 121
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 221 AYFSEFLSREKRGehlswlgifwMTGGIYASAMAWSIIPHYGWGFSMGTNYHFHSWRVFVIVCALPATVSMVALKFMPES 300
Cdd:cd17356  122 VYQSEVAPKHIRG----------TLVSLYQLAITIGILVAYCINYGTHKLDGSAQWRIPLGLQIVWGLLLLIGMFFLPES 191

                 ....*
gi 157909825 301 PRFLL 305
Cdd:cd17356  192 PRWLY 196
PRK11551 PRK11551
putative 3-hydroxyphenylpropionic transporter MhpT; Provisional
116-304 2.15e-14

putative 3-hydroxyphenylpropionic transporter MhpT; Provisional


Pssm-ID: 236927 [Multi-domain]  Cd Length: 406  Bit Score: 75.38  E-value: 2.15e-14
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 116 GLALMADGVeifvvsfALPSAEKDMCLSsskKGMLGLIV---YLGMMAGAFILGGLADKLGRKKVLSMSLAINASFASLS 192
Cdd:PRK11551  28 GLDLQSAGV-------AAPRMAQEFGLD---VAQMGWAFsagILGLLPGALLGGRLADRIGRKRILIVSVALFGLFSLAT 97
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 193 SFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGEHLSWL--GI-FwmtGGIYASAMAWsiiphygwgFSMGT 269
Cdd:PRK11551  98 AQAWDFPSLLVARLLTGVGLGGALPNLIALTSEAVGPRLRGTAVSLMycGVpF---GGALASVIGV---------LAAGD 165
                        170       180       190
                 ....*....|....*....|....*....|....*.
gi 157909825 270 NyhfhSWR-VFVIVCALPATVSMVALKFMPESPRFL 304
Cdd:PRK11551 166 A----AWRhIFYVGGVGPLLLVPLLMRWLPESRAFA 197
2A0109 TIGR00887
phosphate:H+ symporter; This model represents the phosphate uptake symporter subfamily of the ...
99-407 2.62e-14

phosphate:H+ symporter; This model represents the phosphate uptake symporter subfamily of the major facilitator superfamily (pfam00083). [Transport and binding proteins, Anions]


Pssm-ID: 129965 [Multi-domain]  Cd Length: 502  Bit Score: 75.92  E-value: 2.62e-14
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825   99 IDECGHGRFQWTLFFVLGLALMADGVEIFVVSFALPSAEK-----DMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLG 173
Cdd:TIGR00887   5 ADTAPFGWQHFRAIVIAGVGFFTDSYDLFCISLVTKMLGYvyyhgKGPLPSSVSAAVNGSASIGTLAGQLFFGWLADKLG 84
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825  174 RKKVLSM--------SLAINASFASLSSFVQGYgaFLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGEHLSwlGIFWMT 245
Cdd:TIGR00887  85 RKRVYGMeliimiiaTVASGLSPGSSPKSVMAT--LCFWRFWLGVGIGGDYPLSAIITSEFATKKWRGAMMA--AVFAMQ 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825  246 G-GIYASAMAWSIIPHygwGFSMGTNY--HFHS------------WRVFVIVCALPATVSMVALKFMPESPRFLLEMGkH 310
Cdd:TIGR00887 161 GfGILAGAIVALIVLA---GFKHSLEAaaDEASctgscvpavdymWRILIGFGAVPALLALYFRLTIPETPRYTADVA-K 236
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825  311 DEAWMILKQVHDTNMRAKGTPEKV-FTVSHIKTPKqmdefieiQSSTGtwyqrwlvrFMTIFKQvWDNALYcvmgpyrmn 389
Cdd:TIGR00887 237 DVEQAASDMSAVLQVKIEAEPDEVeKASTAVEVPK--------ASWSD---------FFTHFFK-WRHGKH--------- 289
                         330
                  ....*....|....*...
gi 157909825  390 TLILAVVWFTMALSYYGL 407
Cdd:TIGR00887 290 LLGTAGSWFLLDIAFYGV 307
MFS_NepI_like cd17324
Purine ribonucleoside efflux pump NepI and similar transporters of the Major Facilitator ...
113-303 3.33e-14

Purine ribonucleoside efflux pump NepI and similar transporters of the Major Facilitator Superfamily; This family is composed of purine efflux pumps such as Escherichia coli NepI and Bacillus subtilis PbuE, sugar efflux transporters such as Corynebacterium glutamicum arabinose efflux permease, multidrug resistance (MDR) transporters such as Streptomyces lividans chloramphenicol resistance protein (CmlR), and similar proteins. NepI and PbuE are involved in the efflux of purine ribonucleosides such as guanosine, adenosine and inosine, as well as purine bases like guanine, adenine, and hypoxanthine, and purine base analogs. They play a role in the maintenance of cellular purine base pools, as well as in protecting the cells and conferring resistance against toxic purine base analogs such as 6-mercaptopurine. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. The NepI-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340882 [Multi-domain]  Cd Length: 370  Bit Score: 74.51  E-value: 3.33e-14
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 113 FVLGLALMADGVEIFVVSFALPSAEKDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASFASLS 192
Cdd:cd17324    2 LALALAAFAIGTTEYVIQGLLPDIARDFGVSVAQAGLLVSAYALGYALGALLLGPLSDRIERRRLLLVLLLLFILGNLLA 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 193 SFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGIYASAMAWSIIPHYGwgfsmgtnyh 272
Cdd:cd17324   82 ALAPSFALLLLARALAGLAHGGFWAIAAAYAADLVPPEKRGRAIGLVFSGLTLGLVLGRPLGGLLGQLLG---------- 151
                        170       180       190
                 ....*....|....*....|....*....|..
gi 157909825 273 fhsWR-VFVIVCALPATVSMVALKFMPESPRF 303
Cdd:cd17324  152 ---WRaAFLAIAVLALLAALLLWRLLPSLPPK 180
MFS_HMIT_like cd17360
H(+)-myo-inositol cotransporter and similar transporters of the Major Facilitator Superfamily; ...
128-302 3.54e-14

H(+)-myo-inositol cotransporter and similar transporters of the Major Facilitator Superfamily; This subfamily is composed of myo-inositol/inositol transporters and similar transporters from vertebrates, plant, and fungi. The human protein is called H(+)-myo-inositol cotransporter/Proton myo-inositol cotransporter (HMIT), or H(+)-myo-inositol symporter, or Solute carrier family 2 member 13 (SLC2A13). HMIT is classified as a Class 3 GLUT (glucose transporter) based on sequence similarity with GLUTs, but it does not transport glucose. It specifically transports myo-inositol and is expressed predominantly in the brain, with high expression in the hippocampus, hypothalamus, cerebellum and brainstem. HMIT may be involved in regulating processes that require high levels of myo-inositol or its phosphorylated derivatives, such as membrane recycling, growth cone dynamics, and synaptic vesicle exocytosis. Arabidopsis Inositol transporter 4 (AtINT4) mediates high-affinity H+ symport of myo-inositol across the plasma membrane. The HMIT-like subfamily belongs to the Glucose transporter -like (GLUT-like) family of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340918 [Multi-domain]  Cd Length: 362  Bit Score: 74.61  E-value: 3.54e-14
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 128 VVSFALPSAEKDMCLSSSKKGMLGLIV---YLGMMAGAFILGGLADKLGRKKVLSMSLAINASFASLSSFVQGYGAFLFC 204
Cdd:cd17360   15 VISGALLYIKDDLGEVVLSTGWQELIVsstVAGAAVGAAIGGWLNDRFGRRPCILLADALFTIGAIVMAAAPNKEVLIVG 94
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 205 RLISGIGIGGSLPIVFAYFSEFLSREKRGEHLSwLGIFWMTGGIYASAMawsiiphYGWGFSmgtnyHFH-SWRVFVIVC 283
Cdd:cd17360   95 RVLVGLGVGIASMTVPLYIAEAAPPRIRGRLVT-INVLFITGGQFVAYV-------INGAFS-----YLPgGWRWMLGLA 161
                        170
                 ....*....|....*....
gi 157909825 284 ALPATVSMVALKFMPESPR 302
Cdd:cd17360  162 AVPAVLQFIGLLFLPESPR 180
MFS_ExuT_GudP_like cd17319
Hexuronate transporter, Glucarate transporter, and similar transporters of the Major ...
110-263 3.82e-13

Hexuronate transporter, Glucarate transporter, and similar transporters of the Major Facilitator Superfamily; This family is composed of predominantly bacterial transporters for hexuronate (ExuT), glucarate (GudP), galactarate (GarP), and galactonate (DgoT). They mediate the uptake of these compounds into the cell. They belong to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340877 [Multi-domain]  Cd Length: 358  Bit Score: 71.45  E-value: 3.82e-13
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 110 TLFFVLGLALMADGVeifVVSFALPSAEKDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASFA 189
Cdd:cd17319    6 PLLFLAYVINYLDRV---NISVAAPTIMKDLGLSPTQYGLIASAFFLGYALFQVPGGWLLDRFGARKVLAVSMLLWSLFT 82
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 157909825 190 SLSSFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGIYASAMAWSIIPHYGW 263
Cdd:cd17319   83 ALTGFATSLTSLYVLRFLLGVAEAGFFPGAIKALAEWFPARERGRATGLFNSGAPLGAAIGPPLSGWLLLLFGW 156
MFS_MdtG_SLC18_like cd17325
bacterial MdtG-like and eukaryotic solute carrier 18 (SLC18) family of the Major Facilitator ...
106-267 1.70e-12

bacterial MdtG-like and eukaryotic solute carrier 18 (SLC18) family of the Major Facilitator Superfamily of transporters; This family is composed of eukaryotic solute carrier 18 (SLC18) family transporters and related bacterial multidrug resistance (MDR) transporters including several proteins from Escherichia coli such as multidrug resistance protein MdtG, from Bacillus subtilis such as multidrug resistance proteins 1 (Bmr1) and 2 (Bmr2), and from Staphylococcus aureus such as quinolone resistance protein NorA. The family also includes Escherichia coli arabinose efflux transporters YfcJ and YhhS. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. The SLC18 transporter family includes vesicular monoamine transporters (VAT1 and VAT2), vesicular acetylcholine transporter (VAChT), and SLC18B1, which is proposed to be a vesicular polyamine transporter (VPAT). The MdtG/SLC18 family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340883 [Multi-domain]  Cd Length: 375  Bit Score: 69.53  E-value: 1.70e-12
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 106 RFQWTLFFVLGLALMADGVEIFVVSFALPS-AEKDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAI 184
Cdd:cd17325  195 LLRDRRLLALFLAIFVLAFAFGALEPFLPLyAAELGGLSPAQIGLLFGAQGLASALSQPPAGKLSDRIGRKPLILIGLLL 274
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 185 NASFASLSSFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGIYASAMAWSIIPHYGWG 264
Cdd:cd17325  275 SAVALLLLPLATSFWLLLLLLALLGLGLGLVFPATLALLADIVPPEGRGTAMGLFNTAFSLGMVLGPLLGGFLYDAFGFA 354

                 ...
gi 157909825 265 FSM 267
Cdd:cd17325  355 TPF 357
MFS_GLUT_Class1_2_like cd17357
Class 1 and Class 2 Glucose transporters (GLUTs) of the Major Facilitator Superfamily; This ...
153-328 1.76e-12

Class 1 and Class 2 Glucose transporters (GLUTs) of the Major Facilitator Superfamily; This subfamily includes Class 1 and Class 2 glucose transporters (GLUTs) including Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1, also called glucose transporter type 1 or GLUT1), SLC2A2-5 (GLUT2-5), SLC2A7 (GLUT7), SLC2A9 (GLUT9), SLC2A11 (GLUT11), SLC2A14 (GLUT14), and similar proteins. GLUTs are a family of proteins that facilitate the transport of hexoses such as glucose and fructose. There are fourteen GLUTs found in humans; they display different substrate specificities and tissue expression. They have been categorized into three classes based on sequence similarity: Class 1 (GLUTs 1-4, 14); Class 2 (GLUTs 5, 7, 9, and 11); and Class 3 (GLUTs 6, 8, 10, 12, and HMIT). GLUTs 1-5 are the most thoroughly studied and are well-established as glucose and/or fructose transporters in various tissues and cell types. GLUT proteins are comprised of about 500 amino acid residues, possess a single N-linked oligosaccharide, and have 12 transmembrane segments. They belong to the Glucose transporter -like (GLUT-like) family of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340915 [Multi-domain]  Cd Length: 447  Bit Score: 69.98  E-value: 1.76e-12
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 153 IVYLGMMAGAFILGGLADKLGRKKVLSMSLAIN---ASFASLSSFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSR 229
Cdd:cd17357   57 IFFIGGAIGSFISAFLANRFGRKNGLLISNALLvvsSLLMFLSKSAKSPELLIFGRFLVGIACGLSTGFVPMYLQEISPS 136
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 230 EKRGEHLSWLGIFWMTGGIYASAMAWSIIphygwgfsMGTNYHfhsWRVFVIVCALPATVSMVALKFMPESPRFLL-EMG 308
Cdd:cd17357  137 ELRGALGSLTQIGVTLGILLGQVFGLPSV--------LGTETL---WPYLLFFPGIPALLQLAALPFFPESPKFLLiSKG 205
                        170       180
                 ....*....|....*....|
gi 157909825 309 KHDEAWMILKQVHDTNMRAK 328
Cdd:cd17357  206 DEEEAEKSLKFLRGIEDDVD 225
MFS_spinster_like cd17328
Protein spinster and spinster homologs of the Major Facilitator Superfamily of transporters; ...
127-311 7.65e-12

Protein spinster and spinster homologs of the Major Facilitator Superfamily of transporters; The protein spinster family includes Drosophila protein spinster, its vertebrate homologs, and similar proteins. Humans contain three homologs called protein spinster homologs 1 (SPNS1), 2 (SPNS2), and 3 (SPNS3). Protein spinster and its homologs may be sphingolipid transporters that play central roles in endosomes and/or lysosomes storage. SPNS2 is also called sphingosine 1-phosphate (S1P) transporter and is required for migration of myocardial precursors. S1P is a secreted lipid mediator that plays critical roles in cardiovascular, immunological, and neural development and function. The spinster-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340886 [Multi-domain]  Cd Length: 405  Bit Score: 67.65  E-value: 7.65e-12
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 127 FVVSFALPSAEKDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASFASLSSFVQGYGAFLFCRL 206
Cdd:cd17328   16 FTIAGVLPDIQSDFLIDDSLAGLLQTVFIISYMVLSPIFGYLGDRYNRKWILAVGILIWSAATLLSSFAPNFWQLLLFRA 95
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 207 ISGIGIGGSLPIVFAYFSEFLSREKRGehlSWLGIFWMtgGIY-ASAMAwsiiphYGWGFSMGTnyHFHSWRV-FVIVCA 284
Cdd:cd17328   96 LVGIGEASYSPIAPTIIADLFPKEKRT---RALGVFYF--AIPlGSGLG------YVVGGLVAQ--ATGGWRWaFRVTGV 162
                        170       180
                 ....*....|....*....|....*..
gi 157909825 285 LPATVSMVALKFMPESPRFLLEMGKHD 311
Cdd:cd17328  163 LGVLLAILLLLFVREPPRGAAEGGVMA 189
MFS_PhT cd17364
Inorganic Phosphate Transporter of the Major Facilitator Superfamily of transporters; This ...
114-287 1.37e-11

Inorganic Phosphate Transporter of the Major Facilitator Superfamily of transporters; This subfamily is composed of predominantly fungal and plant high-affinity inorganic phosphate transporters (PhT or PiPT), which are involved in the uptake, translocation, and internal transport of inorganic phosphate. They also function in sensing external phosphate levels as transceptors. Phosphate is crucial for structural and metabolic needs, including nucleotide and lipid synthesis, signalling and chemical energy storage. The Pht subfamily belongs to the Metazoan Synaptic Vesicle Glycoprotein 2 (SV2) and related small molecule transporter family (SV2-like) of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340922 [Multi-domain]  Cd Length: 389  Bit Score: 66.92  E-value: 1.37e-11
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 114 VLGLALMADGVEIFVVSFALPSAE-----KDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASF 188
Cdd:cd17364    3 IAGMGFFTDAYDLFSISLVTKILGrlyygGKGSLPSGVSGLVNAAALVGTIIGQLFFGFLGDRFGRKRVYGVELIIMIIG 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 189 ASLSSFVQG------YGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGIYASAMAWSIIPHYG 262
Cdd:cd17364   83 TILSALSPGstplgvMGWLIFFRFLLGIGIGGDYPLSATIMSEYANKKRRGALIAAVFAMQGFGILAGAIVTLILSAIFE 162
                        170       180
                 ....*....|....*....|....*.
gi 157909825 263 WGFSMGTNYHFH-SWRVFVIVCALPA 287
Cdd:cd17364  163 HPLPAGTYHHADlVWRIVLGLGAIPA 188
MFS_GLUT10_12_Class3_like cd17362
Glucose transporter (GLUT) types 10 and 12, Class 3 GLUTs, and similar transporters of the ...
123-303 1.80e-11

Glucose transporter (GLUT) types 10 and 12, Class 3 GLUTs, and similar transporters of the Major Facilitator Superfamily; This subfamily is composed of glucose transporter type 10, GLUT12, plant polyol transporters (PLTs), and similar proteins. GLUTs, also called Solute carrier family 2, facilitated glucose transporters (SLC2A), are a family of proteins that facilitate the transport of hexoses such as glucose and fructose. There are fourteen GLUTs found in humans; they display different substrate specificities and tissue expression. They have been categorized into three classes based on sequence similarity: Class 1 (GLUTs 1-4, 14); Class 2 (GLUTs 5, 7, 9, and 11); and Class 3 (GLUTs 6, 8, 10, 12, and HMIT). GLUT proteins are comprised of about 500 amino acid residues, possess a single N-linked oligosaccharide, and have 12 transmembrane segments. They belong to the Glucose transporter -like (GLUT-like) family of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340920 [Multi-domain]  Cd Length: 389  Bit Score: 66.22  E-value: 1.80e-11
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 123 GVEIFVVSFALPSAEKDMC-------LSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASFASLSSFV 195
Cdd:cd17362   10 GYDIGATSGALLSITSPALsgtdwynLSSLQSGLVVSGSLLGALLGSLVAGALIDRLGRRKELILAALLYLVGSLVTGLA 89
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 196 QGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGEHLSwLGIFWMTGGIYASamawsiiphYGWGFSMGTNyhFHS 275
Cdd:cd17362   90 PSYPVLLVGRLIYGVGIGLAMHAAPVYIAETSPSHIRGLLVS-LKELFIVLGILLG---------YVSGYAFADV--VGG 157
                        170       180
                 ....*....|....*....|....*...
gi 157909825 276 WRVFVIVCALPATVSMVALKFMPESPRF 303
Cdd:cd17362  158 WRYMYGLAAPPALLLGIGMWFLPPSPRW 185
MFS_OCT_plant cd17378
Plant organic cation/carnitine transporters of the Major Facilitator Superfamily of ...
535-675 3.58e-11

Plant organic cation/carnitine transporters of the Major Facilitator Superfamily of transporters; Plant organic cation/carnitine transporters (OCTs) are sequence-similar to their animal counterparts, which are broad-specificity transporters that play a critical role in the excretion and distribution of endogeneous organic cations and for the uptake, elimination and distribution of cationic drugs, toxins, and environmental waste products. Little is know about plant OCTs. In Arabidopsis, there are six genes belonging to this family that show distinct, organ-specific expression pattern of the individual genes. AtOCT1 has been found to affect root development and carnitine-related responses in Arabidopsis. AtOCT4, 5 and 6 are up-regulated during drought stress, AtOCT3 and 5 during cold stress and AtOCT5 and 6 during salt stress treatments. Plant OCTs belongs to the Solute carrier 22 (SLC22) family of organic cation/anion/zwitterion transporters of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340936 [Multi-domain]  Cd Length: 342  Bit Score: 65.07  E-value: 3.58e-11
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 535 DFLIYLVSFLGSLSVLPGNIISALLMDRIGRLKMIGGSMLISAVCCFFLFFgnSESAMIGWQCLFCGT-----SIAAWNA 609
Cdd:cd17378  200 KFNIYLSVALNALSELPAFVITAFLLDRFGRRPSLLGFTLLSGASCLLCFV--LSIGGTTSLQIALELvgffgAAGAFNL 277
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 157909825 610 LDVITVELYPTNQRATAFGILNGLCKFGAILGNTIFASFVGITKVVPILLAAASLVGGGLiALRLP 675
Cdd:cd17378  278 LYIYTVELFPTCVRNAALGMLRQALVVGGIFAPFIVSLGRKNAALSFGVFGVAILLLGLF-ALGLP 342
MFS_YfmO_like cd17474
Bacillus subtilis multidrug efflux protein YfmO and similar transporters of the Major ...
109-302 5.43e-11

Bacillus subtilis multidrug efflux protein YfmO and similar transporters of the Major Facilitator Superfamily; This family is composed of Bacillus subtilis multidrug efflux protein YfmO, bacillibactin exporter YmfD/YmfE, uncharacterized MFS-type transporter YvmA, and similar proteins. YfmO acts to efflux copper or a copper complex, and could contribute to copper resistance. YmfD/YmfE is involved in secretion of bacillibactin. The YfmO-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 341027 [Multi-domain]  Cd Length: 374  Bit Score: 64.90  E-value: 5.43e-11
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 109 WTLFFVLGLALMAdgveIFVVSFALPSAEKDMCLSSSkkgMLGLIVYLGMMAGAF---ILGGLADKLGRKKVLSMSLAIN 185
Cdd:cd17474    2 YAVFFATLLAVLG----VSIVDPILPAIAEALGASPA---QVGLLITAFTLPAAVlmpVAGVLADRFGRKKVLLPGLLLF 74
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 186 ASFASLSSFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGEHLswlgifwmtgGIYASAM--AWSIIPHYGw 263
Cdd:cd17474   75 GIGGLLCGLSDSFALLLAGRALQGIGAAGLGPLALTLIGDLFEGGERAKAM----------GLYEAALglGIAVGPLLG- 143
                        170       180       190
                 ....*....|....*....|....*....|....*....
gi 157909825 264 GFsMGTnyhfHSWRVFVIVCALPATVSMVALKFMPESPR 302
Cdd:cd17474  144 GL-LAA----ISWRYPFFLLAALIPVAFLAILFLLPEPK 177
MFS_PLT cd17437
Plant Polyol transporter family of the Major Facilitator Superfamily of transporters; The ...
123-303 7.26e-11

Plant Polyol transporter family of the Major Facilitator Superfamily of transporters; The plant Polyol transporter (PLT) subfamily includes PLT1-6 from Arabidopsis thaliana and similar transporters. The best characterized member of the group is Polyol transporter 5, also called Sugar-proton symporter PLT5, which mediates the H+-symport of numerous substrates including linear polyols (such as sorbitol, xylitol, erythritol or glycerol), cyclic polyol myo-inositol, and different hexoses, pentoses (including ribose), tetroses, and sugar alcohols. It functions to transport a wide range of substrates into specific sink tissues in the plant. The PLT subfamily belongs to the Glucose transporter -like (GLUT-like) family of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340995 [Multi-domain]  Cd Length: 387  Bit Score: 64.34  E-value: 7.26e-11
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 123 GVEIFVVSFALPSAEKDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASFASLSSFVQGYGAFL 202
Cdd:cd17437   10 GYDIGVMSGAVIFIKEDLKISDVQEEVLIGSLNIISLVGSLAAGRTSDWIGRRYTIALAALIFFVGALLMGVAPNYPVLM 89
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 203 FCRLISGIGIGGSLPIVFAYFSEFLSREKRGEHLSWLGIFwMTGGI---YASAMAWSiiphygwGFSMGTNyhfhsWRVF 279
Cdd:cd17437   90 VGRFVAGIGVGFALMIAPVYTAEVAPASSRGFLTSFPEIF-INIGIllgYVSNYAFS-------GLPLHVG-----WRLM 156
                        170       180
                 ....*....|....*....|....
gi 157909825 280 VIVCALPATVSMVALKFMPESPRF 303
Cdd:cd17437  157 LGVGAVPSLFLAIGVLAMPESPRW 180
MFS_MdtG_SLC18_like cd17325
bacterial MdtG-like and eukaryotic solute carrier 18 (SLC18) family of the Major Facilitator ...
115-302 8.12e-11

bacterial MdtG-like and eukaryotic solute carrier 18 (SLC18) family of the Major Facilitator Superfamily of transporters; This family is composed of eukaryotic solute carrier 18 (SLC18) family transporters and related bacterial multidrug resistance (MDR) transporters including several proteins from Escherichia coli such as multidrug resistance protein MdtG, from Bacillus subtilis such as multidrug resistance proteins 1 (Bmr1) and 2 (Bmr2), and from Staphylococcus aureus such as quinolone resistance protein NorA. The family also includes Escherichia coli arabinose efflux transporters YfcJ and YhhS. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. The SLC18 transporter family includes vesicular monoamine transporters (VAT1 and VAT2), vesicular acetylcholine transporter (VAChT), and SLC18B1, which is proposed to be a vesicular polyamine transporter (VPAT). The MdtG/SLC18 family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340883 [Multi-domain]  Cd Length: 375  Bit Score: 64.13  E-value: 8.12e-11
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 115 LGLALMADGVEIFVVSFALPSAEKDMCLSSSkkgMLGLIV---YLGMMAGAFILGGLADKLGRKKVLSMSLAINASFASL 191
Cdd:cd17325    1 LSLALFLDMLGYGIIIPILPLYAESLGASVA---QIGLIVaayALAQLLFSPPAGRLSDRFGRKRLLLLGLLLLAVSTLL 77
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 192 SSFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGIYASAMAWSIIPHYGWGFsmgtny 271
Cdd:cd17325   78 FAFATSYWQLLLARFLQGLASAAVWPAAMALIADIAPPEERGRAMGIFSSAIGLGFLIGPLLGGLLADALGYRA------ 151
                        170       180       190
                 ....*....|....*....|....*....|..
gi 157909825 272 hfhswrVFvIVCALPATVSMV-ALKFMPESPR 302
Cdd:cd17325  152 ------PF-LVCAALALLALVlALLLLPEPRP 176
AraJ COG2814
Predicted arabinose efflux permease, MFS family [Carbohydrate transport and metabolism];
106-258 1.40e-10

Predicted arabinose efflux permease, MFS family [Carbohydrate transport and metabolism];


Pssm-ID: 225371 [Multi-domain]  Cd Length: 394  Bit Score: 63.79  E-value: 1.40e-10
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 106 RFQWTLFFVLGLALMADGVEIFVVSFALPSAEKDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAIN 185
Cdd:COG2814    9 KPMWLALLALALAAFAIGTTEFVPVGLLPPIAADLGVSEGAAGQLITAYALGVALGAPLLALLTGRLERRRLLLGLLALF 88
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 186 ASFASLSSFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKR-------------------------GEHLSWLG 240
Cdd:COG2814   89 IVSNLLSALAPSFAVLLLARALAGLAHGVFWSIAAALAARLVPPGKRgralalvftgltlatvlgvplgtflGQLFGWRA 168
                        170
                 ....*....|....*...
gi 157909825 241 IFWMTGGIYASAMAWSII 258
Cdd:COG2814  169 TFLAIAVLALLALLLLWK 186
MFS_GLUT8_Class3 cd17433
Glucose transporter type 8, a Class 3 GLUT, of the Major Facilitator Superfamily of ...
130-318 2.18e-10

Glucose transporter type 8, a Class 3 GLUT, of the Major Facilitator Superfamily of transporters; Glucose transporter type 8 (GLUT8) is also called Solute carrier family 2, facilitated glucose transporter member 8 (SLC2A8) or glucose transporter type X1 (GLUTX1). It is classified as a Class 3 GLUT protein and is an insulin-regulated facilitative glucose transporter predominantly expressed in testis and brain. It can also transport fructose and galactose. SLC2A8 knockout mice were viable, developed normally, and display only a very mild phenotype, including mild alterations in the brain (increased proliferation of hippocampal neurons), heart (impaired transmission of electrical wave through the atrium), and sperm cells (reduced number of motile sperm cells). GLUT proteins are comprised of about 500 amino acid residues, possess a single N-linked oligosaccharide, and have 12 transmembrane segments. They belong to the Glucose transporter -like (GLUT-like) family of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340991 [Multi-domain]  Cd Length: 416  Bit Score: 62.97  E-value: 2.18e-10
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 130 SFALPSAEK----DMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSM-SLAINASFASLSSfVQGYGAFLFC 204
Cdd:cd17433   22 SPAIPSLQRiadpALRLDDAAASWFGSVVTLGAAAGGVLGGWIVDRAGRKLSLMLcSVPFIAGFTVITA-AQNVWMLYVG 100
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 205 RLISGIGIGGSLPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGIYASAMAWsiiphygwgfsmgtnyhFHSWRVFVIVCA 284
Cdd:cd17433  101 RLLTGLASGVTSLVVPVYISEIAHPRVRGTLGSCVQLMVVIGIMGAYLAGL-----------------VLDWRWLAVLGS 163
                        170       180       190
                 ....*....|....*....|....*....|....
gi 157909825 285 LPATVSMVALKFMPESPRFLLEMGKHDEAWMILK 318
Cdd:cd17433  164 IPPTLMLLLMCFMPETPRFLLTQHRRQEAMAALR 197
MFS_1 pfam07690
Major Facilitator Superfamily;
537-680 2.93e-10

Major Facilitator Superfamily;


Pssm-ID: 369468 [Multi-domain]  Cd Length: 346  Bit Score: 62.44  E-value: 2.93e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825  537 LIYLVSFLGSLSVLPGNIISALLMDRIGRLKMIGGSMLISAVCCFFLFFGNSESAMIGWQCL---FCGTSIAAWNAldvI 613
Cdd:pfam07690  33 EIGLLLTLFSLGYALAQPLAGRLSDRFGRRRVLLIGLLLFALGLLLLLFASSLWLLLVLRVLqglGAGALFPAAAA---L 109
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 157909825  614 TVELYPTNQRATAFGILNGLCKFGAILGNTIFASFVGIT--KVVPILLAAASLVGGGLIALRLPETREQ 680
Cdd:pfam07690 110 IADWFPPEERGRALGLLSAGFGLGAALGPLLGGLLASLFgwRAAFLILAILSLLAAVLAALLLPRPPPE 178
MFS_MdtG_SLC18_like cd17325
bacterial MdtG-like and eukaryotic solute carrier 18 (SLC18) family of the Major Facilitator ...
534-680 6.80e-10

bacterial MdtG-like and eukaryotic solute carrier 18 (SLC18) family of the Major Facilitator Superfamily of transporters; This family is composed of eukaryotic solute carrier 18 (SLC18) family transporters and related bacterial multidrug resistance (MDR) transporters including several proteins from Escherichia coli such as multidrug resistance protein MdtG, from Bacillus subtilis such as multidrug resistance proteins 1 (Bmr1) and 2 (Bmr2), and from Staphylococcus aureus such as quinolone resistance protein NorA. The family also includes Escherichia coli arabinose efflux transporters YfcJ and YhhS. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. The SLC18 transporter family includes vesicular monoamine transporters (VAT1 and VAT2), vesicular acetylcholine transporter (VAChT), and SLC18B1, which is proposed to be a vesicular polyamine transporter (VPAT). The MdtG/SLC18 family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340883 [Multi-domain]  Cd Length: 375  Bit Score: 61.44  E-value: 6.80e-10
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 534 NDFLIYLVSFLGSLSVLPGNIISALLMDRIGRLKMIGGSMLISAVCCFFLFFGNSESAMIGWQCLFCGTSIAAWNALDVI 613
Cdd:cd17325   29 SVAQIGLIVAAYALAQLLFSPPAGRLSDRFGRKRLLLLGLLLLAVSTLLFAFATSYWQLLLARFLQGLASAAVWPAAMAL 108
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 614 TVELYPTNQRATAFGILNGLCKFGAILGNTI---FASFVGItKVVPILLAAASLVGGGLIALRLPETREQ 680
Cdd:cd17325  109 IADIAPPEERGRAMGIFSSAIGLGFLIGPLLgglLADALGY-RAPFLVCAALALLALVLALLLLPEPRPP 177
MFS_OCT_plant cd17378
Plant organic cation/carnitine transporters of the Major Facilitator Superfamily of ...
135-307 1.00e-09

Plant organic cation/carnitine transporters of the Major Facilitator Superfamily of transporters; Plant organic cation/carnitine transporters (OCTs) are sequence-similar to their animal counterparts, which are broad-specificity transporters that play a critical role in the excretion and distribution of endogeneous organic cations and for the uptake, elimination and distribution of cationic drugs, toxins, and environmental waste products. Little is know about plant OCTs. In Arabidopsis, there are six genes belonging to this family that show distinct, organ-specific expression pattern of the individual genes. AtOCT1 has been found to affect root development and carnitine-related responses in Arabidopsis. AtOCT4, 5 and 6 are up-regulated during drought stress, AtOCT3 and 5 during cold stress and AtOCT5 and 6 during salt stress treatments. Plant OCTs belongs to the Solute carrier 22 (SLC22) family of organic cation/anion/zwitterion transporters of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340936 [Multi-domain]  Cd Length: 342  Bit Score: 60.45  E-value: 1.00e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 135 SAEKDMCLSSSKKGMLGLIVYLGMMAGAFILGGLAD-KLGRKKVLSMSLAINASFASLSSFVQGYGAFLFCRLISGIGIG 213
Cdd:cd17378   23 SEWGLICAGSFLVGLPQSSFFVGCLIGSGVLGHLADsSLGRKNLLFLSCLLMALSGIATAFSPNYWVYAFLRFLTGFGRS 102
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 214 GSLPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGIYASAMAWsiiphygwgfsmgtnYHFHSWRVFVIVCALPATVSMVA 293
Cdd:cd17378  103 GIGTCALVLATEPVGPKWRGQVGMSTFFFFVLGFMSLPGIAY---------------LNGSSWRVLYFWTSIPALIYCIL 167
                        170
                 ....*....|....
gi 157909825 294 LKFMPEspRFLLEM 307
Cdd:cd17378  168 VYLFAR--RLLAVM 179
ProP COG0477
MFS family permease [Carbohydrate transport and metabolism, Amino acid transport and ...
109-317 1.74e-09

MFS family permease [Carbohydrate transport and metabolism, Amino acid transport and metabolism, Inorganic ion transport and metabolism, General function prediction only];


Pssm-ID: 223553 [Multi-domain]  Cd Length: 338  Bit Score: 59.70  E-value: 1.74e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 109 WTLFFVLGLALMADGVEIFVVSFALPSAEKDMCLSSSKK--GMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAINA 186
Cdd:COG0477    1 KRSLLALALAALLLGLDLGLLSPALPLLLSTLSLSSGRLlyGLLLSAFFLGYAIGSLLAGPLGDRYGRRKVLIIGLLLFL 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 187 SFASLSSFV--QGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLS-REKRGEHLSWLGIFWMTGGIYASAMAWSIIPHYGW 263
Cdd:COG0477   81 LGTLLLALApnVGLALLLILRLLQGLGGGGLLPVASALLSEWFPeATERGLAVGLVTLGAGALGLALGPLLAGLLLGALL 160
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|....
gi 157909825 264 GFSMGTNYHFHSWRVFVIVCALPATVSMVALKFMPESPRFLLEMGKHDEAWMIL 317
Cdd:COG0477  161 WGWRAAFLLAALLGLLLLILVLLLDLLLAAPRLPLAVGLALIELGKLLLLLLIL 214
MFS cd06174
Major Facilitator Superfamily; The Major Facilitator Superfamily (MFS) is a large and diverse ...
106-294 2.21e-09

Major Facilitator Superfamily; The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of substrates including ions, sugar phosphates, drugs, neurotransmitters, nucleosides, amino acids, and peptides. They do so using the electrochemical potential of the transported substrates. Uniporters transport a single substrate, while symporters and antiporters transport two substrates in the same or in opposite directions, respectively, across membranes. MFS proteins are typically 400 to 600 amino acids in length, and the majority contain 12 transmembrane alpha helices (TMs) connected by hydrophilic loops. The N- and C-terminal halves of these proteins display weak similarity and may be the result of a gene duplication/fusion event. Based on kinetic studies and the structures of a few bacterial superfamily members, GlpT (glycerol-3-phosphate transporter), LacY (lactose permease), and EmrD (multidrug transporter), MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement. Bacterial members function primarily for nutrient uptake, and as drug-efflux pumps to confer antibiotic resistance. Some MFS proteins have medical significance in humans such as the glucose transporter Glut4, which is impaired in type II diabetes, and glucose-6-phosphate transporter (G6PT), which causes glycogen storage disease when mutated.


Pssm-ID: 349949 [Multi-domain]  Cd Length: 378  Bit Score: 59.75  E-value: 2.21e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 106 RFQWTLFFVLGLALMADGVEIFVVSFALPSAEKDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKL-GRKKVLSMSLAI 184
Cdd:cd06174  200 LKNPGLWLLLLAIFLVNLAYYSFSTLLPLFLLDLGGLSVAVAGLLLSLFGLAGALGSLLLGLLSDRLiGRKPLLLIGLLL 279
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 185 NASFASLSSFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGIYASAMAwsiiphyGWG 264
Cdd:cd06174  280 MALGLALLLLAPSLLLLLLLLLLLGFGLGGLLPLSFALIAELFPPEIRGTAFGLLNTFGFLGGAIGPLLA-------GFL 352
                        170       180       190
                 ....*....|....*....|....*....|
gi 157909825 265 FSMGTNYHFhswrVFVIVCALPATVSMVAL 294
Cdd:cd06174  353 LAATFGLTG----AFLVLAVLLLLAAILLL 378
MFS_SLC22A7_OAT2 cd17447
Solute carrier family 22 member 7 (also called Organic anion transporter 2) of the Major ...
153-298 2.74e-09

Solute carrier family 22 member 7 (also called Organic anion transporter 2) of the Major Facilitator Superfamily of transporters; Solute carrier family 22 member 7 (SLC22A7), also called organic anion transporter 2 (OAT2) mediates sodium-independent transport of a variety of organic anions including prostaglandin E2, prostaglandin F2, tetracycline, bumetanide, estrone sulfate, glutarate, dehydroepiandrosterone sulfate, allopurinol, 5-fluorouracil, paclitaxel, L-ascorbic acid, salicylate, ethotrexate, and alpha-ketoglutarate. It also plays a role in renal uric acid uptake from blood as a first step of tubular secretion. OAT2 belongs to the Solute carrier 22 (SLC22) family of organic cation/anion/zwitterion transporters of the Major Facilitator Superfamily (MFS)of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 341005 [Multi-domain]  Cd Length: 341  Bit Score: 59.36  E-value: 2.74e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 153 IVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASFASLSSFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSRekr 232
Cdd:cd17447   43 FFFAGVTMGAVAFGYLSDRFGRKRMLLVAYVLSLVFGLASAFSVSYVMFAITRTLTGFALTGFSIISMVLCVEWVDI--- 119
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 157909825 233 gEHLSWLGIFwmtggiyaSAMAWSIiphyGWGFSMGTNYHFHSWRVFVIVCALPATVSMVALKFMP 298
Cdd:cd17447  120 -EHRTVAGVL--------ISLFWTV----GNMLLALVAYLIRDWRWLILAVTLPCAPGIITWWWVP 172
MFS_MdfA_MDR_like cd17320
Multidrug transporter MdfA and similar multidrug resistance (MDR) transporters of the Major ...
156-301 2.83e-09

Multidrug transporter MdfA and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily; This family is composed of bacterial multidrug resistance (MDR) transporters including several proteins from Escherichia coli such as MdfA (also called chloramphenicol resistance pump Cmr), EmrD, MdtM, MdtL, bicyclomycin resistance protein (also called sulfonamide resistance protein), and the uncharacterized inner membrane transport protein YdhC. EmrD is a proton-dependent secondary transporter, first identified as an efflux pump for uncouplers of oxidative phosphorylation. It expels a range of drug molecules and amphipathic compounds across the inner membrane of E. coli. Similarly, MdfA is a secondary multidrug transporter that exports a broad spectrum of structurally and electrically dissimilar toxic compounds. These MDR transporters are drug/H+ antiporters (DHA) belonging to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340878 [Multi-domain]  Cd Length: 379  Bit Score: 59.51  E-value: 2.83e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 156 LGMMAGAFILGGLADKLGRKKVLSMSLAINASFASLSSFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGEH 235
Cdd:cd17320   45 LGFALGQLLYGPLSDRFGRRPVLLAGLLLFILASLLCALASSIEQLLIARFLQGLGAAAGSVVARAIVRDLYSGAELAKI 124
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 157909825 236 LSWLGIFWMTGGIYASAMAWSIIPHYGWgfsmgtnyhfHSwrVFVIVCALPATVSMVALKFMPESP 301
Cdd:cd17320  125 FSLLMMILAIAPALAPLLGGLLLLFFGW----------RA--IFVFLALLGLLLLLLVLLFLPETL 178
MFS_MMR_MDR_like cd17321
Methylenomycin A resistance protein (also called MMR peptide) and similar multidrug resistance ...
115-264 4.04e-09

Methylenomycin A resistance protein (also called MMR peptide) and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily; This family is composed of bacterial, fungal, and archaeal multidrug resistance (MDR) transporters including several proteins from Bacilli such as methylenomycin A resistance protein (also called MMR peptide), tetracycline resistance protein (TetB), and lincomycin resistance protein LmrB, as well as fungal proteins such as vacuolar basic amino acid transporters, which are involved in the transport into vacuoles of the basic amino acids histidine, lysine, and arginine in Saccharomyces cerevisiae, and aminotriazole/azole resistance proteins. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. For example, MMR confers resistance to the epoxide antibiotic methylenomycin while TetB resistance to tetracycline by an active tetracycline efflux. MMR-like MDR transporters belong to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340879 [Multi-domain]  Cd Length: 370  Bit Score: 58.72  E-value: 4.04e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 115 LGLALMADGVEIFVVSFALPSAEKDMCLSSSkkgMLGLIV--YLgMMAGAFIL--GGLADKLGRKKVLSMSLAINAsFAS 190
Cdd:cd17321    1 LLLAVFLAALDVTIVNVALPTIARDLGASPS---QLQWVVnaYL-LAFAALLLlaGRLGDRFGRKRVFLIGLALFG-LAS 75
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 157909825 191 -LSSFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGIYASAMAWSIIPHYGWG 264
Cdd:cd17321   76 lLCALAPSLAFLIAARALQGIGAAAIMPASLALIAATFPGERRGRALGLWGAVVGIGAALGPLLGGLLLELFGWR 150
MFS_GLUT_Class1 cd17431
Class 1 Glucose transporters (GLUTs) of the Major Facilitator Superfamily; GLUTs, also called ...
153-323 1.89e-08

Class 1 Glucose transporters (GLUTs) of the Major Facilitator Superfamily; GLUTs, also called Solute carrier family 2, facilitated glucose transporters (SLC2A), are a family of proteins that facilitate the transport of hexoses such as glucose and fructose. There are fourteen GLUTs found in humans; they display different substrate specificities and tissue expression. They have been categorized into three classes based on sequence similarity: Class 1 (GLUTs 1-4, 14); Class 2 (GLUTs 5, 7, 9, and 11); and Class 3 (GLUTs 6, 8, 10, 12, and HMIT). GLUTs 1-4 are well-established as glucose and/or fructose transporters in various tissues and cell types. GLUT1, also called solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1), displays broad substrate specificity and can transport a wide range of pentoses and hexoses including glucose, galactose, mannose, and glucosamine. It is found in the brain, erythrocytes, and in many fetal tissues. GLUT2 (or SLC2A2) is found in the liver, islet of Langerhans, intestine, and kidney, and is the isoform that likely mediates the bidirectional transfer of glucose across the plasma membrane of hepatocytes and is responsible for uptake of glucose by beta cells. GLUT3 (or SLC2A3) is found in the brain and can mediates the uptake of glucose, 2-deoxyglucose, galactose, mannose, xylose and fucose, and dehydroascorbate. GLUT4 (or SLC2A4) is an insulin-regulated facilitative glucose transporter found in adipose tissues, and in skeletal and cardiac muscle. GLUT14 (or SLC2A14) is an orphan transporter expressed mainly in the testis. GLUT proteins are comprised of about 500 amino acid residues, possess a single N-linked oligosaccharide, and have 12 transmembrane segments. They belong to the Glucose transporter -like (GLUT-like) family of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340989 [Multi-domain]  Cd Length: 445  Bit Score: 56.96  E-value: 1.89e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 153 IVYLGMMAGAFILGGLADKLGRKKVLSMS--LAI-NASFASLSSFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSR 229
Cdd:cd17431   58 IFSVGGMIGSFSVGLFVNRFGRRNSMLYNnlLAFaGAALMGLSKLAKSYEMLILGRFIIGLYCGLTTGLVPMYIGEISPT 137
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 230 EKRGE--HLSWLGIfwmTGGIYASAMawsiiphYGWGFSMGTNYHFHSWRVFVIVcalPATVSMVALKFMPESPRFLL-E 306
Cdd:cd17431  138 ALRGAlgTLHQLGI---VVGILISQI-------FGLEFILGTEELWPLLLGFTIV---PAILQLALLPFCPESPRYLLiN 204
                        170
                 ....*....|....*..
gi 157909825 307 MGKHDEAWMILKQVHDT 323
Cdd:cd17431  205 RNEEEEAKSVLKKLRGT 221
2A0115 TIGR00895
benzoate transport; [Transport and binding proteins, Carbohydrates, organic alcohols, and ...
110-246 2.41e-08

benzoate transport; [Transport and binding proteins, Carbohydrates, organic alcohols, and acids]


Pssm-ID: 273327 [Multi-domain]  Cd Length: 398  Bit Score: 56.60  E-value: 2.41e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825  110 TLFFVLGLALMadgveIFVVSFA---LPSAEKDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAINA 186
Cdd:TIGR00895 252 TVLLWLLYFML-----LVGVYFLtnwLPKLMVELGFSLSLAATGGALFNFGGVIGSIIFGWLADRLGPRVTALLLLLGAV 326
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825  187 SFASLSSFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGEhlswlGIFWMTG 246
Cdd:TIGR00895 327 FAVLVGSTLFSPTLLLLLGAIAGFFVNGGQSGLYALMALFYPTAIRAT-----GVGWAIG 381
MFS_SLC22A1_2_3 cd17379
Solute carrier family 22 members 1, 2, and 3 (also called Organic cation transporters 1, 2, ...
141-263 2.94e-08

Solute carrier family 22 members 1, 2, and 3 (also called Organic cation transporters 1, 2, and 3) of the Major Facilitator Superfamily of transporters; This sufamily includes solute carrier family 22 member 1 (SLC22A1, also called organic cation transporter 1 or OCT1), SLC22A2 (or OCT2), SLC22A3 (or OCT3), and similar proteins. OCT1-3 have similar basic functional properties: they are able to translocate a variety of structurally different organic cations in both directions across the plasma membrane; to translocate organic cations independently from sodium, chloride or proton gradients; and to function as electrogenic uniporters for cations or as electroneutral cation exchangers. They show overlapping but distinct substrate and inhibitor specificities, and different tissue expression pattern. In humans, OCT1 is strongly expressed in the liver, OCT2 is highly expressed in the kidney where it is localized at the basolateral membrane of renal proximal tubules, and OCT3 is most strongly expressed in skeletal muscle. OCTs are broad-specificity transporters that play a critical role in the excretion and distribution of endogeneous organic cations and for the uptake, elimination and distribution of cationic drugs, toxins, and environmental waste products. The SLC22A1-3 subfamily belongs to the Solute carrier 22 (SLC22) family of organic cation/anion/zwitterion transporters of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340937 [Multi-domain]  Cd Length: 340  Bit Score: 56.21  E-value: 2.94e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 141 CLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASFASLSSFVQGYGAFLFCRLISGIGIGGSLPIVF 220
Cdd:cd17379   29 CEDAWKLDLFQSSLNLGFLIGSIVIGYLADRFGRKVCFLISILGNGVSGVLMAFSPNYPWFLIFRFLQGLFGKGGWMTGY 108
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|...
gi 157909825 221 AYFSEFLSREKRGEHLSWLGIFWMTGGIYASAMAWsIIPHYGW 263
Cdd:cd17379  109 VLVTEFVGSKYRRTVGIVYQMFFTLGLLILPGIAY-FIPHWRW 150
MFS cd06174
Major Facilitator Superfamily; The Major Facilitator Superfamily (MFS) is a large and diverse ...
528-678 3.94e-08

Major Facilitator Superfamily; The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of substrates including ions, sugar phosphates, drugs, neurotransmitters, nucleosides, amino acids, and peptides. They do so using the electrochemical potential of the transported substrates. Uniporters transport a single substrate, while symporters and antiporters transport two substrates in the same or in opposite directions, respectively, across membranes. MFS proteins are typically 400 to 600 amino acids in length, and the majority contain 12 transmembrane alpha helices (TMs) connected by hydrophilic loops. The N- and C-terminal halves of these proteins display weak similarity and may be the result of a gene duplication/fusion event. Based on kinetic studies and the structures of a few bacterial superfamily members, GlpT (glycerol-3-phosphate transporter), LacY (lactose permease), and EmrD (multidrug transporter), MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement. Bacterial members function primarily for nutrient uptake, and as drug-efflux pumps to confer antibiotic resistance. Some MFS proteins have medical significance in humans such as the glucose transporter Glut4, which is impaired in type II diabetes, and glucose-6-phosphate transporter (G6PT), which causes glycogen storage disease when mutated.


Pssm-ID: 349949 [Multi-domain]  Cd Length: 378  Bit Score: 55.90  E-value: 3.94e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 528 MDFEEDNDFLIYLVSFLGSLSVLPGNIISALLMDRIGRLKMIGGSMLISAVCCFFLFFGNSESAMIGWQCLFCGTSIAAW 607
Cdd:cd06174   23 LQSFGLSASQLGLLFALFSLGYALLQPLAGLLADRFGRRPVLLLGLLLFALGALLFAFAPSFWLLLLGRFLLGLGSGLID 102
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 157909825 608 NALDVITVELYPTNQRATAFGILNGLCKFGAILGNTI---FASFVGITKVVPILLAAASLVGGGLIALRLPETR 678
Cdd:cd06174  103 PAVLALIADLFPERERGRALGLLQAFGSVGGILGPLLggiLASSLGFGWRAVFLIAAALALLAAILLLLVVPDP 176
MFS_MMR_MDR_like cd17504
Methylenomycin A resistance protein (also called MMR peptide)-like multidrug resistance (MDR) ...
115-297 5.58e-08

Methylenomycin A resistance protein (also called MMR peptide)-like multidrug resistance (MDR) transporters of the Major Facilitator Superfamily; This subfamily is composed of putative multidrug resistance (MDR) transporters including Chlamydia trachomatis antiseptic resistance protein QacA_2, and Serratia sp. DD3 Bmr3. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. This subfamily belongs to the Methylenomycin A resistance protein (also called MMR peptide) and similar multidrug resistance (MDR) transporters (MMR-like MDR transporter) family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 341047 [Multi-domain]  Cd Length: 371  Bit Score: 55.28  E-value: 5.58e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 115 LGLALMADGVEIFVVSFALPSAEKDMCLSSSKKGMLgLIVYLgmMAGAF---ILGGLADKLGRKKVLSMSLAINASFASL 191
Cdd:cd17504    1 LALAALAVMLVETMLSPALPTIQREFGTSAAAVSWV-LTAYL--LVGAVstpILGRLGDLYGRKKVLLIVLAIYTAGSLL 77
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 192 SSFVQGYGAFLFCRLISGIGiGGSLPIVFAYFSEFLSREKRGEHLSWL-GIFWMTGGIYASAMAWsIIPHYGWgfsmgtn 270
Cdd:cd17504   78 AAFAPNLPVLIAGRALQGIG-GAVFPLAFALVREEFPPERVPVAQGILsATFGIGAGIGLPLGGW-IVQHLGW------- 148
                        170       180
                 ....*....|....*....|....*..
gi 157909825 271 yHFHSWRVFVIVCALPATVSMVALKFM 297
Cdd:cd17504  149 -RWIFWTAAPVAVLLAALVPLIDLRLL 174
MFS_GLUT_Class2 cd17432
Class 2 Glucose transporters (GLUTs) of the Major Facilitator Superfamily; GLUTs, also called ...
156-313 5.67e-08

Class 2 Glucose transporters (GLUTs) of the Major Facilitator Superfamily; GLUTs, also called Solute carrier family 2, facilitated glucose transporters (SLC2A), are a family of proteins that facilitate the transport of hexoses such as glucose and fructose. There are fourteen GLUTs found in humans; they display different substrate specificities and tissue expression. They have been categorized into three classes based on sequence similarity: Class 1 (GLUTs 1-4, 14); Class 2 (GLUTs 5, 7, 9, and 11); and Class 3 (GLUTs 6, 8, 10, 12, and HMIT). GLUT5, also called Solute carrier family 2, facilitated glucose transporter member 5 (SLC2A5), is a well-established fructose transporter found in the small intestine. GLUT7 (or SLC2A7) is a high-affinity glucose and fructose transporter expressed in the small intestine and colon. GLUT9 (or SLC2A9) transports urate and fructose, and is most strongly expressed in the basolateral membranes of proximal renal tubular cells, liver and placenta. It may play a role in urate reabsorption by proximal tubules. GLUT11 (or SLC2A11) is a facilitative glucose transporter expressed in heart and skeletal muscle. GLUT proteins are comprised of about 500 amino acid residues, possess a single N-linked oligosaccharide, and have 12 transmembrane segments. They belong to the Glucose transporter -like (GLUT-like) family of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340990 [Multi-domain]  Cd Length: 452  Bit Score: 55.70  E-value: 5.67e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 156 LGMMAGAFILGGLADKLGRKKVLSMSLAINASFASLSSFVQGYGAF---LFCRLISGIGIGGSLPIVFAYFSEFLSREKR 232
Cdd:cd17432   61 LGGLFGSLLVGPLVIRLGRKGTLLLNNIFAIVAAILMGLSKIAKSFemiIVGRFLVGINAGISLNVVPMYLGESAPKNLR 140
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 233 GEHLSWLGIFWMTGGIYASAMAWSIIphygwgfsMGTNYHfhsWRVFVIVCALPATVSMVALKFMPESPRFLLeMGKHDE 312
Cdd:cd17432  141 GAVGLVPAIFITLGILLGQVLGLREL--------LGNEEG---WPLLLALTGVPALLQLLTLPFFPESPRYLL-IEKGDE 208

                 .
gi 157909825 313 A 313
Cdd:cd17432  209 E 209
MFS_1 pfam07690
Major Facilitator Superfamily;
109-251 6.63e-08

Major Facilitator Superfamily;


Pssm-ID: 369468 [Multi-domain]  Cd Length: 346  Bit Score: 55.12  E-value: 6.63e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825  109 WTLFFVLGLALMAdgveifvVSFALPSAEKDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASF 188
Cdd:pfam07690 208 LLALLLFGFAFFG-------LLTYLPLYQEVLGLSALLAGLLLGLAGLLGAIGRLLLGRLSDRLGRRRRLLLALLLLILA 280
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 157909825  189 A---SLSSFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGIYAS 251
Cdd:pfam07690 281 AlglLLLSLTLSSLWLLLALLLLGFGFGLVFPALNALVSDLAPKEERGTASGLYNTAGSLGGALGP 346
MFS_KgtP cd17367
Alpha-ketoglutarate permease of the Major Facilitator Superfamily of transporters; This ...
161-303 7.15e-08

Alpha-ketoglutarate permease of the Major Facilitator Superfamily of transporters; This subfamily includes Escherichia coli alpha-ketoglutarate permease (KgtP) and similar proteins. KgtP is a constitutively expressed proton symporter that functions in the uptake of alpha-ketoglutarate across the boundary membrane. Also included is a putative transporter from Pseudomonas aeruginosa named dicarboxylic acid transporter PcaT. The KgtP subfamily belongs to the Metazoan Synaptic Vesicle Glycoprotein 2 (SV2) and related small molecule transporter family (SV2-like) of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340925 [Multi-domain]  Cd Length: 407  Bit Score: 54.99  E-value: 7.15e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 161 GAFILGGLADKLGRKKVLSMSLainaSFASLSSFV---------QGYGAF---LFCRLISGIGIGGSLPIVFAYFSEFLS 228
Cdd:cd17367   56 GGWLFGRLADRIGRRAALTLSV----SLMAAGSLViavtptyatIGIWAPiilLLARLLQGLSVGGEYGTSATYLSEVAP 131
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 229 REKRGEHLSWLGIFWMTGGIYASAMAwSIIPH-------YGWGfsmgtnyhfhsWRVFVIVCALPATVSMVALKFMPESP 301
Cdd:cd17367  132 PGRRGFYSSFQYVTLIGGQLLALGVL-LVLQHtlgedqmAAWG-----------WRIPFLLGGVLAVVVLWLRRGLEETE 199

                 ..
gi 157909825 302 RF 303
Cdd:cd17367  200 SF 201
MFS_arabinose_efflux_permease_like cd17473
Putative arabinose efflux permease family transporters of the Major Facilitator Superfamily; ...
156-248 7.25e-08

Putative arabinose efflux permease family transporters of the Major Facilitator Superfamily; This family includes a group of putative arabinose efflux permease family transporters, such as alpha proteobacterium quinolone resistance protein NorA (characterized Staphylococcus aureus Quinolone resistance protein NorA belongs to a different group), Desulfovibrio dechloracetivorans bacillibactin exporter, Vibrio aerogenes antiseptic resistance protein. The biological function of those transporters remain unclear. They belong to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 341026 [Multi-domain]  Cd Length: 374  Bit Score: 54.89  E-value: 7.25e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 156 LGMMAGAFILGGLADKLGRKKVLSMSLAINASFASLSSFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGEH 235
Cdd:cd17473   46 LFIALFAPLAGWLADRFGRKRLLIAGLLLYGIGGVAGLFLDSLYALLASRALLGIGVAGIMTLATALIGDYFEGEERAKM 125
                         90
                 ....*....|...
gi 157909825 236 LSWLGIFWMTGGI 248
Cdd:cd17473  126 LGLQSAAMSLGGV 138
MFS_MT3072_like cd17475
Mycobacterium tuberculosis uncharacterized MFS-type transporter MT3072 and similar ...
129-320 9.33e-08

Mycobacterium tuberculosis uncharacterized MFS-type transporter MT3072 and similar transporters of the Major Facilitator Superfamily; This family includes the Mycobacterium tuberculosis uncharacterized MFS-type transporter MT3072. It belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 341028 [Multi-domain]  Cd Length: 378  Bit Score: 54.55  E-value: 9.33e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 129 VSFALPSAEKDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASFASLSSFVQGYGAFLFCRLIS 208
Cdd:cd17475   15 IPALAPFLQEDLHLSLAQVGLLLSALNLGVAVSMLPAGWLLDRFGERRVLAVGLLLMGAAALLMALVGSYPVLLVLLFLV 94
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 209 GIGIGGSLP----IVFAYFSEflsrEKRGehlswlgiFWMT--------GGIYASAMAWSIIPHYGWGFSMgtnyhfhsw 276
Cdd:cd17475   95 GAGYGSVQPgggrAIMRWFPP----RERG--------LAMGirqtgvplGGALAAALLPPLALHYGWRAAF--------- 153
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|....
gi 157909825 277 RVFVIVCALPATVSMValkFMPESPRFLLEMGKHDEAWMILKQV 320
Cdd:cd17475  154 VVAGLVSILAAVLFWL---FYREPPAASAATESASTLLRSLKEV 194
MFS_OAT cd17374
Organic anion transporters of the Major Facilitator Superfamily of transporters; Organic anion ...
538-675 2.31e-07

Organic anion transporters of the Major Facilitator Superfamily of transporters; Organic anion transporters (OATs) generally display broad substrate specificity and they facilitate the exchange of extracellular with intracellular organic anions (OAs). Several OATs have been characterized including OAT1-10 and urate anion exchanger 1 (URAT1, also called SLC22A12). Many OATs occur in renal proximal tubules, the site of active drug secretion. OATs mediate the absorption, distribution, and excretion of a diverse array of environmental toxins, and clinically important drugs, including anti-HIV therapeutics, anti-tumor drugs, antibiotics, anti-hypertensives, and anti-inflammatories, and therefore is critical for the survival of the mammalian species. OAT falls into the SLC22 (solute carrier 22) family of the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340932 [Multi-domain]  Cd Length: 341  Bit Score: 53.06  E-value: 2.31e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 538 IYLVSFLGSLSVLPGNIISALLMDRIGRLKMIGGSMLISAVCCFFLFFGNSES-------AMIGwqclfCGTSIAAWNAL 610
Cdd:cd17374  203 VFLLQFLFGAVEVPARCLALFLLNHMGRRISQAVLLLLAGLCILANIFVPQEMqtlrtvlAVLG-----KGSSAAAFTIS 277
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 157909825 611 DVITVELYPTNQRATAFGILNGLCKFGAILGNTIFASFVgITKVVPILLAAASLVGGGLIALRLP 675
Cdd:cd17374  278 YVYTAELFPTVLRQTGMGLNSMFARIGGILAPLIMLLGV-YSPLLPMIIYGVLPILAGLLALLLP 341
MFS_YfcJ_like cd17489
Escherichia coli YfcJ, YhhS, and similar transporters of the Major Facilitator Superfamily; ...
133-320 2.68e-07

Escherichia coli YfcJ, YhhS, and similar transporters of the Major Facilitator Superfamily; This subfamily is composed of Escherichia coli membrane proteins, YfcJ and YhhS, Bacillus subtilis uncharacterized MFS-type transporter YwoG, and similar proteins. YfcJ and YhhS are putative arabinose efflux transporters. YhhS has been implicated glyphosate resistance. YfcJ-like arabinose efflux transporters belong to the bacterial MdtG-like and eukaryotic solute carrier 18 (SLC18) family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 341042 [Multi-domain]  Cd Length: 367  Bit Score: 52.98  E-value: 2.68e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 133 LPSAEKDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASFASLSSFVQGYGAFLFCRLISGIGI 212
Cdd:cd17489   19 LPLYAHDLGGSEAVAGLVVGLFTLAALLARPFAGRLLDRFGRKRLLLIGLLIFALATLLYLLATSVALLLVLRLIHGIGW 98
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 213 GGSLPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGIYASAMAWSIIPHYGWGFSMgtnyhfhswrVFVIVCALPATVSMV 292
Cdd:cd17489   99 GAFTTAAATLVADIIPPSRRGEGIGYYGLATTLAMALGPALGLFLYQHLGFAVLF----------IVAAVLALLALLLVF 168
                        170       180
                 ....*....|....*....|....*...
gi 157909825 293 ALKFMPESPRFLLEMGKHDEAWMILKQV 320
Cdd:cd17489  169 LVKDPPPVAAEEAEAGTRAFRRLVEKKV 196
MFS_OFA_like cd17353
Oxalate:formate antiporter (OFA) and similar proteins of the Major Facilitator Superfamily of ...
109-294 2.82e-07

Oxalate:formate antiporter (OFA) and similar proteins of the Major Facilitator Superfamily of transporters; This subfamily is composed of Oxalobacter formigenes oxalate:formate antiporter (OFA or OxlT) and similar proteins. O. formigenes, a commensal found in the gut of animals and humans, plays an important role in clearing dietary oxalate from the intestinal tract, which is carried out by OFA/OxlT, an anion transporter that facilitates the exchange of divalent oxalate with monovalent formate, the product of oxalate decarboxylation. This exchange generates an electrochemical proton gradient and is the source of energy for ATP synthesis in this cell. The OFA-like subfamily belongs to the Monocarboxylate transporter -like (MCT-like) family of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340911 [Multi-domain]  Cd Length: 389  Bit Score: 53.38  E-value: 2.82e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 109 WTLFFVLGLALMAdGVEIFVVSfalpsaeKDMCLSSSKKGMLGLIVYLGMMA-----GAFILGGLADKLGRKKVLSMSLA 183
Cdd:cd17353  216 WLLWLMFFLNATA-GLMLIGQA-------KPIGQEFAGLDAGIAALAVSILSifnggGRPFWGWLSDKIGRKNTLSIAFL 287
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 184 INA-SFASLSSFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGIYASAMAWSIipHYG 262
Cdd:cd17353  288 IQGvAMFLLPFIGSVAVLFVLGVALIGFCYGGGFALFPALTADFFGTKNAGTNYGLLYTAKGVGGLIGPIIAAYV--LYT 365
                        170       180       190
                 ....*....|....*....|....*....|..
gi 157909825 263 WGFSMgtnyhfhswrVFVIVCALPATVSMVAL 294
Cdd:cd17353  366 GGYNA----------AFIIAAALSLVALALAL 387
xylE PRK10077
D-xylose transporter XylE; Provisional
144-323 2.99e-07

D-xylose transporter XylE; Provisional


Pssm-ID: 182225 [Multi-domain]  Cd Length: 479  Bit Score: 53.54  E-value: 2.99e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 144 SSKKGMLGLIV---YLGMMAGAFILGGLADKLGRKK------VLSMSLAINASFASLSSFVQGYG------AFLFCRLIS 208
Cdd:PRK10077  51 SAANSLLGFCVasaLIGCIIGGALGGYCSNRFGRRDslkiaaVLFFISALGSAWPEFGFTSIGPDntgyvpEFVIYRIIG 130
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 209 GIGIGGSLPIVFAYFSEFLSREKRGEHLSW---------LGIFWMTGGIyASAMAWSIIPHYGWgfsmgtNYHFHSWrvf 279
Cdd:PRK10077 131 GIGVGLASMLSPMYIAEIAPAHIRGKLVSFnqfaiifgqLVVYFVNYFI-ARSGDASWLNTDGW------RYMFASE--- 200
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|....
gi 157909825 280 vivcALPATVSMVALKFMPESPRFLLEMGKHDEAWMILKQVHDT 323
Cdd:PRK10077 201 ----AIPALLFLMLLYFVPETPRYLMSRGKQEQAEGILRKIMGN 240
MFS_MJ1317_like cd17370
MJ1317 and similar transporters of the Major Facilitator Superfamily; This family is composed ...
150-294 3.42e-07

MJ1317 and similar transporters of the Major Facilitator Superfamily; This family is composed of Methanocaldococcus jannaschii MFS-type transporter MJ1317, Mycobacterium bovis protein Mb2288, and similar proteins. They are uncharacterized transporters belonging to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340928 [Multi-domain]  Cd Length: 371  Bit Score: 52.93  E-value: 3.42e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 150 LGLIVYLGMMA----GAFILGGLADKLGRKKVL----SMSLAINASFASLSSFVQGYGAFLFcrliSGIGIGGSLPIVFA 221
Cdd:cd17370  235 LIPLLYALFNLvyalAAYPAGRLSDRIGRKKLLilgyLSLALAYLGFALGSSLWLLLLGFIL----WGLYMGAQESIERA 310
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 157909825 222 YFSEFLSREKRGehlSWLGIFWMTGGIyaSAMAWSIIphygwgfsMGTNYHFHSWRVFVIVCALPATVSMVAL 294
Cdd:cd17370  311 AVADLVPAELRG---TAYGLFNTVVGI--GWLLASLI--------AGYLWDLISPSAAFLFSAVLALIALLLL 370
MFS_PcaK_like cd17365
4-hydroxybenzoate transporter PcaK and similar transporters of the Major Facilitator ...
107-294 6.97e-07

4-hydroxybenzoate transporter PcaK and similar transporters of the Major Facilitator Superfamily; This aromatic acid:H(+) symporter subfamily includes Acinetobacter sp. 4-hydroxybenzoate transporter PcaK, Pseudomonas putida gallate transporter (GalT), Corynebacterium glutamicum gentisate transporter (GenK), Nocardioides sp. 1-hydroxy-2-naphthoate transporter (PhdT), Escherichia coli 3-(3-hydroxy-phenyl)propionate (3HPP) transporter (MhpT), and similar proteins. These transporters are involved in the uptake across the cytoplasmic membrane of specific aromatic compounds such as 4-hydroxybenzoate, gallate, gentisate (2,5-dihydroxybenzoate), 1-hydroxy-2-naphthoate, and 3HPP, respectively. The PcaK-like aromatic acid:H(+) symporter subfamily belongs to the Metazoan Synaptic Vesicle Glycoprotein 2 (SV2) and related small molecule transporter family (SV2-like) of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340923 [Multi-domain]  Cd Length: 351  Bit Score: 51.82  E-value: 6.97e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 107 FQWTLFFVLG-------LALMADGVEIFVVSFA-----------LPSAEKDMCLSSSKKGMLGLIVYLGMMAGAFILGGL 168
Cdd:cd17365  150 FGWRSVFLLGgvpplilLPLLRGTLLLWVTFFMglllvyllnswLPKLMVEAGYSLSQALTITLLLNIGGVIGSLLLGWL 229
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 169 ADKLGRKKVLSMSLAINASF-ASLSSFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGEHLSWLGIFWMTGG 247
Cdd:cd17365  230 ADRFGPKRVLALFFALGAVSlALLGVSPASLVLLYVLVFLAGACVNGAQVGLYALAARFYPTEVRATGVGWALGVGRLGA 309
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|....*..
gi 157909825 248 IYASAMAWSIIphyGWGFSMGTNYhfhswrvfvIVCALPATVSMVAL 294
Cdd:cd17365  310 ILGPLLGGLLL---AAGLGPESVF---------LALAIPAALGALAV 344
MFS_GLUT12_Class3 cd17435
Glucose transporter type 12 (GLUT12), a Class 3 GLUT, of the Major Facilitator Superfamily of ...
123-305 1.26e-06

Glucose transporter type 12 (GLUT12), a Class 3 GLUT, of the Major Facilitator Superfamily of transporters; Glucose transporter type 12 (GLUT12) is also called Solute carrier family 2, facilitated glucose transporter member 12 (SLC2A12). It is a facilitative glucose transporter, classified as a Class 3 GLUT, and is expressed in the heart, skeletal muscle, prostate, and small intestine, and is highly upregulated in breast ductal cell carcinoma. It plays a role as a secondary insulin-sensitive glucose transporter in insulin-dependent tissues. The GLUT12 subfamily belongs to the Glucose transporter -like (GLUT-like) family of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340993 [Multi-domain]  Cd Length: 376  Bit Score: 50.95  E-value: 1.26e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 123 GVEIFVVSFALPSAEKDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKK--VLSMSLAINASFasLSSFVQGYGA 200
Cdd:cd17435   14 GYELGIISGALLQLRTLLALSCHEQEMVVSSLLIGALLASLTGGVLIDRYGRRTaiILTSCLLVLGSL--LLVCSVSYTV 91
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 201 FLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGI--YASAMAWSIIPHyGWGFSMGtnyhfhswrv 278
Cdd:cd17435   92 LIVGRIAIGVSISLSSIATCVYIAEIAPQHRRGLLVSLNELMIVIGILlaYISNYAFANVSN-GWKYMFG---------- 160
                        170       180
                 ....*....|....*....|....*..
gi 157909825 279 FVIvcaLPATVSMVALKFMPESPRFLL 305
Cdd:cd17435  161 LVI---PLAALQAIAMYFLPPSPRFLV 184
MFS_OAT cd17374
Organic anion transporters of the Major Facilitator Superfamily of transporters; Organic anion ...
141-298 2.71e-06

Organic anion transporters of the Major Facilitator Superfamily of transporters; Organic anion transporters (OATs) generally display broad substrate specificity and they facilitate the exchange of extracellular with intracellular organic anions (OAs). Several OATs have been characterized including OAT1-10 and urate anion exchanger 1 (URAT1, also called SLC22A12). Many OATs occur in renal proximal tubules, the site of active drug secretion. OATs mediate the absorption, distribution, and excretion of a diverse array of environmental toxins, and clinically important drugs, including anti-HIV therapeutics, anti-tumor drugs, antibiotics, anti-hypertensives, and anti-inflammatories, and therefore is critical for the survival of the mammalian species. OAT falls into the SLC22 (solute carrier 22) family of the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340932 [Multi-domain]  Cd Length: 341  Bit Score: 49.98  E-value: 2.71e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 141 CLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASFASLSSFVQGYGAFLFCRLISGIGIGGSLPIVF 220
Cdd:cd17374   31 CESQSLKSVAQSIFMAGLLVGALIFGHLSDRFGRKFILLLSLLQLAIFGTCAAFAPTFPVYCVLRFLAGFAVSGISINTL 110
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 157909825 221 AYFSEflsrekrgehlsWLGIFWMTGGIYASAMAWSIiphyGWGFSMGTNYHFHSWRVFVIVCALPATVSMVALKFMP 298
Cdd:cd17374  111 ILGTE------------WTTPRHRALAITLTSCFFSI----GQMLLAGLAYAIRDWRLLQLVVSVPFFLFFLYSWWLP 172
MFS_Azr1_MDR_like cd17502
Saccharomyces cerevisiae Azole resistance protein 1 (Azr1p), and similar multidrug resistance ...
115-248 2.94e-06

Saccharomyces cerevisiae Azole resistance protein 1 (Azr1p), and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily; This subfamily is composed of multidrug resistance (MDR) transporters including various Saccharomyces cerevisiae proteins such as azole resistance protein 1 (Azr1p), vacuolar basic amino acid transporter 1 (Vba1p), vacuolar basic amino acid transporter 5 (Vba5p), and Sge1p (also known as Nor1p, 10-N-nonyl acridine orange resistance protein, and crystal violet resistance protein). MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. This subfamily belongs to the Methylenomycin A resistance protein (also called MMR peptide) and similar multidrug resistance (MDR) transporters (MMR-like MDR transporter) family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 341045 [Multi-domain]  Cd Length: 337  Bit Score: 49.87  E-value: 2.94e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 115 LGLALMAdgVEIFVVSFALPSAEKDMClSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASFASLSSF 194
Cdd:cd17502    3 LALFLAA--LDQTIVATALPTIVAEFG-GLSLVSWVGTAYLLTSTAFQPIYGKLSDLFGRKWVLLIAIVIFELGSLLCGL 79
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....
gi 157909825 195 VQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGI 248
Cdd:cd17502   80 APNMTMLIVGRAIQGIGGGGLMSLAFIIIADLVPPRERGKYQGYIGAVFGIASV 133
MFS_MefA_like cd06173
Macrolide efflux protein A and similar proteins of the Major Facilitator Superfamily of ...
109-296 3.05e-06

Macrolide efflux protein A and similar proteins of the Major Facilitator Superfamily of transporters; This family is composed of Streptococcus pyogenes macrolide efflux protein A (MefA) and similar transporters, many of which remain uncharacterized. Some members may be multidrug resistance (MDR) transporters, which are drug/H+ antiporters (DHAs) that mediate the efflux of a variety of drugs and toxic compounds, conferring resistance to these compounds. MefA confers resistance to 14-membered macrolides including erythromycin and to 15-membered macrolides. It functions as an efflux pump to regulate intracellular macrolide levels. The MefA-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340863 [Multi-domain]  Cd Length: 383  Bit Score: 49.92  E-value: 3.05e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 109 WTLFFVLGLALMADGVEIFVVSFAlpsaEKDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASF 188
Cdd:cd06173  212 LLLLALALFALLGGALTVLLPLLA----KEVLGGGAAGYGLLLAAFGVGALLGALLLGRLSKRRRRGRLLLIGALLLGLA 287
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 189 ASLSSFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGIYASAMAWSIIPHYGWGfsmg 268
Cdd:cd06173  288 LLVLGLSPSLWLLLAALFLLGLAGGLFNVPLNTLLQLRVPDELRGRVFSVYNALNSGAMPLGALLAGLLADALGLS---- 363
                        170       180
                 ....*....|....*....|....*...
gi 157909825 269 tnyhfhswRVFVIVCALPATVSMVALKF 296
Cdd:cd06173  364 --------AVFLLAGALLLLAALLLLLL 383
MFS_FsR cd17478
Fosmidomycin resistance protein of the Major Facilitator Superfamily of transporters; ...
148-302 3.77e-06

Fosmidomycin resistance protein of the Major Facilitator Superfamily of transporters; Fosmidomycin resistance protein (FsR) confers resistance against fosmidomycin. It shows sequence similarity with the bacterial drug-export proteins that mediate resistance to tetracycline and chloramphenicol. This FsR family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 341031 [Multi-domain]  Cd Length: 365  Bit Score: 49.48  E-value: 3.77e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 148 GMLGLIVYLGMMAGAF---ILGGLADKLGRKKVLSMSLAINASFASLSSFVQGYGAFLFCRLISGIGIGGSLPIVFAYFS 224
Cdd:cd17478   31 AQAGLLVSVFSITSSLlqpLFGYLADRKPRRYLLPLGPLLTGLGLSLLGFAPNYWLLLLLVALAGIGSAAFHPEGARLAS 110
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 157909825 225 EfLSREKRGehlSWLGIFwMTGGIYASAMAWSIIphyGWGFSMGTNYHfhswrvFVIVCALPATVSMVALKFMPESPR 302
Cdd:cd17478  111 Q-AAGGRRG---LAMSIF-SVGGNLGFALGPLIA---AALVALFGGLG------LLILLIIPGLAVALLLLRLRPLKK 174
MFS_FucP_MFSD4_like cd17333
Bacterial fucose permease, eukaryotic Major facilitator superfamily domain-containing protein ...
109-248 4.13e-06

Bacterial fucose permease, eukaryotic Major facilitator superfamily domain-containing protein 4, and similar proteins; This family is composed of bacterial L-fucose permease (FucP), eukaryotic Major facilitator superfamily domain-containing protein 4 (MFSD4) proteins, and similar proteins. L-fucose permease facilitates the uptake of L-fucose across the boundary membrane with the concomitant transport of protons into the cell; it can also transport L-galactose and D-arabinose. The MFSD4 subfamily consists of two vertebrate members: MFSD4A and MFSD4B. The function of MFSD4A is unknown. MFSD4B is more commonly know as Sodium-dependent glucose transporter 1 (NaGLT1), a primary fructose transporter in rat renal brush-border membranes that also facilitates sodium-independent urea uptake. The FucP/MFSD4 family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340891 [Multi-domain]  Cd Length: 372  Bit Score: 49.63  E-value: 4.13e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 109 WTLFFVLGLALMADGVEIfvvsfalPSAEKDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASF 188
Cdd:cd17333    2 YISFFSNGLTDALLGILG-------PSLEEAFNLNVADVSVIFSSQNAGYLIGSLLAGFLMKRLGRRRTLILGLLLISLA 74
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 189 ASLSSFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEfLSREKRGEHLSWLGIFWMTGGI 248
Cdd:cd17333   75 LALIFATPSIYLFVVLMFLAGLGAGILDTGANTFVGA-LFEESSATRLNVLHGFFGLGAL 133
MFS_MJ1317_like cd17370
MJ1317 and similar transporters of the Major Facilitator Superfamily; This family is composed ...
533-645 4.53e-06

MJ1317 and similar transporters of the Major Facilitator Superfamily; This family is composed of Methanocaldococcus jannaschii MFS-type transporter MJ1317, Mycobacterium bovis protein Mb2288, and similar proteins. They are uncharacterized transporters belonging to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340928 [Multi-domain]  Cd Length: 371  Bit Score: 49.46  E-value: 4.53e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 533 DNDFLIYLVSFLG-SLSVLPG-----NIISAL-------LMDRIGRLKMIGGSMLISAVCCF-FLFFGNSESAMIGwqCL 598
Cdd:cd17370  218 SFAFLILRAQELGlSAALIPLlyalfNLVYALaaypagrLSDRIGRKKLLILGYLSLALAYLgFALGSSLWLLLLG--FI 295
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*...
gi 157909825 599 FCGTSIAAWNAL-DVITVELYPTNQRATAFGILNGLCKFGAILGNTIF 645
Cdd:cd17370  296 LWGLYMGAQESIeRAAVADLVPAELRGTAYGLFNTVVGIGWLLASLIA 343
PRK12307 PRK12307
MFS transporter;
106-263 4.93e-06

MFS transporter;


Pssm-ID: 237051 [Multi-domain]  Cd Length: 426  Bit Score: 49.54  E-value: 4.93e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 106 RFQWTLFFVLGLALMADGVEIFVVSFALPSAEKDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAIN 185
Cdd:PRK12307  14 RPQKNALFSAWLGYVFDGFDFMLIFYIMYLIKADLGLTDMEGAFLATAAFIGRPFGGALFGLLADKFGRKPLMMWSIVAY 93
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 157909825 186 ASFASLSSFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGIYASAMAWSIIPHYGW 263
Cdd:PRK12307  94 SVGTGLSGLASGVIMLTLSRFIVGMGMAGEYACASTYAVESWPKHLKSKASAFLVSGFGIGNIIAAYFMPSFAEAYGW 171
MFS_SLC22A15 cd17377
Solute carrier family 22 member 15 of the Major Facilitator Superfamily of transporters; ...
144-298 4.95e-06

Solute carrier family 22 member 15 of the Major Facilitator Superfamily of transporters; Solute carrier family 22 member 15 (SLC22A15) is also called fly-like putative transporter 1 (FLIPT1). It is expressed at the highest levels in the kidney and brain. It is a member of the SLC22 family of transporters, which includes organic cation transporters (OCTs), organic zwitterion/cation transporters (OCTNs), and organic anion transporters (OATs). SLC22 transporters interact with a variety of compounds that include drugs of abuse, environmental toxins, opioid analgesics, antidepressant and anxiolytic agents, and neurotransmitters and their metabolites. SLC22A15 belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340935 [Multi-domain]  Cd Length: 353  Bit Score: 49.01  E-value: 4.95e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 144 SSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASFASLSSFVQGYGAFLFCRLISGIGIGGSLPIVFAYF 223
Cdd:cd17377   38 AYKVSLASSFFFAGVLIGVVSFGQLSDRFGRKPVYLTGLALDILFAYFNALAPSYEFFAVSRFLVGVMNGGMSLVAFVLL 117
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 157909825 224 SEFLSREkrgehlswlgiFW-MTGGIYASAMAWSIIPHYGWGfsmgtnYHFHSWRVFVIVCALPATVSMVALKFMP 298
Cdd:cd17377  118 NECVGKS-----------YWaLAGSLGGLFFAVGIAQYALLG------YFIRSWRTLAVVVNLQGTLVFLLSLFIP 176
MFS_MdtG_SLC18_like cd17325
bacterial MdtG-like and eukaryotic solute carrier 18 (SLC18) family of the Major Facilitator ...
537-674 6.36e-06

bacterial MdtG-like and eukaryotic solute carrier 18 (SLC18) family of the Major Facilitator Superfamily of transporters; This family is composed of eukaryotic solute carrier 18 (SLC18) family transporters and related bacterial multidrug resistance (MDR) transporters including several proteins from Escherichia coli such as multidrug resistance protein MdtG, from Bacillus subtilis such as multidrug resistance proteins 1 (Bmr1) and 2 (Bmr2), and from Staphylococcus aureus such as quinolone resistance protein NorA. The family also includes Escherichia coli arabinose efflux transporters YfcJ and YhhS. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. The SLC18 transporter family includes vesicular monoamine transporters (VAT1 and VAT2), vesicular acetylcholine transporter (VAChT), and SLC18B1, which is proposed to be a vesicular polyamine transporter (VPAT). The MdtG/SLC18 family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340883 [Multi-domain]  Cd Length: 375  Bit Score: 48.73  E-value: 6.36e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 537 LIYLVSFLGSLSVLPgniISALLMDRIGRLKMIGGSMLISAVCCFFLFFGNSESAMIGWQCLFCGTSIAAWNALDVITVE 616
Cdd:cd17325  239 LLFGAQGLASALSQP---PAGKLSDRIGRKPLILIGLLLSAVALLLLPLATSFWLLLLLLALLGLGLGLVFPATLALLAD 315
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 157909825 617 LYPTNQRATAFGILNGLCKFGAILGNTI---FASFVGITkvVPILLAAASLVGGGLIALRL 674
Cdd:cd17325  316 IVPPEGRGTAMGLFNTAFSLGMVLGPLLggfLYDAFGFA--TPFLAAAALLLLAAVLFLLL 374
PRK10473 PRK10473
MdtL family multidrug efflux MFS transporter;
154-241 7.90e-06

MdtL family multidrug efflux MFS transporter;


Pssm-ID: 182486 [Multi-domain]  Cd Length: 392  Bit Score: 48.48  E-value: 7.90e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 154 VYLGMMAGAFILGG-LADKLGRKKVLSMSLAINASFASLSSFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKR 232
Cdd:PRK10473  46 VYLAGMAAAMLFAGkIADRSGRKPVAIPGAALFIIASLLCSLAETSSLFLAGRFLQGIGAGCCYVVAFAILRDTLDDRRR 125
                         90
                 ....*....|
gi 157909825 233 GEHLSWL-GI 241
Cdd:PRK10473 126 AKVLSLLnGI 135
BtlA COG2270
MFS-type transporter involved in bile tolerance, Atg22 family [General function prediction ...
111-302 8.63e-06

MFS-type transporter involved in bile tolerance, Atg22 family [General function prediction only];


Pssm-ID: 225179 [Multi-domain]  Cd Length: 438  Bit Score: 48.46  E-value: 8.63e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 111 LFFVLGLALMADGVEIfVVSFALPSAEKDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASFAS 190
Cdd:COG2270  255 VLFLIARFFYIDGVNT-ILAMGGVFGAADLGLSSTELLLIGIALSVVAALGAIIAGFLDERFGSKPVLMIGLVILSIAAL 333
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 191 LSSFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGIYASAMaWSIIphygwgfsmgTN 270
Cdd:COG2270  334 YLIFLEGELDFWILGLLVGTSLGGAQASSRSYLARLVPKGKEGRFFGLYALTGRAASFLGPFL-VAVI----------TQ 402
                        170       180       190
                 ....*....|....*....|....*....|..
gi 157909825 271 YhFHSWRVFVIVCALPATVSMVALKFMPESPR 302
Cdd:COG2270  403 I-TGSSRAGVLSIIVLLLIGLLLLLRVKVPGR 433
MFS_NepI_like cd17324
Purine ribonucleoside efflux pump NepI and similar transporters of the Major Facilitator ...
541-680 1.14e-05

Purine ribonucleoside efflux pump NepI and similar transporters of the Major Facilitator Superfamily; This family is composed of purine efflux pumps such as Escherichia coli NepI and Bacillus subtilis PbuE, sugar efflux transporters such as Corynebacterium glutamicum arabinose efflux permease, multidrug resistance (MDR) transporters such as Streptomyces lividans chloramphenicol resistance protein (CmlR), and similar proteins. NepI and PbuE are involved in the efflux of purine ribonucleosides such as guanosine, adenosine and inosine, as well as purine bases like guanine, adenine, and hypoxanthine, and purine base analogs. They play a role in the maintenance of cellular purine base pools, as well as in protecting the cells and conferring resistance against toxic purine base analogs such as 6-mercaptopurine. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. The NepI-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340882 [Multi-domain]  Cd Length: 370  Bit Score: 47.93  E-value: 1.14e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 541 VSFLGSLSVLP---GNIISALLMDRIGRLKMIGGSMLISAVCCFFLFFGNSESAMIGWQCLFCGTSIAAWNALDVITVEL 617
Cdd:cd17324   36 AGLLVSAYALGyalGALLLGPLSDRIERRRLLLVLLLLFILGNLLAALAPSFALLLLARALAGLAHGGFWAIAAAYAADL 115
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 157909825 618 YPTNQRATAFGILNGLCKFGAILGN---TIFASFVGItKVVPILLAAASLVGGGLIALRLPETREQ 680
Cdd:cd17324  116 VPPEKRGRAIGLVFSGLTLGLVLGRplgGLLGQLLGW-RAAFLAIAVLALLAALLLWRLLPSLPPK 180
MFS_SLC22A7_OAT2 cd17447
Solute carrier family 22 member 7 (also called Organic anion transporter 2) of the Major ...
538-675 1.20e-05

Solute carrier family 22 member 7 (also called Organic anion transporter 2) of the Major Facilitator Superfamily of transporters; Solute carrier family 22 member 7 (SLC22A7), also called organic anion transporter 2 (OAT2) mediates sodium-independent transport of a variety of organic anions including prostaglandin E2, prostaglandin F2, tetracycline, bumetanide, estrone sulfate, glutarate, dehydroepiandrosterone sulfate, allopurinol, 5-fluorouracil, paclitaxel, L-ascorbic acid, salicylate, ethotrexate, and alpha-ketoglutarate. It also plays a role in renal uric acid uptake from blood as a first step of tubular secretion. OAT2 belongs to the Solute carrier 22 (SLC22) family of organic cation/anion/zwitterion transporters of the Major Facilitator Superfamily (MFS)of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 341005 [Multi-domain]  Cd Length: 341  Bit Score: 47.80  E-value: 1.20e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 538 IYLVSFLGSLSVLPGNIISALLMDRIGRLKMIGGSMLISAVCCFFLFFGNSESAMI--GWQCLFCGTSIAAWNALDVITV 615
Cdd:cd17447  203 VYLTQFIYGAIELPAKLLAYLLLDRIGRRLTQAGSLILTGLSIGINILIPSEFTVVrtVIAVLGKGFSEAAFTTVFLYTS 282
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 616 ELYPTNQRATAFGILNGLCKFGAILGNTIFAsFVGITKVVPILLAAASLVGGGLIALRLP 675
Cdd:cd17447  283 ELYPTVLRQNGMGYTSFIARLGGSLAPLVIL-LDDVWLSLPQVIFCGVALLAGGVAFLLP 341
MFS_YcaD_like cd17477
YcaD and similar transporters of the Major Facilitator Superfamily; This family is composed of ...
111-301 1.27e-05

YcaD and similar transporters of the Major Facilitator Superfamily; This family is composed of Escherichia coli MFS-type transporter YcaD, Bacillus subtilis MFS-type transporter YfkF, and similar proteins. They are uncharacterized transporters belonging to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 341030 [Multi-domain]  Cd Length: 360  Bit Score: 47.94  E-value: 1.27e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 111 LFFVLGLALMADGVEIFVVSFALpsaeKDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASFAS 190
Cdd:cd17477    1 LLLSVALLGLGSGLLLPLLSLRL----EREGVSTALIGLVASAYYLGILLGSPLVPRLIRRVGHIRAFAAGAAITAVSVL 76
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 191 LSSFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGEHLSWLGIFwMTGGIYASAMAWSIIPHYGwgfsmgtn 270
Cdd:cd17477   77 LLALTDSPWVWFLLRFVMGIGLAGLFVVSESWLNALATNENRGRVLGLYSTV-LGLGFALGPLLLALVGTAG-------- 147
                        170       180       190
                 ....*....|....*....|....*....|.
gi 157909825 271 yhfhsWRVFVIVCALPAtVSMVALKFMPESP 301
Cdd:cd17477  148 -----ALPFLIAAVLLL-LALVPLLLTRRAA 172
MFS_FEN2_like cd17327
Pantothenate transporter FEN2 and similar transporters of the Major Facilitator Superfamily; ...
153-342 1.29e-05

Pantothenate transporter FEN2 and similar transporters of the Major Facilitator Superfamily; This family is composed of Saccharomyces cerevisiae pantothenate transporter FEN2 (or fenpropimorph resistance protein 2) and similar proteins from fungi and bacteria including fungal vitamin H transporter, allantoate permease, and high-affinity nicotinic acid transporter, as well as Pseudomonas putida phthalate transporter and nicotinate degradation protein T (nicT). These proteins are involved in the uptake into the cell of specific substrates such as pathothenate, biotin, allantoate, and nicotinic acid, among others. The FEN2-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340885 [Multi-domain]  Cd Length: 406  Bit Score: 48.01  E-value: 1.29e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 153 IVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASFASLSSFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKR 232
Cdd:cd17327   49 VFYVGYIIFELPGNLLLQRFPPSKWLSVFIVLWGLLTLLTAAVKNFGGLIALRFFLGLFESGVFPGFILYLGMWYKREEQ 128
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 233 GEHLSWLGIFWMTGGIYASAMAWSIiphygwgFSMGTNYHFHSWR-VFVIVCALPATVSMVALKFMPESP---RFLLEMG 308
Cdd:cd17327  129 AKRIAFFYAAAGLGSIFGGLLAYGV-------FKILGVGGLAGWRwLFIIEGLITIIIGLVIFFWLPDNPskaWFLTEEE 201
                        170       180       190
                 ....*....|....*....|....*....|....
gi 157909825 309 KHdeawMILKQVHDtnmRAKGTPEKVFTVSHIKT 342
Cdd:cd17327  202 KE----LAVERLRA---NQTGKGDQKFKWKQIKE 228
MFS_SLC22A16_CT2 cd17375
Solute carrier family 22 member 16 (also called Carnitine transporter 2) of the Major ...
539-675 1.30e-05

Solute carrier family 22 member 16 (also called Carnitine transporter 2) of the Major Facilitator Superfamily of transporters; Solute carrier family 22 member 16 (SLC22A16) is also called carnitine transporter 2 (CT2), fly-like putative transporter 2 (FLIPT2), organic cation transporter OKB1, or organic cation/carnitine transporter 6 (OCT6). It is a partially sodium-ion dependent high affinity carnitine transporter. It also transports organic cations such as tetraethylammonium (TEA) and doxorubicin. It is one of several organic cation transporters (OCTs) that falls into the SLC22 (solute carrier 22) family. OCTs are broad-specificity transporters that play a critical role in the excretion and distribution of endogeneous organic cations and for the uptake, elimination and distribution of cationic drugs, toxins, and environmental waste products. SLC22A16 belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340933 [Multi-domain]  Cd Length: 341  Bit Score: 47.82  E-value: 1.30e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 539 YLVSFLGSLSVLPGNIISALLMDRIGRLKMIGGSMLISAVCCFFLFFGNSESAMIGWQCLFCGTSI--AAWNALDVITVE 616
Cdd:cd17375  204 YLNLFLVGAVEIPSYIIACIGMDKLGRRNTLAPFLLLSALACMLIMVIPQDYEVLTIVLSMTGKFAiaIAFGLIYLYTAE 283
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 157909825 617 LYPTNQRATAFGILNGLCKFGailgnTIFASF-VGITKV---VPILLAAASLVGGGLIALRLP 675
Cdd:cd17375  284 LYPTIVRSLAVGSGSMMCRVG-----SVVAPFcVYLSDVwifLPQLLVGIMAFLSGILTLMLP 341
MFS_Tpo1_MDR_like cd17323
Yeast Polyamine transporter 1 (Tpo1) and similar multidrug resistance (MDR) transporters of ...
150-233 1.75e-05

Yeast Polyamine transporter 1 (Tpo1) and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily; This family is composed of fungal multidrug resistance (MDR) transporters including several proteins from Saccharomyces cerevisiae such as polyamine transporters 1-4 (Tpo1-4), quinidine resistance proteins 1-3 (Qdr1-3), dityrosine transporter 1 (Dtr1), fluconazole resistance protein 1 (Flr1), and protein HOL1. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. For example, Flr1 confers resistance to the azole derivative fluconazole while Tpo1 confers resistance and adaptation to quinidine and ketoconazole. The polyamine transporters are involved in the detoxification of excess polyamines in the cytoplasm. Tpo1-like MDR transporters belong to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340881 [Multi-domain]  Cd Length: 376  Bit Score: 47.57  E-value: 1.75e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 150 LGLIVY-LGMMAGAFILGGLADKLGRKKVLSMSLAINASFASLSSFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLS 228
Cdd:cd17323   38 LGVSLFvLGFGLGPLIWAPLSELYGRRPVYLVSLFIFVIFQIGCALAPNIAMLIILRFLQGFFGSSPLAIGAGTIADLFT 117

                 ....*
gi 157909825 229 REKRG 233
Cdd:cd17323  118 PEERG 122
MFS_OPA_SLC37 cd17312
Organophosphate:Pi antiporter/Solute Carrier family 37 of the Major Facilitator Superfamily of ...
130-308 1.89e-05

Organophosphate:Pi antiporter/Solute Carrier family 37 of the Major Facilitator Superfamily of transporters; Organophosphate:Pi antiporters (OPA) are integral membrane proteins responsible for the transport of specific organophosphates or sugar phosphates across biological membranes with the simultaneous translocation of inorganic phosphate into the opposite direction. The OPA family is also called solute carrier family 37 (SLC37) in vertebrates. Members include glucose-6-phosphate (Glc6P) transporter (also called translocase or exchanger), glycerol-3-phosphate permease, 2-phosphonopropionate transporter, phosphoglycerate transporter, as well as membrane sensor protein UhpC from Escherichia coli. UhpC is both a sensor and a transport protein; it recognizes external Glc6P and induces transport by UhpT, and it can also transport Glc6P. Vertebrates contain four SLC37 or sugar-phosphate exchange (SPX) proteins: SLC37A1 (SPX1), SLC37A2 (SPX2), SLC37A3 (SPX3), and SLC37AA4 (SPX4). The OPA/SLC37 family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340870 [Multi-domain]  Cd Length: 364  Bit Score: 47.27  E-value: 1.89e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 130 SFALPSAEKDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASFASLSSFVQGYGAFLFCRLISG 209
Cdd:cd17312   23 SVAKPPIVEEIGLSKDDLGIIGSAFLIAYAVGKFISGFLSDRSNIRRFMSAGLLLSALANIFMGFSTSLWFFAVLWGLNG 102
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 210 IGIGGSLPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGIYASAMAWSIIPHYGWGFsmgtnyhfhswrVFVIVCALPATV 289
Cdd:cd17312  103 LFQSMGWPPCVKLLGNWFSKKERGTVYGIWSTSHNFGGILAPILAASLASYYGWRA------------AFLVPGIVGLVV 170
                        170
                 ....*....|....*....
gi 157909825 290 SMVALKFMPESPRFLLEMG 308
Cdd:cd17312  171 AIILFFFLRDSPPYVWVLS 189
UhpC COG2271
Sugar phosphate permease [Carbohydrate transport and metabolism];
106-263 1.97e-05

Sugar phosphate permease [Carbohydrate transport and metabolism];


Pssm-ID: 225180 [Multi-domain]  Cd Length: 448  Bit Score: 47.65  E-value: 1.97e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 106 RFQWTLFFV--LGLALMADGVEIFvvSFALPSAEKDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLA 183
Cdd:COG2271   25 RWRIQIFLSifIGYAAFYLTRKNF--NLAMPALIEDGGLSKTQLGILGSAFSITYGVSKFVMGVLSDRSNPRYFMAFGLI 102
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 184 INASFASLSSFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGehlSWLGIfWMT----GGIYASAMA--WSI 257
Cdd:COG2271  103 LSAIVNILFGFSPSLFLFAVLWVLNGWFQGMGWPPCARTITHWFSRKERG---TWWSI-WNTshniGGALAPLVAllAFF 178

                 ....*.
gi 157909825 258 IPHYGW 263
Cdd:COG2271  179 AFHGGW 184
MFS_NRT2_like cd17341
Plant Nitrate transporter NRT2 family and Bacterial Nitrate/Nitrite transporters of the Major ...
127-309 1.98e-05

Plant Nitrate transporter NRT2 family and Bacterial Nitrate/Nitrite transporters of the Major Facilitator Superfamily; This family is composed of plant NRT2 family high-affinity nitrate transporters as well as nitrate and nitrite transporters from bacteria including Bacillus subtilis nitrate transporter NasA and nitrite extrusion protein NarK, Staphylococcus aureus NarT, Synechococcus sp. nitrate permease NapA, Mycobacterium tuberculosis NarK2 and nitrite extrusion protein NarU. NRT2 family proteins are involved in the uptake of nitrate by plant roots from the soil through the high-affinity transport system (HATS). There are seven Arabidopsis thaliana NRT2 proteins, called AtNRT2:1 to AtNRT2:7. The NRT2-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340899 [Multi-domain]  Cd Length: 384  Bit Score: 47.25  E-value: 1.98e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 127 FVVSFALPSAE----KDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASFA-SLSSFVQGYGAF 201
Cdd:cd17341   12 FMVWFLFAPLGpvirDDLGLSTSQIGLLVAIPVLAGALLRLPYGFLCDRFGGRRVFIASLLLLLIPLlALALAVSSYWGL 91
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 202 LFCRLISGIGiGGSLPIVFAYFSEFLSREKRGehLSWLGIFWMtGGIYASAMAWSIIPHYGWGFSMGTNYhfhSWR-VFV 280
Cdd:cd17341   92 LVLGFLLGFA-GANFASGQPWASFWFPKEKIG--GAAGGIAGA-GNMGVAVSQLLAPLIAGAIVFDGGFV---GWRnAFF 164
                        170       180       190
                 ....*....|....*....|....*....|..
gi 157909825 281 IVCALPATVSMVALKFM---PESPRFLLEMGK 309
Cdd:cd17341  165 VPGILLAIAAVLVLLFGddlPTGKASALEFLK 196
MFS_GLUT6_Class3 cd17434
Glucose transporter type 6, a Class 3 GLUT, of the Major Facilitator Superfamily of ...
130-334 2.12e-05

Glucose transporter type 6, a Class 3 GLUT, of the Major Facilitator Superfamily of transporters; Glucose transporter type 6 (GLUT6) is also called Solute carrier family 2, facilitated glucose transporter member 6 (SLC2A6). It is classified as a Class 3 GLUT protein, and is a facilitative glucose transporter that binds cytochalasin B with low affinity. It is found in the brain, spleen, and leucocytes. GLUT6 may function in oxalate secretion. SLC2A6 has been identified as an oxalate nephrolithiasis gene in mice; its deletion causes spontaneous calcium oxalate nephrolithiasis in the setting of hyperoxalaemia, hyperoxaluria, and nephrocalcinosis. GLUT proteins are comprised of about 500 amino acid residues, possess a single N-linked oligosaccharide, and have 12 transmembrane segments. They belong to the Glucose transporter -like (GLUT-like) family of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340992 [Multi-domain]  Cd Length: 417  Bit Score: 47.52  E-value: 2.12e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 130 SFALPSAEKD----MCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASFASLSSFVQGYGAFLFCR 205
Cdd:cd17434   22 SPVIPALEQGddprLHLNVHQISWFGSVFTLGAAAGGLSAMFLNDRLGRKLSIMFSAVPSALGYLLMGSAQGIWMLLLGR 101
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 206 LISGIGIG---GSLPIvfaYFSEFLSREKRGEHLSWLGIFWMTGGIYASAMAWsIIPhygwgfsmgtnyhfhsWRVFVIV 282
Cdd:cd17434  102 FLTGFAGGitaASIPV---YVSEISHPGVRGALGACPQIMAVFGSLALYALGL-LLP----------------WRWLAVA 161
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|..
gi 157909825 283 CALPATVSMVALKFMPESPRFLLEMGKHDEAWMILKQVHDTNMRAKGTPEKV 334
Cdd:cd17434  162 GEVPVVIMILLLCFMPNSPRFLISKGKDEKALKALAWLRGPNTDYMTEFEQI 213
MFS_SLC22A4_5_OCTN1_2 cd17376
Solute carrier family 22 members 4 and 5 (also called Organic cation/carnitine transporters 1 ...
153-298 2.42e-05

Solute carrier family 22 members 4 and 5 (also called Organic cation/carnitine transporters 1 and 2) of the Major Facilitator Superfamily of transporters; This subfamily is composed of solute carrier family 22 members 4 (SLC22A4) and 5 (SLC22A5), and similar proteins. SLC22A4 is also called ergothioneine transporter (ETT) or organic cation/carnitine transporter 1 (OCTN1). It is a sodium-ion dependent, low affinity carnitine transporter, and a highly specific transporter for the uptake of ergothioneine (ET), a thiolated derivative of histidine with antioxidant properties. ET is a natural compound produced only by certain fungi and bacteria and must be absorbed from the diet by humans and other vetebrates. SLC22A5, also called organic cation/carnitine transporter 2 (OCTN2), is a sodium-ion dependent, high affinity carnitine transporter involved in the active cellular uptake of carnitine. SLC22A4/5 belongs to the Solute carrier 22 (SLC22) family of organic cation/anion/zwitterion transporters of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340934 [Multi-domain]  Cd Length: 342  Bit Score: 47.08  E-value: 2.42e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 153 IVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASFASLSSFVQGYgaFLFCRLISGIGIGGSLPIVFAYF--SEFLSRE 230
Cdd:cd17376   43 LFFVGVLLGSFISGQLSDRFGRKKVLFATMAVQTGFSFLQIFSPSW--EMFTVLFVIVGMGQISNYVVAFVlgTEILGKS 120
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 157909825 231 KRgehlswlGIFWMTGGIYASAMAWSIIPHYGwgfsmgtnYHFHSWRVFVIVCALPATVSMVALKFMP 298
Cdd:cd17376  121 VR-------ILFSTLGVCIFYAIGYMLLPLFA--------YFIRDWRMLLLALTLPGVLCVPLWWFIP 173
BtlA COG2270
MFS-type transporter involved in bile tolerance, Atg22 family [General function prediction ...
538-679 3.46e-05

MFS-type transporter involved in bile tolerance, Atg22 family [General function prediction only];


Pssm-ID: 225179 [Multi-domain]  Cd Length: 438  Bit Score: 46.53  E-value: 3.46e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 538 IYLVSFLGSLSVLPGNIISALLMDRIGRLKMIGGSMLISAVCCFFLFFGNSESAMIGWQCLFCGTSIAAWNALDVITVEL 617
Cdd:COG2270  290 LLLIGIALSVVAALGAIIAGFLDERFGSKPVLMIGLVILSIAALYLIFLEGELDFWILGLLVGTSLGGAQASSRSYLARL 369
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 157909825 618 YPTNQRATAFGILNGLCKFGAILGNTIFASFVGITKVV--PILLAAASLVGGGLIALRLPETRE 679
Cdd:COG2270  370 VPKGKEGRFFGLYALTGRAASFLGPFLVAVITQITGSSraGVLSIIVLLLIGLLLLLRVKVPGR 433
MFS_MCT_SLC16 cd17352
Monocarboxylate transporter (MCT) family of the Major Facilitator Superfamily of transporters; ...
539-675 3.53e-05

Monocarboxylate transporter (MCT) family of the Major Facilitator Superfamily of transporters; The animal Monocarboxylate transporter (MCT) family is also called Solute carrier family 16 (SLC16 or SLC16A). It is composed of 14 members, MCT1-14. MCTs play an integral role in cellular metabolism via lactate transport and have been implicated in metabolic synergy in tumors. MCT1-4 are proton-coupled transporters that facilitate the transport across the plasma membrane of monocarboxylates such as lactate, pyruvate, branched-chain oxo acids derived from leucine, valine and isoleucine, and ketone bodies such as acetoacetate, beta-hydroxybutyrate and acetate. MCT8 and MCT10 are transporters which stimulate the cellular uptake of thyroid hormones such as thyroxine (T4), triiodothyronine (T3), reverse triiodothyronine (rT3) and diidothyronine (T2). MCT10 also functions as a sodium-independent transporter that mediates the uptake or efflux of aromatic acids. Many members are orphan transporters whose substrates are yet to be determined. The MCT family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340910 [Multi-domain]  Cd Length: 361  Bit Score: 46.39  E-value: 3.53e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 539 YLVSFLGSLSvLPGNIISALLMDR--IGRLKMIGGSMLISAVCCFFLFFGNSESAMIGWqCLFCGTSIAAWNAL-DVITV 615
Cdd:cd17352  222 FLLSIIGISD-IVGRILLGLLADKprIGRLYLYIFTLLILGLSLLAFPLATTYVGLIVF-SVLFGFCSGSYSSLtPVILA 299
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 157909825 616 ELYPTNQRATAFGILNGLCKFGAILGNTIFASFVGITKV--VPILLAAASLVGGGLIALRLP 675
Cdd:cd17352  300 DLVGLEKLSNAYGLVLLFQGLAALVGPPIAGLLRDYTGDydAAFYFCGACLLLSGVLLFLLP 361
2_A_01_02 TIGR00880
Multidrug resistance protein;
538-677 5.03e-05

Multidrug resistance protein;


Pssm-ID: 273318 [Multi-domain]  Cd Length: 141  Bit Score: 43.79  E-value: 5.03e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825  538 IYLVSFlgSLSVLPGNIISALLMDRIGRLKMIGGSMLISAVCCFFLFFGNSESAMIG---WQCLFCGTSIAAWNALdviT 614
Cdd:TIGR00880   2 LLLAGY--ALGQLIYSPLSGLLTDRFGRKPVLLVGLFIFVLSTAMFALSSNITVLIIarfLQGFGAAFALVAGAAL---I 76
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 157909825  615 VELYPTNQRATAFGILNGLCKFGAILGnTIFASFVG--ITKVVPIL-LAAASLVGGGLIALRLPET 677
Cdd:TIGR00880  77 ADIYPPEERGVALGLMSAGIALGPLLG-PPLGGVLAqfLGWRAPFLfLAILALAAFILLAFLLPET 141
MFS_ExuT_GudP_like cd17319
Hexuronate transporter, Glucarate transporter, and similar transporters of the Major ...
540-675 6.22e-05

Hexuronate transporter, Glucarate transporter, and similar transporters of the Major Facilitator Superfamily; This family is composed of predominantly bacterial transporters for hexuronate (ExuT), glucarate (GudP), galactarate (GarP), and galactonate (DgoT). They mediate the uptake of these compounds into the cell. They belong to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340877 [Multi-domain]  Cd Length: 358  Bit Score: 45.64  E-value: 6.22e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 540 LVSFLGSLSVLPGNIISALLMDRIGRLKMIGGSMLISAVCCFFLFFGNSESAMIGWQCLFCGTSIAAWNALDVITVELYP 619
Cdd:cd17319   42 LIASAFFLGYALFQVPGGWLLDRFGARKVLAVSMLLWSLFTALTGFATSLTSLYVLRFLLGVAEAGFFPGAIKALAEWFP 121
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 157909825 620 TNQRATAFGILNglckFGAILGNTIFASFVGI------TKVVPILLAAASLVGGGLIALRLP 675
Cdd:cd17319  122 ARERGRATGLFN----SGAPLGAAIGPPLSGWllllfgWRWAFIIEGLLGLLLAVLWWFYLR 179
PRK03893 PRK03893
putative sialic acid transporter; Provisional
108-263 6.80e-05

putative sialic acid transporter; Provisional


Pssm-ID: 179668 [Multi-domain]  Cd Length: 496  Bit Score: 45.84  E-value: 6.80e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 108 QWTLFFVLGLALMADGVEIFVVSFALPSAEKDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKkvLSMSLAINA- 186
Cdd:PRK03893  18 QWKAFSAAWLGYLLDGFDFVLITLVLTEVQGEFGLTTVQAASLISAAFISRWFGGLLLGAMGDRYGRR--LAMVISIVLf 95
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 157909825 187 SFASLS-SFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGIYASAMAWSIIPHYGW 263
Cdd:PRK03893  96 SVGTLAcGFAPGYWTLFIARLVIGMGMAGEYGSSATYVIESWPKHLRNKASGFLISGFSIGAVVAAQVYSLVVPVWGW 173
MFS_arabinose_efflux_permease_like cd17473
Putative arabinose efflux permease family transporters of the Major Facilitator Superfamily; ...
83-298 8.32e-05

Putative arabinose efflux permease family transporters of the Major Facilitator Superfamily; This family includes a group of putative arabinose efflux permease family transporters, such as alpha proteobacterium quinolone resistance protein NorA (characterized Staphylococcus aureus Quinolone resistance protein NorA belongs to a different group), Desulfovibrio dechloracetivorans bacillibactin exporter, Vibrio aerogenes antiseptic resistance protein. The biological function of those transporters remain unclear. They belong to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 341026 [Multi-domain]  Cd Length: 374  Bit Score: 45.26  E-value: 8.32e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825  83 ERMEDEEELAHQYETIIDECGHGRFqWTLFFVLGLALMAdgveIFVVSFALPSAEKDMCL-SSSKKGMLGLIVYLGMMAG 161
Cdd:cd17473  175 EPARKSKSAASPGAATAAALPWKRV-LPIYFLAFLAMLL----FYVIPIQLPFLLQERGGgSAALIGLALAIASLAGAIG 249
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 162 AFILGGLADKLGRKKVLSMSLAINA-SFASLSsFVQGYGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGEHLSWLG 240
Cdd:cd17473  250 ALLFGRLKRRLGKRRLLAIGFALMAlGFLLLA-LASGLWVVLLGAILAGLGFGLLLPTLNSWAMSLVPPELRGRAMGIVT 328
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|....*...
gi 157909825 241 IFwMTGGIYASAMAWSIIPHYGWGFSmgtnyhfhswRVFVIVCALpATVSMVALKFMP 298
Cdd:cd17473  329 SA-FFLGQFLSPLVLGPLVNLTGGLS----------GAFLILGVL-ALVLAIVLLLLR 374
MFS_MdtH_MDR_like cd17329
Multidrug resistance protein MdtH and similar multidrug resistance (MDR) transporters of the ...
540-678 1.07e-04

Multidrug resistance protein MdtH and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily; This family is composed of Escherichia coli MdtH and similar multidrug resistance (MDR) transporters from bacteria and archaea, many of which remain uncharacterized. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. MdtH confers resistance to norfloxacin and enoxacin. MdtH-like MDR transporters belong to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340887 [Multi-domain]  Cd Length: 376  Bit Score: 44.91  E-value: 1.07e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 540 LVSFLGSLSVLPGNIISALLMDRIGRLKMIGGSMLISAVCCFFLFFGNSESAMIGWqclFCGTSIAA---WNALDVITVE 616
Cdd:cd17329   39 LVLALSAVAGIVASLIGGRLADRFGRKPVMLAGLLLRALGFALLGFAHSPWLFAIA---LVLTGFGGglfEPASEAMIAD 115
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 157909825 617 LYPTNQRATAFGILNGLCKFGAILGNTIFASFVGITKVVPILLAAASLVGGGLIALR-LPETR 678
Cdd:cd17329  116 VTTPENRTRAFSLLYWAINLGVAIGPLLGGLLLLYSFRLLFLAAAVLFLLAALVLLFlLPETR 178
MFS_ProP cd17366
Proline/betaine transporter of the Major Facilitator Superfamily of transporters; This ...
161-263 1.81e-04

Proline/betaine transporter of the Major Facilitator Superfamily of transporters; This subfamily is composed of Escherichia coli proline/betaine transporter, also called proline porter II (PPII), and similar proteins. ProP is a proton symporter that senses osmotic shifts and responds by importing osmolytes such as proline, glycine betaine, stachydrine, pipecolic acid, ectoine and taurine. It is both an osmosensor and an osmoregulator which is available to participate early in the bacterial osmoregulatory response. The ProP subfamily belongs to the Metazoan Synaptic Vesicle Glycoprotein 2 (SV2) and related small molecule transporter family (SV2-like) of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340924 [Multi-domain]  Cd Length: 377  Bit Score: 44.27  E-value: 1.81e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 161 GAFILGGLADKLGRKKVLSMSLAINASFASLSSFVQGYGA--------FLFCRLISGIGIGGSLPIVFAYFSEFLSREKR 232
Cdd:cd17366   56 GGLVFGPLGDKYGRQKVLAITIILMAASTFCIGLLPTYATigvwapilLLLARMVQGFSTGGEYGGAATFVAEYAPDRKR 135
                         90       100       110
                 ....*....|....*....|....*....|....*....
gi 157909825 233 GEHLSWLGIFWMTGGIYAS----AMAWSIIP----HYGW 263
Cdd:cd17366  136 GFLGSWLEFGTLAGFILGAglvtLLTLLLTEaqmlDWGW 174
MFS_CitA cd17368
Citrate-proton symporter of the Major Facilitator Superfamily of transporters; Citrate-proton ...
161-238 2.42e-04

Citrate-proton symporter of the Major Facilitator Superfamily of transporters; Citrate-proton symporter, also called citrate carrier protein or citrate transporter or citrate utilization protein A (CitA), is a proton symporter that functions in the uptake of citrate across the boundary membrane. It allows the utilization of citrate as a sole source of carbon and energy. In Klebsiella pneumoniae, the gene encoding this protein is called citH, instead of citA, which is the case for Escherichia coli and other organisms. CitA belongs to the Metazoan Synaptic Vesicle Glycoprotein 2 (SV2) and related small molecule transporter family (SV2-like) of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340926 [Multi-domain]  Cd Length: 407  Bit Score: 43.90  E-value: 2.42e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 161 GAFILGGLADKLGRKKVLSMSLAINASFASLSSFVQGYGA--------FLFCRLISGIGIGGSLPIVFAYFSEFLSREKR 232
Cdd:cd17368   56 GAIVLGAYADRIGRKPAMTLTLAIMALGTLLIALAPTYATigiaapllVLLARLLQGFAAGGEVGGVTAYLVEAAPPGRR 135

                 ....*.
gi 157909825 233 GEHLSW 238
Cdd:cd17368  136 GFYTSW 141
MFS_SLC46_TetA_like cd17330
Eukaryotic Solute carrier 46 (SLC46) family, Bacterial Tetracycline resistance proteins, and ...
538-675 2.73e-04

Eukaryotic Solute carrier 46 (SLC46) family, Bacterial Tetracycline resistance proteins, and similar proteins of the Major Facilitator Superfamily of transporters; This family is composed of the eukaryotic proteins MFSD9, MFSD10, MFSD14, and SLC46 family proteins, as well as bacterial multidrug resistance (MDR) transporters such as tetracycline resistance protein TetA and multidrug resistance protein MdtG. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. TetA proteins confer resistance to tetracycline while MdtG confers resistance to fosfomycin and deoxycholate. The Solute carrier 46 (SLC46) family is composed of three vertebrate members (SLC46A1, SLC46A2, and SLC46A3), the best-studied of which is SLC46A1, which functions both as an intestinal proton-coupled high-affinity folate transporter involved in the absorption of folates and as an intestinal heme transporter which mediates heme uptake. MFSD10 facilitates the uptake of organic anions such as some non-steroidal anti-inflammatory drugs (NSAIDs) and confers resistance to such NSAIDs. The SLC46/TetA-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340888 [Multi-domain]  Cd Length: 349  Bit Score: 43.72  E-value: 2.73e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 538 IYLVSFLGS---LSVLPGNIISALLMDRIGRLKMIGGSMLISAVCCFFLFFGNSESAMIGWQCL---FCGTSIAAWNALD 611
Cdd:cd17330   33 GYYVGLLQSsysLGQFLASPLWGRLSDRYGRKPVLLLSLAGSAVSYVLLGLSRNLWLLFLARFLdglTGGNVSVAQAYIA 112
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 157909825 612 VITVElyptNQRATAFGILNGLCKFGAILGNTI---FASFVGITkvVPILLAAASLVGGGLIALRLP 675
Cdd:cd17330  113 DITDE----EERAKAFGIISAAFGLGFILGPALggfLSTPYGYA--LPFLVAAALALLNLVLVLFFL 173
MFS_SLC22A6_OAT1_like cd17446
Solute carrier family 22 member 6 (also called Organic anion transporter 1) and similar ...
141-263 3.53e-04

Solute carrier family 22 member 6 (also called Organic anion transporter 1) and similar transporters of the Major Facilitator Superfamily; This subfamily includes solute carrier family 22 member 6 (SLC22A6, also called organic anion transporter 1 or OAT1 or para-aminohippurate (PAH) transporter), SLC22A8 (or OAT3), and SLC22A20 (or OAT6). OAT1 and OAT3 are involved in the renal elimination of endogenous and exogenous organic anions (OAs). They function as OA exchangers, coupling the uptake of OAs against an electrochemical gradient with the efflux of intracellular dicarboxylates. SLC22A20 is an OA transporter that mediates the uptake of estrone sulfate. The OAT1-like subfamily belongs to the Solute carrier 22 (SLC22) family of organic cation/anion/zwitterion transporters of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 341004 [Multi-domain]  Cd Length: 339  Bit Score: 43.17  E-value: 3.53e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 141 CLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASFASLSSFVQGYGAFLFCRLISGIGIGGSLPIVF 220
Cdd:cd17446   29 CNHRALRQLAQSIYMAGVLVGAIVFGGLSDRFGRRPLLIWSYLQMAVSGTCAAFSPSFPIYCVFRFLTGMALSGIVLNSV 108
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|...
gi 157909825 221 AYFSEFLSREKRGEHLSWLGIFWMTGGIYASAMAWsIIPHYGW 263
Cdd:cd17446  109 SLNVEWMPTRVRAVVGTLLGYCYTLGQLILAGVAY-AIRDWRW 150
MFS_MucK cd17371
Cis,cis-muconate transport protein and similar proteins of the Major Facilitator Superfamily; ...
107-269 3.71e-04

Cis,cis-muconate transport protein and similar proteins of the Major Facilitator Superfamily; This subfamily is composed of Acinetobacter sp. Cis,cis-muconate transport protein (MucK), Escherichia coli putative sialic acid transporter 1, and similar proteins. MucK functions in the uptake of muconate and allows Acinetobacter calcoaceticus ADP1 (BD413) to grow on exogenous cis,cis-muconate as the sole carbon source. The MucK subfamily belongs to the Metazoan Synaptic Vesicle Glycoprotein 2 (SV2) and related small molecule transporter family (SV2-like) of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.


Pssm-ID: 340929 [Multi-domain]  Cd Length: 389  Bit Score: 43.44  E-value: 3.71e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 107 FQWTLF------FVLGLALMADGVEI--FVVSFALPS---AEKDMclssSKKGMLGLIV--YLGMMAGAFILGGLADKLG 173
Cdd:cd17371  198 SLRELFsppllrTTLLASLLATGALGgyYGITTWLPSyltGERGL----SFEGSAGYLVvtILGGFLGYLAGGFLADRIG 273
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825 174 RKKVLSMSLAinASFASLSSFVQG---YGAFLFCRLISGIGIGGSLPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGIYA 250
Cdd:cd17371  274 RRNNFALFAL--GSAISILLYFFLplsPTLILILGFPLGFFASGPFSGMGAYLTELFPTAVRATAQGFCYNVGRIIGALF 351
                        170
                 ....*....|....*....
gi 157909825 251 SAMAWSIIPHYGWGFSMGT 269
Cdd:cd17371  352 PFLVGFLATSGSLGTAIAV 370
2A0104 TIGR00881
phosphoglycerate transporter family protein; [Transport and binding proteins, Carbohydrates, ...
130-302 4.08e-04

phosphoglycerate transporter family protein; [Transport and binding proteins, Carbohydrates, organic alcohols, and acids]


Pssm-ID: 273319 [Multi-domain]  Cd Length: 379  Bit Score: 43.13  E-value: 4.08e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825  130 SFALPSAEKDMCLSSSKKGMLGLIVYLGMMAGAFILGGLADKLGRKKVLSMSLAINASFASLSSFVQGYGAFLFCRLISG 209
Cdd:TIGR00881  15 ALAMPYLVEEIGLSKTDLGLLLSSFSIAYGISKFVMGSVSDRSNPRVFLPIGLILCAIVNLFFGFSTSLWVMAALWALNG 94
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157909825  210 IGIGGSLPIVFAYFSEFLSREKRGehlSWLGiFWMTGGIYASAMAWSIiphygwgFSMGTNYHFhSWRVFVIVCALPA-T 288
Cdd:TIGR00881  95 IFQGMGWPPCGRTVTKWFSRSERG---TWVS-FWNCSHNVGGGLLPPL-------VLFGIAELY-SWHWVFIVPGIIAiI 162
                         170
                  ....*....|....
gi 157909825  289 VSMVALKFMPESPR 302
Cdd:TIGR00881 163 VS