NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|189217853|ref|NP_001121363|]
View 

72 kDa type IV collagenase isoform 2 [Homo sapiens]

Protein Classification

ZnMc_MMP and HX domain-containing protein (domain architecture ID 12021233)

protein containing domains PG_binding_1, ZnMc_MMP, FN2, and HX

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
HX cd00094
Hemopexin-like repeats.; Hemopexin is a heme-binding protein that transports heme to the liver. ...
416-610 2.84e-76

Hemopexin-like repeats.; Hemopexin is a heme-binding protein that transports heme to the liver. Hemopexin-like repeats occur in vitronectin and some matrix metalloproteinases family (matrixins). The HX repeats of some matrixins bind tissue inhibitor of metalloproteinases (TIMPs). This CD contains 4 instances of the repeat.


:

Pssm-ID: 238046 [Multi-domain]  Cd Length: 194  Bit Score: 240.68  E-value: 2.84e-76
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189217853 416 PEICKQdIVFDGIAQIRGEIFFFKDRFIWRtVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWIYSA 495
Cdd:cd00094    1 PDACDP-LSFDAVTTLRGELYFFKGRYFWR-LSPGKPPGSPFLISSFWPSLPSPVDAAFERPDTGKIYFFKGDKYWVYTG 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189217853 496 STLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDPGFPKLIADAWNAIPDNLDAVVDLQg 575
Cdd:cd00094   79 KNLEPGYPKPISDLGFPPTVKQIDAALRWPDNGKTYFFKGDKYWRYDEKTQKMDPGYPKLIETDFPGVPDKVDAAFRWL- 157
                        170       180       190
                 ....*....|....*....|....*....|....*..
gi 189217853 576 GGHSYFFKGAYYLKLENQSLKS--VKFGSIKSDWLGC 610
Cdd:cd00094  158 DGYYYFFKGDQYWRFDPRSKEVrvGYPLKISSDWLGC 194
Peptidase_M10 pfam00413
Matrixin; The members of this family are enzymes that cleave peptides. These proteases require ...
68-396 1.40e-68

Matrixin; The members of this family are enzymes that cleave peptides. These proteases require zinc for catalysis.


:

Pssm-ID: 334067  Cd Length: 159  Bit Score: 219.41  E-value: 1.40e-68
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189217853   68 KWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAP 147
Cdd:pfam00413   1 KWRKKNLTYRILNYTPDLPRAEVRRAIRRAFKVWSEVTPLTFTEVSTGEADIMIGFARGDHGDGYPFDGPGGVLAHAFFP 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189217853  148 GTGVGGDSHFDDDELWTLGEGQvvrvkygnadgeyckfpflfngkeynsctdtgrsdgflwcsttynfekdgkygfcphe 227
Cdd:pfam00413  81 GPGLGGDIHFDDDETWTVGSSA---------------------------------------------------------- 102
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189217853  228 alftmggnaegqpckfpfrfqgtsydscttegrtdgyrwcgttedydrdkkygfcpetamstvggnsegapcvfpftflg 307
Cdd:pfam00413     --------------------------------------------------------------------------------
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189217853  308 nkyesctsagrsdgkmwcattanydddrkwgfcpDQGYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTY--TKNFRLSQ 385
Cdd:pfam00413 103 ----------------------------------PNGINLFLVAAHEIGHALGLGHSSDPGAIMYPTYSPldPKKFRLSQ 148
                         330
                  ....*....|.
gi 189217853  386 DDIKGIQELYG 396
Cdd:pfam00413 149 DDIKGIQQLYG 159
FN2 smart00059
Fibronectin type 2 domain; One of three types of internal repeat within the plasma protein, ...
292-340 4.18e-24

Fibronectin type 2 domain; One of three types of internal repeat within the plasma protein, fibronectin. Also occurs in coagulation factor XII, 2 type IV collagenases, PDC-109, and cation-independent mannose-6-phosphate and secretory phospholipase A2 receptors. In fibronectin, PDC-109, and the collagenases, this domain contributes to collagen-binding function.


:

Pssm-ID: 128373  Cd Length: 49  Bit Score: 95.06  E-value: 4.18e-24
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|....*....
gi 189217853   292 GNSEGAPCVFPFTFLGNKYESCTSAGRSDGKMWCATTANYDDDRKWGFC 340
Cdd:smart00059   1 GNSDGEPCVFPFIYNGKKYHDCTSEGRSDGMLWCSTTPNYDRDGKWGFC 49
FN2 smart00059
Fibronectin type 2 domain; One of three types of internal repeat within the plasma protein, ...
234-282 3.72e-23

Fibronectin type 2 domain; One of three types of internal repeat within the plasma protein, fibronectin. Also occurs in coagulation factor XII, 2 type IV collagenases, PDC-109, and cation-independent mannose-6-phosphate and secretory phospholipase A2 receptors. In fibronectin, PDC-109, and the collagenases, this domain contributes to collagen-binding function.


:

Pssm-ID: 128373  Cd Length: 49  Bit Score: 92.36  E-value: 3.72e-23
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|....*....
gi 189217853   234 GNAEGQPCKFPFRFQGTSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFC 282
Cdd:smart00059   1 GNSDGEPCVFPFIYNGKKYHDCTSEGRSDGMLWCSTTPNYDRDGKWGFC 49
FN2 smart00059
Fibronectin type 2 domain; One of three types of internal repeat within the plasma protein, ...
176-224 1.74e-22

Fibronectin type 2 domain; One of three types of internal repeat within the plasma protein, fibronectin. Also occurs in coagulation factor XII, 2 type IV collagenases, PDC-109, and cation-independent mannose-6-phosphate and secretory phospholipase A2 receptors. In fibronectin, PDC-109, and the collagenases, this domain contributes to collagen-binding function.


:

Pssm-ID: 128373  Cd Length: 49  Bit Score: 90.44  E-value: 1.74e-22
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|....*....
gi 189217853   176 GNADGEYCKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFC 224
Cdd:smart00059   1 GNSDGEPCVFPFIYNGKKYHDCTSEGRSDGMLWCSTTPNYDRDGKWGFC 49
PG_binding_1 pfam01471
Putative peptidoglycan binding domain; This domain is composed of three alpha helices. This ...
20-47 6.33e-04

Putative peptidoglycan binding domain; This domain is composed of three alpha helices. This domain is found at the N or C-terminus of a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. This family is found N-terminal to the catalytic domain of matrixins. The domain is found to bind peptidoglycan experimentally.


:

Pssm-ID: 334552 [Multi-domain]  Cd Length: 57  Bit Score: 37.87  E-value: 6.33e-04
                          10        20
                  ....*....|....*....|....*...
gi 189217853   20 LKDTLKKMQKFFGLPQTGDLDQNTIETM 47
Cdd:pfam01471  30 TEAAVKAFQRAFGLPVDGIVDPETLAAL 57
 
Name Accession Description Interval E-value
HX cd00094
Hemopexin-like repeats.; Hemopexin is a heme-binding protein that transports heme to the liver. ...
416-610 2.84e-76

Hemopexin-like repeats.; Hemopexin is a heme-binding protein that transports heme to the liver. Hemopexin-like repeats occur in vitronectin and some matrix metalloproteinases family (matrixins). The HX repeats of some matrixins bind tissue inhibitor of metalloproteinases (TIMPs). This CD contains 4 instances of the repeat.


Pssm-ID: 238046 [Multi-domain]  Cd Length: 194  Bit Score: 240.68  E-value: 2.84e-76
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189217853 416 PEICKQdIVFDGIAQIRGEIFFFKDRFIWRtVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWIYSA 495
Cdd:cd00094    1 PDACDP-LSFDAVTTLRGELYFFKGRYFWR-LSPGKPPGSPFLISSFWPSLPSPVDAAFERPDTGKIYFFKGDKYWVYTG 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189217853 496 STLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDPGFPKLIADAWNAIPDNLDAVVDLQg 575
Cdd:cd00094   79 KNLEPGYPKPISDLGFPPTVKQIDAALRWPDNGKTYFFKGDKYWRYDEKTQKMDPGYPKLIETDFPGVPDKVDAAFRWL- 157
                        170       180       190
                 ....*....|....*....|....*....|....*..
gi 189217853 576 GGHSYFFKGAYYLKLENQSLKS--VKFGSIKSDWLGC 610
Cdd:cd00094  158 DGYYYFFKGDQYWRFDPRSKEVrvGYPLKISSDWLGC 194
Peptidase_M10 pfam00413
Matrixin; The members of this family are enzymes that cleave peptides. These proteases require ...
68-396 1.40e-68

Matrixin; The members of this family are enzymes that cleave peptides. These proteases require zinc for catalysis.


Pssm-ID: 334067  Cd Length: 159  Bit Score: 219.41  E-value: 1.40e-68
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189217853   68 KWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAP 147
Cdd:pfam00413   1 KWRKKNLTYRILNYTPDLPRAEVRRAIRRAFKVWSEVTPLTFTEVSTGEADIMIGFARGDHGDGYPFDGPGGVLAHAFFP 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189217853  148 GTGVGGDSHFDDDELWTLGEGQvvrvkygnadgeyckfpflfngkeynsctdtgrsdgflwcsttynfekdgkygfcphe 227
Cdd:pfam00413  81 GPGLGGDIHFDDDETWTVGSSA---------------------------------------------------------- 102
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189217853  228 alftmggnaegqpckfpfrfqgtsydscttegrtdgyrwcgttedydrdkkygfcpetamstvggnsegapcvfpftflg 307
Cdd:pfam00413     --------------------------------------------------------------------------------
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189217853  308 nkyesctsagrsdgkmwcattanydddrkwgfcpDQGYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTY--TKNFRLSQ 385
Cdd:pfam00413 103 ----------------------------------PNGINLFLVAAHEIGHALGLGHSSDPGAIMYPTYSPldPKKFRLSQ 148
                         330
                  ....*....|.
gi 189217853  386 DDIKGIQELYG 396
Cdd:pfam00413 149 DDIKGIQQLYG 159
ZnMc_MMP cd04278
Zinc-dependent metalloprotease, matrix metalloproteinase (MMP) sub-family. MMPs are ...
68-396 3.40e-61

Zinc-dependent metalloprotease, matrix metalloproteinase (MMP) sub-family. MMPs are responsible for a great deal of pericellular proteolysis of extracellular matrix and cell surface molecules, playing crucial roles in morphogenesis, cell fate specification, cell migration, tissue repair, tumorigenesis, gain or loss of tissue-specific functions, and apoptosis. In many instances, they are anchored to cell membranes via trans-membrane domains, and their activity is controlled via TIMPs (tissue inhibitors of metalloproteinases).


Pssm-ID: 239805 [Multi-domain]  Cd Length: 157  Bit Score: 199.74  E-value: 3.40e-61
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189217853  68 KWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDG-EADIMINFGRWEHGDGYPFDGKDGLLAHAFA 146
Cdd:cd04278    1 KWSKTNLTYRILNYPPDLPRDDVRRAIARAFRVWSDVTPLTFREVTSGqEADIRISFARGNHGDGYPFDGPGGTLAHAFF 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189217853 147 PGtGVGGDSHFDDDELWTLGEGqvvrvkygnadgeyckfpflfngkeynsctdtgrsdgflwcsttynfekdgkygfcph 226
Cdd:cd04278   81 PG-GIGGDIHFDDDEQWTLGSD---------------------------------------------------------- 101
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189217853 227 ealftmggnaegqpckfpfrfqgtsydscttegrtdgyrwcgttedydrdkkygfcpetamstvggnsegapcvfpftfl 306
Cdd:cd04278      --------------------------------------------------------------------------------
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189217853 307 gnkyesctsagrsdgkmwcattanydddrkwgfcpDQGYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYT-YTKNFRLSQ 385
Cdd:cd04278  102 -----------------------------------SGGTDLFSVAAHEIGHALGLGHSSDPDSIMYPYYQgPVPKFKLSQ 146
                        330
                 ....*....|.
gi 189217853 386 DDIKGIQELYG 396
Cdd:cd04278  147 DDIRGIQALYG 157
FN2 smart00059
Fibronectin type 2 domain; One of three types of internal repeat within the plasma protein, ...
292-340 4.18e-24

Fibronectin type 2 domain; One of three types of internal repeat within the plasma protein, fibronectin. Also occurs in coagulation factor XII, 2 type IV collagenases, PDC-109, and cation-independent mannose-6-phosphate and secretory phospholipase A2 receptors. In fibronectin, PDC-109, and the collagenases, this domain contributes to collagen-binding function.


Pssm-ID: 128373  Cd Length: 49  Bit Score: 95.06  E-value: 4.18e-24
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|....*....
gi 189217853   292 GNSEGAPCVFPFTFLGNKYESCTSAGRSDGKMWCATTANYDDDRKWGFC 340
Cdd:smart00059   1 GNSDGEPCVFPFIYNGKKYHDCTSEGRSDGMLWCSTTPNYDRDGKWGFC 49
FN2 smart00059
Fibronectin type 2 domain; One of three types of internal repeat within the plasma protein, ...
234-282 3.72e-23

Fibronectin type 2 domain; One of three types of internal repeat within the plasma protein, fibronectin. Also occurs in coagulation factor XII, 2 type IV collagenases, PDC-109, and cation-independent mannose-6-phosphate and secretory phospholipase A2 receptors. In fibronectin, PDC-109, and the collagenases, this domain contributes to collagen-binding function.


Pssm-ID: 128373  Cd Length: 49  Bit Score: 92.36  E-value: 3.72e-23
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|....*....
gi 189217853   234 GNAEGQPCKFPFRFQGTSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFC 282
Cdd:smart00059   1 GNSDGEPCVFPFIYNGKKYHDCTSEGRSDGMLWCSTTPNYDRDGKWGFC 49
FN2 smart00059
Fibronectin type 2 domain; One of three types of internal repeat within the plasma protein, ...
176-224 1.74e-22

Fibronectin type 2 domain; One of three types of internal repeat within the plasma protein, fibronectin. Also occurs in coagulation factor XII, 2 type IV collagenases, PDC-109, and cation-independent mannose-6-phosphate and secretory phospholipase A2 receptors. In fibronectin, PDC-109, and the collagenases, this domain contributes to collagen-binding function.


Pssm-ID: 128373  Cd Length: 49  Bit Score: 90.44  E-value: 1.74e-22
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|....*....
gi 189217853   176 GNADGEYCKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFC 224
Cdd:smart00059   1 GNSDGEPCVFPFIYNGKKYHDCTSEGRSDGMLWCSTTPNYDRDGKWGFC 49
FN2 cd00062
Fibronectin Type II domain: FN2 is one of three types of internal repeats which combine to ...
293-340 7.16e-22

Fibronectin Type II domain: FN2 is one of three types of internal repeats which combine to form larger domains within fibronectin. Fibronectin, a plasma protein that binds cell surfaces and various compounds including collagen, fibrin, heparin, DNA, and actin, usually exists as a dimer in plasma and as an insoluble multimer in extracellular matrices. Dimers of nearly identical subunits are linked by a disulfide bond close to their C-terminus. Fibronectin is composed of 3 types of modules, FN1,FN2 and FN3. The collagen binding domain contains four FN1 and two FN2 repeats.


Pssm-ID: 238019  Cd Length: 48  Bit Score: 88.52  E-value: 7.16e-22
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|....*...
gi 189217853 293 NSEGAPCVFPFTFLGNKYESCTSAGRSDGKMWCATTANYDDDRKWGFC 340
Cdd:cd00062    1 NSDGAPCVFPFIYRGKWYHDCTTEGSNDGKLWCSTTPNYDRDGKWGYC 48
FN2 cd00062
Fibronectin Type II domain: FN2 is one of three types of internal repeats which combine to ...
235-282 9.20e-21

Fibronectin Type II domain: FN2 is one of three types of internal repeats which combine to form larger domains within fibronectin. Fibronectin, a plasma protein that binds cell surfaces and various compounds including collagen, fibrin, heparin, DNA, and actin, usually exists as a dimer in plasma and as an insoluble multimer in extracellular matrices. Dimers of nearly identical subunits are linked by a disulfide bond close to their C-terminus. Fibronectin is composed of 3 types of modules, FN1,FN2 and FN3. The collagen binding domain contains four FN1 and two FN2 repeats.


Pssm-ID: 238019  Cd Length: 48  Bit Score: 85.43  E-value: 9.20e-21
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|....*...
gi 189217853 235 NAEGQPCKFPFRFQGTSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFC 282
Cdd:cd00062    1 NSDGAPCVFPFIYRGKWYHDCTTEGSNDGKLWCSTTPNYDRDGKWGYC 48
fn2 pfam00040
Fibronectin type II domain;
299-340 1.85e-20

Fibronectin type II domain;


Pssm-ID: 306537  Cd Length: 42  Bit Score: 84.16  E-value: 1.85e-20
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|..
gi 189217853  299 CVFPFTFLGNKYESCTSAGRSDGKMWCATTANYDDDRKWGFC 340
Cdd:pfam00040   1 CVFPFTYKGKWYYSCTTDGRSDGRLWCATTSNYDKDKKWGYC 42
ZnMc smart00235
Zinc-dependent metalloprotease; Neutral zinc metallopeptidases. This alignment represents a ...
65-168 4.24e-20

Zinc-dependent metalloprotease; Neutral zinc metallopeptidases. This alignment represents a subset of known subfamilies. Highest similarity occurs in the HExxH zinc-binding site/ active site.


Pssm-ID: 214576 [Multi-domain]  Cd Length: 139  Bit Score: 86.64  E-value: 4.24e-20
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189217853    65 RKPKWDKNQITYRIigYTPDLDPEtVDDAFARAFQVWSDVTPLRFSRIhDGEADIMINFGRWEHGdgypfdgkdGLLAHA 144
Cdd:smart00235   1 GSKKWPKGTVPYVI--DSSSLSPE-EREAIAKALAEWSDVTCIRFVER-TGTADIYISFGSGDSG---------CTLSHA 67
                           90       100
                   ....*....|....*....|....
gi 189217853   145 FAPgtgvGGDSHFdDDELWTLGEG 168
Cdd:smart00235  68 GRP----GGDQHL-SLGNGCINTG 86
FN2 cd00062
Fibronectin Type II domain: FN2 is one of three types of internal repeats which combine to ...
177-224 7.26e-20

Fibronectin Type II domain: FN2 is one of three types of internal repeats which combine to form larger domains within fibronectin. Fibronectin, a plasma protein that binds cell surfaces and various compounds including collagen, fibrin, heparin, DNA, and actin, usually exists as a dimer in plasma and as an insoluble multimer in extracellular matrices. Dimers of nearly identical subunits are linked by a disulfide bond close to their C-terminus. Fibronectin is composed of 3 types of modules, FN1,FN2 and FN3. The collagen binding domain contains four FN1 and two FN2 repeats.


Pssm-ID: 238019  Cd Length: 48  Bit Score: 82.74  E-value: 7.26e-20
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|....*...
gi 189217853 177 NADGEYCKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFC 224
Cdd:cd00062    1 NSDGAPCVFPFIYRGKWYHDCTTEGSNDGKLWCSTTPNYDRDGKWGYC 48
fn2 pfam00040
Fibronectin type II domain;
241-282 1.42e-19

Fibronectin type II domain;


Pssm-ID: 306537  Cd Length: 42  Bit Score: 81.85  E-value: 1.42e-19
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|..
gi 189217853  241 CKFPFRFQGTSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFC 282
Cdd:pfam00040   1 CVFPFTYKGKWYYSCTTDGRSDGRLWCATTSNYDKDKKWGYC 42
fn2 pfam00040
Fibronectin type II domain;
183-224 4.07e-19

Fibronectin type II domain;


Pssm-ID: 306537  Cd Length: 42  Bit Score: 80.69  E-value: 4.07e-19
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|..
gi 189217853  183 CKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFC 224
Cdd:pfam00040   1 CVFPFTYKGKWYYSCTTDGRSDGRLWCATTSNYDKDKKWGYC 42
HX smart00120
Hemopexin-like repeats; Hemopexin is a heme-binding protein that transports heme to the liver. ...
518-564 3.92e-10

Hemopexin-like repeats; Hemopexin is a heme-binding protein that transports heme to the liver. Hemopexin-like repeats occur in vitronectin and some matrix metalloproteinases family (matrixins). The HX repeats of some matrixins bind tissue inhibitor of metalloproteinases (TIMPs).


Pssm-ID: 214524 [Multi-domain]  Cd Length: 45  Bit Score: 54.94  E-value: 3.92e-10
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|....*..
gi 189217853   518 VDAAFnWSKNKKTYIFAGDKFWRYNEvkKKMDPGFPKLIADAWNAIP 564
Cdd:smart00120   1 IDAAF-ELRDGKTYFFKGDKYWRFDP--KRVDPGYPKLISSFFPGLP 44
Hemopexin pfam00045
Hemopexin; Hemopexin is a heme-binding protein that transports heme to the liver. ...
518-564 2.47e-09

Hemopexin; Hemopexin is a heme-binding protein that transports heme to the liver. Hemopexin-like repeats occur in vitronectin and some matrix metallopeptidases family (matrixins). The HX repeats of some matrixins bind tissue inhibitor of metallopeptidases (TIMPs).


Pssm-ID: 333794  Cd Length: 44  Bit Score: 52.97  E-value: 2.47e-09
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....*..
gi 189217853  518 VDAAFNWSKNKkTYIFAGDKFWRYNEvkKKMDPGFPKLIADAWNAIP 564
Cdd:pfam00045   1 IDAAFEDRDGK-TYFFKGRKYWRFDP--QKVEPGYPKLISDFWPGLP 44
PG_binding_1 pfam01471
Putative peptidoglycan binding domain; This domain is composed of three alpha helices. This ...
20-47 6.33e-04

Putative peptidoglycan binding domain; This domain is composed of three alpha helices. This domain is found at the N or C-terminus of a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. This family is found N-terminal to the catalytic domain of matrixins. The domain is found to bind peptidoglycan experimentally.


Pssm-ID: 334552 [Multi-domain]  Cd Length: 57  Bit Score: 37.87  E-value: 6.33e-04
                          10        20
                  ....*....|....*....|....*...
gi 189217853   20 LKDTLKKMQKFFGLPQTGDLDQNTIETM 47
Cdd:pfam01471  30 TEAAVKAFQRAFGLPVDGIVDPETLAAL 57
 
Name Accession Description Interval E-value
HX cd00094
Hemopexin-like repeats.; Hemopexin is a heme-binding protein that transports heme to the liver. ...
416-610 2.84e-76

Hemopexin-like repeats.; Hemopexin is a heme-binding protein that transports heme to the liver. Hemopexin-like repeats occur in vitronectin and some matrix metalloproteinases family (matrixins). The HX repeats of some matrixins bind tissue inhibitor of metalloproteinases (TIMPs). This CD contains 4 instances of the repeat.


Pssm-ID: 238046 [Multi-domain]  Cd Length: 194  Bit Score: 240.68  E-value: 2.84e-76
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189217853 416 PEICKQdIVFDGIAQIRGEIFFFKDRFIWRtVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWIYSA 495
Cdd:cd00094    1 PDACDP-LSFDAVTTLRGELYFFKGRYFWR-LSPGKPPGSPFLISSFWPSLPSPVDAAFERPDTGKIYFFKGDKYWVYTG 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189217853 496 STLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDPGFPKLIADAWNAIPDNLDAVVDLQg 575
Cdd:cd00094   79 KNLEPGYPKPISDLGFPPTVKQIDAALRWPDNGKTYFFKGDKYWRYDEKTQKMDPGYPKLIETDFPGVPDKVDAAFRWL- 157
                        170       180       190
                 ....*....|....*....|....*....|....*..
gi 189217853 576 GGHSYFFKGAYYLKLENQSLKS--VKFGSIKSDWLGC 610
Cdd:cd00094  158 DGYYYFFKGDQYWRFDPRSKEVrvGYPLKISSDWLGC 194
Peptidase_M10 pfam00413
Matrixin; The members of this family are enzymes that cleave peptides. These proteases require ...
68-396 1.40e-68

Matrixin; The members of this family are enzymes that cleave peptides. These proteases require zinc for catalysis.


Pssm-ID: 334067  Cd Length: 159  Bit Score: 219.41  E-value: 1.40e-68
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189217853   68 KWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAP 147
Cdd:pfam00413   1 KWRKKNLTYRILNYTPDLPRAEVRRAIRRAFKVWSEVTPLTFTEVSTGEADIMIGFARGDHGDGYPFDGPGGVLAHAFFP 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189217853  148 GTGVGGDSHFDDDELWTLGEGQvvrvkygnadgeyckfpflfngkeynsctdtgrsdgflwcsttynfekdgkygfcphe 227
Cdd:pfam00413  81 GPGLGGDIHFDDDETWTVGSSA---------------------------------------------------------- 102
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189217853  228 alftmggnaegqpckfpfrfqgtsydscttegrtdgyrwcgttedydrdkkygfcpetamstvggnsegapcvfpftflg 307
Cdd:pfam00413     --------------------------------------------------------------------------------
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189217853  308 nkyesctsagrsdgkmwcattanydddrkwgfcpDQGYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTY--TKNFRLSQ 385
Cdd:pfam00413 103 ----------------------------------PNGINLFLVAAHEIGHALGLGHSSDPGAIMYPTYSPldPKKFRLSQ 148
                         330
                  ....*....|.
gi 189217853  386 DDIKGIQELYG 396
Cdd:pfam00413 149 DDIKGIQQLYG 159
ZnMc_MMP cd04278
Zinc-dependent metalloprotease, matrix metalloproteinase (MMP) sub-family. MMPs are ...
68-396 3.40e-61

Zinc-dependent metalloprotease, matrix metalloproteinase (MMP) sub-family. MMPs are responsible for a great deal of pericellular proteolysis of extracellular matrix and cell surface molecules, playing crucial roles in morphogenesis, cell fate specification, cell migration, tissue repair, tumorigenesis, gain or loss of tissue-specific functions, and apoptosis. In many instances, they are anchored to cell membranes via trans-membrane domains, and their activity is controlled via TIMPs (tissue inhibitors of metalloproteinases).


Pssm-ID: 239805 [Multi-domain]  Cd Length: 157  Bit Score: 199.74  E-value: 3.40e-61
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189217853  68 KWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDG-EADIMINFGRWEHGDGYPFDGKDGLLAHAFA 146
Cdd:cd04278    1 KWSKTNLTYRILNYPPDLPRDDVRRAIARAFRVWSDVTPLTFREVTSGqEADIRISFARGNHGDGYPFDGPGGTLAHAFF 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189217853 147 PGtGVGGDSHFDDDELWTLGEGqvvrvkygnadgeyckfpflfngkeynsctdtgrsdgflwcsttynfekdgkygfcph 226
Cdd:cd04278   81 PG-GIGGDIHFDDDEQWTLGSD---------------------------------------------------------- 101
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189217853 227 ealftmggnaegqpckfpfrfqgtsydscttegrtdgyrwcgttedydrdkkygfcpetamstvggnsegapcvfpftfl 306
Cdd:cd04278      --------------------------------------------------------------------------------
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189217853 307 gnkyesctsagrsdgkmwcattanydddrkwgfcpDQGYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYT-YTKNFRLSQ 385
Cdd:cd04278  102 -----------------------------------SGGTDLFSVAAHEIGHALGLGHSSDPDSIMYPYYQgPVPKFKLSQ 146
                        330
                 ....*....|.
gi 189217853 386 DDIKGIQELYG 396
Cdd:cd04278  147 DDIRGIQALYG 157
FN2 smart00059
Fibronectin type 2 domain; One of three types of internal repeat within the plasma protein, ...
292-340 4.18e-24

Fibronectin type 2 domain; One of three types of internal repeat within the plasma protein, fibronectin. Also occurs in coagulation factor XII, 2 type IV collagenases, PDC-109, and cation-independent mannose-6-phosphate and secretory phospholipase A2 receptors. In fibronectin, PDC-109, and the collagenases, this domain contributes to collagen-binding function.


Pssm-ID: 128373  Cd Length: 49  Bit Score: 95.06  E-value: 4.18e-24
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|....*....
gi 189217853   292 GNSEGAPCVFPFTFLGNKYESCTSAGRSDGKMWCATTANYDDDRKWGFC 340
Cdd:smart00059   1 GNSDGEPCVFPFIYNGKKYHDCTSEGRSDGMLWCSTTPNYDRDGKWGFC 49
FN2 smart00059
Fibronectin type 2 domain; One of three types of internal repeat within the plasma protein, ...
234-282 3.72e-23

Fibronectin type 2 domain; One of three types of internal repeat within the plasma protein, fibronectin. Also occurs in coagulation factor XII, 2 type IV collagenases, PDC-109, and cation-independent mannose-6-phosphate and secretory phospholipase A2 receptors. In fibronectin, PDC-109, and the collagenases, this domain contributes to collagen-binding function.


Pssm-ID: 128373  Cd Length: 49  Bit Score: 92.36  E-value: 3.72e-23
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|....*....
gi 189217853   234 GNAEGQPCKFPFRFQGTSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFC 282
Cdd:smart00059   1 GNSDGEPCVFPFIYNGKKYHDCTSEGRSDGMLWCSTTPNYDRDGKWGFC 49
FN2 smart00059
Fibronectin type 2 domain; One of three types of internal repeat within the plasma protein, ...
176-224 1.74e-22

Fibronectin type 2 domain; One of three types of internal repeat within the plasma protein, fibronectin. Also occurs in coagulation factor XII, 2 type IV collagenases, PDC-109, and cation-independent mannose-6-phosphate and secretory phospholipase A2 receptors. In fibronectin, PDC-109, and the collagenases, this domain contributes to collagen-binding function.


Pssm-ID: 128373  Cd Length: 49  Bit Score: 90.44  E-value: 1.74e-22
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|....*....
gi 189217853   176 GNADGEYCKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFC 224
Cdd:smart00059   1 GNSDGEPCVFPFIYNGKKYHDCTSEGRSDGMLWCSTTPNYDRDGKWGFC 49
FN2 cd00062
Fibronectin Type II domain: FN2 is one of three types of internal repeats which combine to ...
293-340 7.16e-22

Fibronectin Type II domain: FN2 is one of three types of internal repeats which combine to form larger domains within fibronectin. Fibronectin, a plasma protein that binds cell surfaces and various compounds including collagen, fibrin, heparin, DNA, and actin, usually exists as a dimer in plasma and as an insoluble multimer in extracellular matrices. Dimers of nearly identical subunits are linked by a disulfide bond close to their C-terminus. Fibronectin is composed of 3 types of modules, FN1,FN2 and FN3. The collagen binding domain contains four FN1 and two FN2 repeats.


Pssm-ID: 238019  Cd Length: 48  Bit Score: 88.52  E-value: 7.16e-22
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|....*...
gi 189217853 293 NSEGAPCVFPFTFLGNKYESCTSAGRSDGKMWCATTANYDDDRKWGFC 340
Cdd:cd00062    1 NSDGAPCVFPFIYRGKWYHDCTTEGSNDGKLWCSTTPNYDRDGKWGYC 48
FN2 cd00062
Fibronectin Type II domain: FN2 is one of three types of internal repeats which combine to ...
235-282 9.20e-21

Fibronectin Type II domain: FN2 is one of three types of internal repeats which combine to form larger domains within fibronectin. Fibronectin, a plasma protein that binds cell surfaces and various compounds including collagen, fibrin, heparin, DNA, and actin, usually exists as a dimer in plasma and as an insoluble multimer in extracellular matrices. Dimers of nearly identical subunits are linked by a disulfide bond close to their C-terminus. Fibronectin is composed of 3 types of modules, FN1,FN2 and FN3. The collagen binding domain contains four FN1 and two FN2 repeats.


Pssm-ID: 238019  Cd Length: 48  Bit Score: 85.43  E-value: 9.20e-21
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|....*...
gi 189217853 235 NAEGQPCKFPFRFQGTSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFC 282
Cdd:cd00062    1 NSDGAPCVFPFIYRGKWYHDCTTEGSNDGKLWCSTTPNYDRDGKWGYC 48
fn2 pfam00040
Fibronectin type II domain;
299-340 1.85e-20

Fibronectin type II domain;


Pssm-ID: 306537  Cd Length: 42  Bit Score: 84.16  E-value: 1.85e-20
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|..
gi 189217853  299 CVFPFTFLGNKYESCTSAGRSDGKMWCATTANYDDDRKWGFC 340
Cdd:pfam00040   1 CVFPFTYKGKWYYSCTTDGRSDGRLWCATTSNYDKDKKWGYC 42
ZnMc smart00235
Zinc-dependent metalloprotease; Neutral zinc metallopeptidases. This alignment represents a ...
65-168 4.24e-20

Zinc-dependent metalloprotease; Neutral zinc metallopeptidases. This alignment represents a subset of known subfamilies. Highest similarity occurs in the HExxH zinc-binding site/ active site.


Pssm-ID: 214576 [Multi-domain]  Cd Length: 139  Bit Score: 86.64  E-value: 4.24e-20
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189217853    65 RKPKWDKNQITYRIigYTPDLDPEtVDDAFARAFQVWSDVTPLRFSRIhDGEADIMINFGRWEHGdgypfdgkdGLLAHA 144
Cdd:smart00235   1 GSKKWPKGTVPYVI--DSSSLSPE-EREAIAKALAEWSDVTCIRFVER-TGTADIYISFGSGDSG---------CTLSHA 67
                           90       100
                   ....*....|....*....|....
gi 189217853   145 FAPgtgvGGDSHFdDDELWTLGEG 168
Cdd:smart00235  68 GRP----GGDQHL-SLGNGCINTG 86
FN2 cd00062
Fibronectin Type II domain: FN2 is one of three types of internal repeats which combine to ...
177-224 7.26e-20

Fibronectin Type II domain: FN2 is one of three types of internal repeats which combine to form larger domains within fibronectin. Fibronectin, a plasma protein that binds cell surfaces and various compounds including collagen, fibrin, heparin, DNA, and actin, usually exists as a dimer in plasma and as an insoluble multimer in extracellular matrices. Dimers of nearly identical subunits are linked by a disulfide bond close to their C-terminus. Fibronectin is composed of 3 types of modules, FN1,FN2 and FN3. The collagen binding domain contains four FN1 and two FN2 repeats.


Pssm-ID: 238019  Cd Length: 48  Bit Score: 82.74  E-value: 7.26e-20
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|....*...
gi 189217853 177 NADGEYCKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFC 224
Cdd:cd00062    1 NSDGAPCVFPFIYRGKWYHDCTTEGSNDGKLWCSTTPNYDRDGKWGYC 48
fn2 pfam00040
Fibronectin type II domain;
241-282 1.42e-19

Fibronectin type II domain;


Pssm-ID: 306537  Cd Length: 42  Bit Score: 81.85  E-value: 1.42e-19
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|..
gi 189217853  241 CKFPFRFQGTSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFC 282
Cdd:pfam00040   1 CVFPFTYKGKWYYSCTTDGRSDGRLWCATTSNYDKDKKWGYC 42
fn2 pfam00040
Fibronectin type II domain;
183-224 4.07e-19

Fibronectin type II domain;


Pssm-ID: 306537  Cd Length: 42  Bit Score: 80.69  E-value: 4.07e-19
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|..
gi 189217853  183 CKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFC 224
Cdd:pfam00040   1 CVFPFTYKGKWYYSCTTDGRSDGRLWCATTSNYDKDKKWGYC 42
HX smart00120
Hemopexin-like repeats; Hemopexin is a heme-binding protein that transports heme to the liver. ...
518-564 3.92e-10

Hemopexin-like repeats; Hemopexin is a heme-binding protein that transports heme to the liver. Hemopexin-like repeats occur in vitronectin and some matrix metalloproteinases family (matrixins). The HX repeats of some matrixins bind tissue inhibitor of metalloproteinases (TIMPs).


Pssm-ID: 214524 [Multi-domain]  Cd Length: 45  Bit Score: 54.94  E-value: 3.92e-10
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|....*..
gi 189217853   518 VDAAFnWSKNKKTYIFAGDKFWRYNEvkKKMDPGFPKLIADAWNAIP 564
Cdd:smart00120   1 IDAAF-ELRDGKTYFFKGDKYWRFDP--KRVDPGYPKLISSFFPGLP 44
Hemopexin pfam00045
Hemopexin; Hemopexin is a heme-binding protein that transports heme to the liver. ...
518-564 2.47e-09

Hemopexin; Hemopexin is a heme-binding protein that transports heme to the liver. Hemopexin-like repeats occur in vitronectin and some matrix metallopeptidases family (matrixins). The HX repeats of some matrixins bind tissue inhibitor of metallopeptidases (TIMPs).


Pssm-ID: 333794  Cd Length: 44  Bit Score: 52.97  E-value: 2.47e-09
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....*..
gi 189217853  518 VDAAFNWSKNKkTYIFAGDKFWRYNEvkKKMDPGFPKLIADAWNAIP 564
Cdd:pfam00045   1 IDAAFEDRDGK-TYFFKGRKYWRFDP--QKVEPGYPKLISDFWPGLP 44
ZnMc_MMP_like_1 cd04279
Zinc-dependent metalloprotease; MMP_like sub-family 1. A group of bacterial, archaeal, and ...
337-396 9.85e-08

Zinc-dependent metalloprotease; MMP_like sub-family 1. A group of bacterial, archaeal, and fungal metalloproteinase domains similar to matrix metalloproteinases and astacin.


Pssm-ID: 239806  Cd Length: 156  Bit Score: 51.69  E-value: 9.85e-08
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 189217853 337 WGFCPDQG-YSLFLVAAHEFGHAMGLEHSQD-PGALMAPIYTY--TKNFRLSQDDIKGIQELYG 396
Cdd:cd04279   93 LGPGQPRGaENLQAIALHELGHALGLWHHSDrPEDAMYPSQGQgpDGNPTLSARDVATLKRLYG 156
ZnMc cd00203
Zinc-dependent metalloprotease. This super-family of metalloproteases contains two major ...
344-395 1.28e-06

Zinc-dependent metalloprotease. This super-family of metalloproteases contains two major branches, the astacin-like proteases and the adamalysin/reprolysin-like proteases. Both branches have wide phylogenetic distribution, and contain sub-families, which are involved in vertebrate development and disease.


Pssm-ID: 238124 [Multi-domain]  Cd Length: 167  Bit Score: 48.67  E-value: 1.28e-06
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 189217853 344 GYSLFLVAAHEFGHAMGLEHSQD--------------------PGALMAPI---YTYTKNFRLSQDDIKGIQELY 395
Cdd:cd00203   93 TKEGAQTIAHELGHALGFYHDHDrkdrddyptiddtlnaedddYYSVMSYTkgsFSDGQRKDFSQCDIDQINKLY 167
Hemopexin pfam00045
Hemopexin; Hemopexin is a heme-binding protein that transports heme to the liver. ...
425-467 6.04e-06

Hemopexin; Hemopexin is a heme-binding protein that transports heme to the liver. Hemopexin-like repeats occur in vitronectin and some matrix metallopeptidases family (matrixins). The HX repeats of some matrixins bind tissue inhibitor of metallopeptidases (TIMPs).


Pssm-ID: 333794  Cd Length: 44  Bit Score: 43.34  E-value: 6.04e-06
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....
gi 189217853  425 FDGIAQIR-GEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELP 467
Cdd:pfam00045   1 IDAAFEDRdGKTYFFKGRKYWRFDPQKVEPGYPKLISDFWPGLP 44
HX smart00120
Hemopexin-like repeats; Hemopexin is a heme-binding protein that transports heme to the liver. ...
470-513 2.88e-05

Hemopexin-like repeats; Hemopexin is a heme-binding protein that transports heme to the liver. Hemopexin-like repeats occur in vitronectin and some matrix metalloproteinases family (matrixins). The HX repeats of some matrixins bind tissue inhibitor of metalloproteinases (TIMPs).


Pssm-ID: 214524 [Multi-domain]  Cd Length: 45  Bit Score: 41.46  E-value: 2.88e-05
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|....*.
gi 189217853   470 IDAVYEAPqEEKAVFFAGNEYWIYSASTLERGYPKPLTSL--GLPP 513
Cdd:smart00120   1 IDAAFELR-DGKTYFFKGDKYWRFDPKRVDPGYPKLISSFfpGLPC 45
Hemopexin pfam00045
Hemopexin; Hemopexin is a heme-binding protein that transports heme to the liver. ...
470-512 5.73e-05

Hemopexin; Hemopexin is a heme-binding protein that transports heme to the liver. Hemopexin-like repeats occur in vitronectin and some matrix metallopeptidases family (matrixins). The HX repeats of some matrixins bind tissue inhibitor of metallopeptidases (TIMPs).


Pssm-ID: 333794  Cd Length: 44  Bit Score: 40.64  E-value: 5.73e-05
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....*
gi 189217853  470 IDAVYEAPQEeKAVFFAGNEYWIYSASTLERGYPKPLTSL--GLP 512
Cdd:pfam00045   1 IDAAFEDRDG-KTYFFKGRKYWRFDPQKVEPGYPKLISDFwpGLP 44
ZnMc_serralysin_like cd04277
Zinc-dependent metalloprotease, serralysin_like subfamily. Serralysins and related proteases ...
314-396 8.51e-05

Zinc-dependent metalloprotease, serralysin_like subfamily. Serralysins and related proteases are important virulence factors in pathogenic bacteria. They may be secreted into the medium via a mechanism found in gram-negative bacteria, that does not require n-terminal signal sequences which are cleaved after the transmembrane translocation. A calcium-binding domain c-terminal to the metalloprotease domain, which contains multiple tandem repeats of a nine-residue motif including the pattern GGxGxD, and which forms a parallel beta roll may be involved in the translocation mechanism and/or substrate binding. Serralysin family members may have a broad spectrum of substrates each, including host immunoglobulins, complement proteins, cell matrix and cytoskeletal proteins, as well as antimicrobial peptides.


Pssm-ID: 239804  Cd Length: 186  Bit Score: 43.56  E-value: 8.51e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189217853 314 TSAGRSDGKMWCATTANYDDDRKwgfcPDQGYSLFLvaaHEFGHAMGLEHSQDPGA----------------LMA----P 373
Cdd:cd04277   87 GSGTAYGGDIWFNSSYDTNSDSP----GSYGYQTII---HEIGHALGLEHPGDYNGgdpvpptyaldsreytVMSynsgY 159
                         90       100
                 ....*....|....*....|....*..
gi 189217853 374 IYTYTKNFRLSQ----DDIKGIQELYG 396
Cdd:cd04277  160 GNGASAGGGYPQtpmlLDIAALQYLYG 186
HX smart00120
Hemopexin-like repeats; Hemopexin is a heme-binding protein that transports heme to the liver. ...
425-467 3.47e-04

Hemopexin-like repeats; Hemopexin is a heme-binding protein that transports heme to the liver. Hemopexin-like repeats occur in vitronectin and some matrix metalloproteinases family (matrixins). The HX repeats of some matrixins bind tissue inhibitor of metalloproteinases (TIMPs).


Pssm-ID: 214524 [Multi-domain]  Cd Length: 45  Bit Score: 38.38  E-value: 3.47e-04
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|....
gi 189217853   425 FDGIAQIR-GEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELP 467
Cdd:smart00120   1 IDAAFELRdGKTYFFKGDKYWRFDPKRVDPGYPKLISSFFPGLP 44
PG_binding_1 pfam01471
Putative peptidoglycan binding domain; This domain is composed of three alpha helices. This ...
20-47 6.33e-04

Putative peptidoglycan binding domain; This domain is composed of three alpha helices. This domain is found at the N or C-terminus of a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. This family is found N-terminal to the catalytic domain of matrixins. The domain is found to bind peptidoglycan experimentally.


Pssm-ID: 334552 [Multi-domain]  Cd Length: 57  Bit Score: 37.87  E-value: 6.33e-04
                          10        20
                  ....*....|....*....|....*...
gi 189217853   20 LKDTLKKMQKFFGLPQTGDLDQNTIETM 47
Cdd:pfam01471  30 TEAAVKAFQRAFGLPVDGIVDPETLAAL 57
ZnMc_MMP_like cd04268
Zinc-dependent metalloprotease, MMP_like subfamily. This group contains matrix ...
350-395 7.53e-04

Zinc-dependent metalloprotease, MMP_like subfamily. This group contains matrix metalloproteinases (MMPs), serralysins, and the astacin_like family of proteases.


Pssm-ID: 239796 [Multi-domain]  Cd Length: 165  Bit Score: 40.56  E-value: 7.53e-04
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 189217853 350 VAAHEFGHAMGLEHSQD--------------------------PGALMAPIYTYTKnfrLSQDDIKGIQELY 395
Cdd:cd04268   97 TAEHELGHALGLRHNFAasdrddnvdllaekgdtssvmdyapsNFSIQLGDGQKYT---IGPYDIAAIKKLY 165
ZnMc_ADAM_like cd04267
Zinc-dependent metalloprotease, ADAM_like or reprolysin_like subgroup. The adamalysin_like or ...
349-396 9.99e-04

Zinc-dependent metalloprotease, ADAM_like or reprolysin_like subgroup. The adamalysin_like or ADAM family of metalloproteases contains proteolytic domains from snake venoms, proteases from the mammalian reproductive tract, and the tumor necrosis factor alpha convertase, TACE. ADAMs (A Disintegrin And Metalloprotease) are glycoproteins, which play roles in cell signaling, cell fusion, and cell-cell interactions.


Pssm-ID: 239795  Cd Length: 192  Bit Score: 40.48  E-value: 9.99e-04
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....*...
gi 189217853 349 LVAAHEFGHAMGLEHS----------QDPGALMAPIYTYTKNFRLSQDDIKGIQELYG 396
Cdd:cd04267  135 LTMAHELGHNLGAEHDggdelafecdGGGNYIMAPVDSGLNSYRFSQCSIGSIREFLD 192
ZnMc cd00203
Zinc-dependent metalloprotease. This super-family of metalloproteases contains two major ...
74-172 1.77e-03

Zinc-dependent metalloprotease. This super-family of metalloproteases contains two major branches, the astacin-like proteases and the adamalysin/reprolysin-like proteases. Both branches have wide phylogenetic distribution, and contain sub-families, which are involved in vertebrate development and disease.


Pssm-ID: 238124 [Multi-domain]  Cd Length: 167  Bit Score: 39.43  E-value: 1.77e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189217853  74 ITYRIIGYTPDLD----PETVDDAFARAFQVWSDVTPLRF--SRIHDGEADIMINFGRWehgdgypfDGKDGLLAHAFAP 147
Cdd:cd00203    3 IPYVVVADDRDVEeenlSAQIQSLILIAMQIWRDYLNIRFvlVGVEIDKADIAILVTRQ--------DFDGGTGGWAYLG 74
                         90       100
                 ....*....|....*....|....*..
gi 189217853 148 GT--GVGGDSHFDDDELWTLGEGQVVR 172
Cdd:cd00203   75 RVcdSLRGVGVLQDNQSGTKEGAQTIA 101
ZnMc_MMP_like cd04268
Zinc-dependent metalloprotease, MMP_like subfamily. This group contains matrix ...
71-151 6.65e-03

Zinc-dependent metalloprotease, MMP_like subfamily. This group contains matrix metalloproteinases (MMPs), serralysins, and the astacin_like family of proteases.


Pssm-ID: 239796 [Multi-domain]  Cd Length: 165  Bit Score: 37.48  E-value: 6.65e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189217853  71 KNQITYRIIGYTPDldpeTVDDAFARAFQVWSDVTPLRFSRIHDG-EADIMINFGRWEHGDGYPFdgkdGLLAHAFAPGT 149
Cdd:cd04268    1 KKPITYYIDDSVPD----KLRAAILDAIEAWNKAFAIGFKNANDVdPADIRYSVIRWIPYNDGTW----SYGPSQVDPLT 72

                 ..
gi 189217853 150 GV 151
Cdd:cd04268   73 GE 74
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.17
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH