NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|255522817|ref|NP_001157319|]
View 

TBC1 domain family member 24 isoform a [Mus musculus]

Protein Classification

TBC domain-containing protein (domain architecture ID 10456719)

TBC domain-containing protein such as vertebrate TBC1 domain family member 24; contains a TLDc domain, which is a domain found in TBC and LysM proteins

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
TLDc smart00584
domain in TBC and LysM domain containing proteins;
342-556 1.08e-56

domain in TBC and LysM domain containing proteins;


:

Pssm-ID: 214733  Cd Length: 165  Bit Score: 187.53  E-value: 1.08e-56
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255522817   342 SEIVSVKEMRDIWSWIPERFALCQPLLLFSSLQHGYSLSRFYFQCEG-HEPTLLLIKTTQKEVCGAYLSTDWSERTKfgg 420
Cdd:smart00584   1 SSILSEEILALINSHLPTRAEGYPWTLLYSSSQHGYSLNTLYRKVEGyRPPTLLIIKDTDGEVFGAYASQAWRVSDH--- 77
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255522817   421 klgFFGTGECFVFRLQPEVQRYEWVVIKHpeltkatslksseaagssslishcssdpadrlspflaarhfnlpskteSMF 500
Cdd:smart00584  78 ---FYGTGESFLFQLNPKFVVYDWTGKNK------------------------------------------------YYY 106
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|....*....
gi 255522817   501 MAGGNDCLIIGGGGGQ-ALYVDGDLNRGRTGHCDTFNNQPLCS--ENFLIAAVEAWGFQ 556
Cdd:smart00584 107 INGTPDSLPIGGGGGGfGLWIDEDLNHGSSSHCKTFGNPPLSTkqEDFLILDIEVWGFG 165
RabGAP-TBC pfam00566
Rab-GTPase-TBC domain; Identification of a TBC domain in GYP6_YEAST and GYP7_YEAST, which are ...
48-253 4.56e-26

Rab-GTPase-TBC domain; Identification of a TBC domain in GYP6_YEAST and GYP7_YEAST, which are GTPase activator proteins of yeast Ypt6 and Ypt7, implies that these domains are GTPase activator proteins of Rab-like small GTPases.


:

Pssm-ID: 366170  Cd Length: 180  Bit Score: 105.03  E-value: 4.56e-26
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255522817   48 HTLRGKVYQRLIRDIpcrtvtpdasvYSDIvgkivgkhsSSSLPLPEFVDNTQvptyclntrGEGAVRKILLCIANQFPD 127
Cdd:pfam00566   1 DSLRGRVWPLLLSQI-----------RKDV---------PRTFPHSFFFDNGP---------GQNSLRRILKAYSIYNPD 51
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255522817  128 ISFCPALPAVVALLLHYSIDEAECFEKACRILSCNDPtKKLIDQSFLAFESSCMTFGDLVNKYCQAAHKLMVAVSEDVLQ 207
Cdd:pfam00566  52 VGYCQGMNFIAAPLLLVYLDEEDAFWCFVSLLENYLL-RDFYTPDFPGLKRDFYVFEELLKKYDPKLYKHLKELGLDPDL 130
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|....*...
gi 255522817  208 VYSDWQRWLF-GELPLNYFARVFDVFLvEGYKV-LYRVALAILKFFHK 253
Cdd:pfam00566 131 FATKWFLTLFaREFPLSTVLRIWDFLL-EGEKFvLFRVALAILKRFRE 177
 
Name Accession Description Interval E-value
TLDc smart00584
domain in TBC and LysM domain containing proteins;
342-556 1.08e-56

domain in TBC and LysM domain containing proteins;


Pssm-ID: 214733  Cd Length: 165  Bit Score: 187.53  E-value: 1.08e-56
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255522817   342 SEIVSVKEMRDIWSWIPERFALCQPLLLFSSLQHGYSLSRFYFQCEG-HEPTLLLIKTTQKEVCGAYLSTDWSERTKfgg 420
Cdd:smart00584   1 SSILSEEILALINSHLPTRAEGYPWTLLYSSSQHGYSLNTLYRKVEGyRPPTLLIIKDTDGEVFGAYASQAWRVSDH--- 77
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255522817   421 klgFFGTGECFVFRLQPEVQRYEWVVIKHpeltkatslksseaagssslishcssdpadrlspflaarhfnlpskteSMF 500
Cdd:smart00584  78 ---FYGTGESFLFQLNPKFVVYDWTGKNK------------------------------------------------YYY 106
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|....*....
gi 255522817   501 MAGGNDCLIIGGGGGQ-ALYVDGDLNRGRTGHCDTFNNQPLCS--ENFLIAAVEAWGFQ 556
Cdd:smart00584 107 INGTPDSLPIGGGGGGfGLWIDEDLNHGSSSHCKTFGNPPLSTkqEDFLILDIEVWGFG 165
RabGAP-TBC pfam00566
Rab-GTPase-TBC domain; Identification of a TBC domain in GYP6_YEAST and GYP7_YEAST, which are ...
48-253 4.56e-26

Rab-GTPase-TBC domain; Identification of a TBC domain in GYP6_YEAST and GYP7_YEAST, which are GTPase activator proteins of yeast Ypt6 and Ypt7, implies that these domains are GTPase activator proteins of Rab-like small GTPases.


Pssm-ID: 366170  Cd Length: 180  Bit Score: 105.03  E-value: 4.56e-26
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255522817   48 HTLRGKVYQRLIRDIpcrtvtpdasvYSDIvgkivgkhsSSSLPLPEFVDNTQvptyclntrGEGAVRKILLCIANQFPD 127
Cdd:pfam00566   1 DSLRGRVWPLLLSQI-----------RKDV---------PRTFPHSFFFDNGP---------GQNSLRRILKAYSIYNPD 51
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255522817  128 ISFCPALPAVVALLLHYSIDEAECFEKACRILSCNDPtKKLIDQSFLAFESSCMTFGDLVNKYCQAAHKLMVAVSEDVLQ 207
Cdd:pfam00566  52 VGYCQGMNFIAAPLLLVYLDEEDAFWCFVSLLENYLL-RDFYTPDFPGLKRDFYVFEELLKKYDPKLYKHLKELGLDPDL 130
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|....*...
gi 255522817  208 VYSDWQRWLF-GELPLNYFARVFDVFLvEGYKV-LYRVALAILKFFHK 253
Cdd:pfam00566 131 FATKWFLTLFaREFPLSTVLRIWDFLL-EGEKFvLFRVALAILKRFRE 177
TLD pfam07534
TLD; This domain is predicted to be an enzyme and is often found associated with pfam01476. It ...
370-555 1.86e-25

TLD; This domain is predicted to be an enzyme and is often found associated with pfam01476. It's structure consists of a beta-sandwich surrounded by two helices and two one-turn helices.


Pssm-ID: 400081  Cd Length: 136  Bit Score: 101.53  E-value: 1.86e-25
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255522817  370 FSSLQHGYSLSRFYFQCEGHEPTLLLIKTTQKEVCGAYLSTDWSERTKfggklGFFGTGECFVFRLQPEVQRYEWvvikh 449
Cdd:pfam07534   1 YSTSRDGRSYQTFYEKIDNKGPTLLIIKDNDGYIFGAFASQPWKVSGK-----KFYGDGSSFLFSLSPQFDPYKW----- 70
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255522817  450 peltkatslksseaagssslishcssdpadrlspflaarhfnlpSKTESMFMAGGNDCLIIGGGGGQ-ALYVDGDLNRGR 528
Cdd:pfam07534  71 --------------------------------------------TGKNNAYFNCTSDGLGFGGGQPKfDLWIDSDLEFGY 106
                         170       180       190
                  ....*....|....*....|....*....|
gi 255522817  529 TGHCDTFNNQPLCS---ENFLIAAVEAWGF 555
Cdd:pfam07534 107 SRHCETFGNGQLSGsgqERFKIDDVEVWGL 136
TBC smart00164
Domain in Tre-2, BUB2p, and Cdc16p. Probable Rab-GAPs; Widespread domain present in Gyp6 and ...
115-254 2.69e-13

Domain in Tre-2, BUB2p, and Cdc16p. Probable Rab-GAPs; Widespread domain present in Gyp6 and Gyp7, thereby giving rise to the notion that it performs a GTP-activator activity on Rab-like GTPases.


Pssm-ID: 214540  Cd Length: 216  Bit Score: 69.26  E-value: 2.69e-13
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255522817   115 RKILLCIANQFPDISFCPALPAVVALLLHYSIDEAECFEKACRIlsCNDPTKKLIDQSFLAFESSCMTFGDLVNKYCQAA 194
Cdd:smart00164  76 RRVLKAYALYNPEVGYCQGMNFLAAPLLLVMEDEEDAFWCLVKL--MERYGPNFYLPDMSGLQLDLLQLDRLVKEYDPDL 153
                           90       100       110       120       130       140
                   ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 255522817   195 HKLMVAVSEDVLQVYSDWQRWLFG-ELPLNYFARVFDVFLVEGYKVLYRVALAILKFFHKV 254
Cdd:smart00164 154 YKHLKDLGITPSLYALRWFLTLFArELPLEIVLRIWDVLFAEGSDFLFRVALALLKLHRDV 214
OXR1 COG5142
Oxidation resistance protein [DNA replication, recombination, and repair];
357-553 3.10e-07

Oxidation resistance protein [DNA replication, recombination, and repair];


Pssm-ID: 227471  Cd Length: 212  Bit Score: 51.05  E-value: 3.10e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255522817 357 IPERFALCQPL-LLFSSLQHGYSLSRFYFQCEGHE------PTLLLIKTTQKEVCGAYLStdwserTKFGGKLGFFGTGE 429
Cdd:COG5142   49 LPDRYKYSTSWrLLYSLFENGFSLRTFYESFGENEwpfrrvGFVLACRDKDGDLFGAFFE------DRIRPARHYYGRDE 122
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255522817 430 CFVFRLQpevqryewvviKHPeltkATSLKSSEAAGSsslishcssdpadrlsPFLAARHFNLPSKTEsmFMAGGndcli 509
Cdd:COG5142  123 MFLWKAA-----------RRP----ADRLADKEVAVY----------------PISGGKGFGIYCTPD--FLAFG----- 164
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|....*.
gi 255522817 510 iGGGGGQALYVDGDLNRGRTGHCDTFNNQPLCSEN--FLIAAVEAW 553
Cdd:COG5142  165 -CGGGRYGLLIDKSLLDGESHPVETFGNCLLSSKGhfFRIVYLELW 209
COG5210 COG5210
GTPase-activating protein [General function prediction only];
114-330 9.54e-06

GTPase-activating protein [General function prediction only];


Pssm-ID: 227535 [Multi-domain]  Cd Length: 496  Bit Score: 48.26  E-value: 9.54e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255522817 114 VRKILLCIANQFPDISFCPALPAVVALLLHYSIDEAECFEKACRILsCNDPTKKLIDQSFLAFESSCMTFGDLVNKYC-- 191
Cdd:COG5210  285 LRRVLKAYSLYNPEVGYVQGMNFLAAPLLLVLESEEQAFWCLVKLL-KNYGLPGYFLKNLSGLHRDLKVLDDLVEELDpe 363
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255522817 192 QAAHKLMVAVSEDVLQVYSdWQRWLFGELPLNYFARVFDVFLVEGYKVLYRVALAILKffhKVRAGQ-PLESDNVKQDIr 270
Cdd:COG5210  364 LYEHLLREGVVLLMFAFRW-FLTLFVREFPLEYALRIWDCLFLEGSSMLFQLALAILK---LLRDKLlKLDSDELLDLL- 438
                        170       180       190       200       210       220
                 ....*....|....*....|....*....|....*....|....*....|....*....|
gi 255522817 271 mFVKDIAKtvSPEKLLEKAFAIRLFSRKEIQLLQManekALRQKGITVKQKSVSLSKRQF 330
Cdd:COG5210  439 -LKQLFLH--SGKEAWSSILKFRHGTDRDILLFIE----DLLKKDITPTRYRSELREIQR 491
 
Name Accession Description Interval E-value
TLDc smart00584
domain in TBC and LysM domain containing proteins;
342-556 1.08e-56

domain in TBC and LysM domain containing proteins;


Pssm-ID: 214733  Cd Length: 165  Bit Score: 187.53  E-value: 1.08e-56
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255522817   342 SEIVSVKEMRDIWSWIPERFALCQPLLLFSSLQHGYSLSRFYFQCEG-HEPTLLLIKTTQKEVCGAYLSTDWSERTKfgg 420
Cdd:smart00584   1 SSILSEEILALINSHLPTRAEGYPWTLLYSSSQHGYSLNTLYRKVEGyRPPTLLIIKDTDGEVFGAYASQAWRVSDH--- 77
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255522817   421 klgFFGTGECFVFRLQPEVQRYEWVVIKHpeltkatslksseaagssslishcssdpadrlspflaarhfnlpskteSMF 500
Cdd:smart00584  78 ---FYGTGESFLFQLNPKFVVYDWTGKNK------------------------------------------------YYY 106
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|....*....
gi 255522817   501 MAGGNDCLIIGGGGGQ-ALYVDGDLNRGRTGHCDTFNNQPLCS--ENFLIAAVEAWGFQ 556
Cdd:smart00584 107 INGTPDSLPIGGGGGGfGLWIDEDLNHGSSSHCKTFGNPPLSTkqEDFLILDIEVWGFG 165
RabGAP-TBC pfam00566
Rab-GTPase-TBC domain; Identification of a TBC domain in GYP6_YEAST and GYP7_YEAST, which are ...
48-253 4.56e-26

Rab-GTPase-TBC domain; Identification of a TBC domain in GYP6_YEAST and GYP7_YEAST, which are GTPase activator proteins of yeast Ypt6 and Ypt7, implies that these domains are GTPase activator proteins of Rab-like small GTPases.


Pssm-ID: 366170  Cd Length: 180  Bit Score: 105.03  E-value: 4.56e-26
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255522817   48 HTLRGKVYQRLIRDIpcrtvtpdasvYSDIvgkivgkhsSSSLPLPEFVDNTQvptyclntrGEGAVRKILLCIANQFPD 127
Cdd:pfam00566   1 DSLRGRVWPLLLSQI-----------RKDV---------PRTFPHSFFFDNGP---------GQNSLRRILKAYSIYNPD 51
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255522817  128 ISFCPALPAVVALLLHYSIDEAECFEKACRILSCNDPtKKLIDQSFLAFESSCMTFGDLVNKYCQAAHKLMVAVSEDVLQ 207
Cdd:pfam00566  52 VGYCQGMNFIAAPLLLVYLDEEDAFWCFVSLLENYLL-RDFYTPDFPGLKRDFYVFEELLKKYDPKLYKHLKELGLDPDL 130
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|....*...
gi 255522817  208 VYSDWQRWLF-GELPLNYFARVFDVFLvEGYKV-LYRVALAILKFFHK 253
Cdd:pfam00566 131 FATKWFLTLFaREFPLSTVLRIWDFLL-EGEKFvLFRVALAILKRFRE 177
TLD pfam07534
TLD; This domain is predicted to be an enzyme and is often found associated with pfam01476. It ...
370-555 1.86e-25

TLD; This domain is predicted to be an enzyme and is often found associated with pfam01476. It's structure consists of a beta-sandwich surrounded by two helices and two one-turn helices.


Pssm-ID: 400081  Cd Length: 136  Bit Score: 101.53  E-value: 1.86e-25
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255522817  370 FSSLQHGYSLSRFYFQCEGHEPTLLLIKTTQKEVCGAYLSTDWSERTKfggklGFFGTGECFVFRLQPEVQRYEWvvikh 449
Cdd:pfam07534   1 YSTSRDGRSYQTFYEKIDNKGPTLLIIKDNDGYIFGAFASQPWKVSGK-----KFYGDGSSFLFSLSPQFDPYKW----- 70
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255522817  450 peltkatslksseaagssslishcssdpadrlspflaarhfnlpSKTESMFMAGGNDCLIIGGGGGQ-ALYVDGDLNRGR 528
Cdd:pfam07534  71 --------------------------------------------TGKNNAYFNCTSDGLGFGGGQPKfDLWIDSDLEFGY 106
                         170       180       190
                  ....*....|....*....|....*....|
gi 255522817  529 TGHCDTFNNQPLCS---ENFLIAAVEAWGF 555
Cdd:pfam07534 107 SRHCETFGNGQLSGsgqERFKIDDVEVWGL 136
TBC smart00164
Domain in Tre-2, BUB2p, and Cdc16p. Probable Rab-GAPs; Widespread domain present in Gyp6 and ...
115-254 2.69e-13

Domain in Tre-2, BUB2p, and Cdc16p. Probable Rab-GAPs; Widespread domain present in Gyp6 and Gyp7, thereby giving rise to the notion that it performs a GTP-activator activity on Rab-like GTPases.


Pssm-ID: 214540  Cd Length: 216  Bit Score: 69.26  E-value: 2.69e-13
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255522817   115 RKILLCIANQFPDISFCPALPAVVALLLHYSIDEAECFEKACRIlsCNDPTKKLIDQSFLAFESSCMTFGDLVNKYCQAA 194
Cdd:smart00164  76 RRVLKAYALYNPEVGYCQGMNFLAAPLLLVMEDEEDAFWCLVKL--MERYGPNFYLPDMSGLQLDLLQLDRLVKEYDPDL 153
                           90       100       110       120       130       140
                   ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 255522817   195 HKLMVAVSEDVLQVYSDWQRWLFG-ELPLNYFARVFDVFLVEGYKVLYRVALAILKFFHKV 254
Cdd:smart00164 154 YKHLKDLGITPSLYALRWFLTLFArELPLEIVLRIWDVLFAEGSDFLFRVALALLKLHRDV 214
OXR1 COG5142
Oxidation resistance protein [DNA replication, recombination, and repair];
357-553 3.10e-07

Oxidation resistance protein [DNA replication, recombination, and repair];


Pssm-ID: 227471  Cd Length: 212  Bit Score: 51.05  E-value: 3.10e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255522817 357 IPERFALCQPL-LLFSSLQHGYSLSRFYFQCEGHE------PTLLLIKTTQKEVCGAYLStdwserTKFGGKLGFFGTGE 429
Cdd:COG5142   49 LPDRYKYSTSWrLLYSLFENGFSLRTFYESFGENEwpfrrvGFVLACRDKDGDLFGAFFE------DRIRPARHYYGRDE 122
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255522817 430 CFVFRLQpevqryewvviKHPeltkATSLKSSEAAGSsslishcssdpadrlsPFLAARHFNLPSKTEsmFMAGGndcli 509
Cdd:COG5142  123 MFLWKAA-----------RRP----ADRLADKEVAVY----------------PISGGKGFGIYCTPD--FLAFG----- 164
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|....*.
gi 255522817 510 iGGGGGQALYVDGDLNRGRTGHCDTFNNQPLCSEN--FLIAAVEAW 553
Cdd:COG5142  165 -CGGGRYGLLIDKSLLDGESHPVETFGNCLLSSKGhfFRIVYLELW 209
COG5210 COG5210
GTPase-activating protein [General function prediction only];
114-330 9.54e-06

GTPase-activating protein [General function prediction only];


Pssm-ID: 227535 [Multi-domain]  Cd Length: 496  Bit Score: 48.26  E-value: 9.54e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255522817 114 VRKILLCIANQFPDISFCPALPAVVALLLHYSIDEAECFEKACRILsCNDPTKKLIDQSFLAFESSCMTFGDLVNKYC-- 191
Cdd:COG5210  285 LRRVLKAYSLYNPEVGYVQGMNFLAAPLLLVLESEEQAFWCLVKLL-KNYGLPGYFLKNLSGLHRDLKVLDDLVEELDpe 363
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 255522817 192 QAAHKLMVAVSEDVLQVYSdWQRWLFGELPLNYFARVFDVFLVEGYKVLYRVALAILKffhKVRAGQ-PLESDNVKQDIr 270
Cdd:COG5210  364 LYEHLLREGVVLLMFAFRW-FLTLFVREFPLEYALRIWDCLFLEGSSMLFQLALAILK---LLRDKLlKLDSDELLDLL- 438
                        170       180       190       200       210       220
                 ....*....|....*....|....*....|....*....|....*....|....*....|
gi 255522817 271 mFVKDIAKtvSPEKLLEKAFAIRLFSRKEIQLLQManekALRQKGITVKQKSVSLSKRQF 330
Cdd:COG5210  439 -LKQLFLH--SGKEAWSSILKFRHGTDRDILLFIE----DLLKKDITPTRYRSELREIQR 491
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH