NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|291575188|ref|NP_001167565|]
View 

zinc finger E-box-binding homeobox 1 isoform d [Homo sapiens]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
zf-H2C2_2 pfam13465
Zinc-finger double domain;
929-954 4.23e-07

Zinc-finger double domain;


:

Pssm-ID: 404364 [Multi-domain]  Cd Length: 26  Bit Score: 46.96  E-value: 4.23e-07
                           10        20
                   ....*....|....*....|....*.
gi 291575188   929 HLIEHMRLHSGEKPYQCDKCGKRFSH 954
Cdd:pfam13465    1 NLKRHMRKHTGEKPYKCPECGKSFKS 26
zf-H2C2_2 pfam13465
Zinc-finger double domain;
237-260 7.98e-07

Zinc-finger double domain;


:

Pssm-ID: 404364 [Multi-domain]  Cd Length: 26  Bit Score: 46.19  E-value: 7.98e-07
                           10        20
                   ....*....|....*....|....
gi 291575188   237 HLKEHLRIHSGEKPYECPNCKKRF 260
Cdd:pfam13465    1 NLKRHMRKHTGEKPYKCPECGKSF 24
zf-C2H2 pfam00096
Zinc finger, C2H2 type; The C2H2 zinc finger is the classical zinc finger domain. The two ...
223-245 3.73e-06

Zinc finger, C2H2 type; The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter.


:

Pssm-ID: 395048 [Multi-domain]  Cd Length: 23  Bit Score: 44.21  E-value: 3.73e-06
                           10        20
                   ....*....|....*....|...
gi 291575188   223 FKCTECGKAFKYKHHLKEHLRIH 245
Cdd:pfam00096    1 YKCPDCGKSFSRKSNLKRHLRTH 23
zf-C2H2 pfam00096
Zinc finger, C2H2 type; The C2H2 zinc finger is the classical zinc finger domain. The two ...
915-937 3.15e-05

Zinc finger, C2H2 type; The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter.


:

Pssm-ID: 395048 [Multi-domain]  Cd Length: 23  Bit Score: 41.52  E-value: 3.15e-05
                           10        20
                   ....*....|....*....|...
gi 291575188   915 HECGICKKAFKHKHHLIEHMRLH 937
Cdd:pfam00096    1 YKCPDCGKSFSRKSNLKRHLRTH 23
zf-H2C2_2 pfam13465
Zinc-finger double domain;
901-926 6.31e-05

Zinc-finger double domain;


:

Pssm-ID: 404364 [Multi-domain]  Cd Length: 26  Bit Score: 40.80  E-value: 6.31e-05
                           10        20
                   ....*....|....*....|....*.
gi 291575188   901 SLLRHKYEHTGKRPHECGICKKAFKH 926
Cdd:pfam13465    1 NLKRHMRKHTGEKPYKCPECGKSFKS 26
MDN1 super family cl34967
Midasin, AAA ATPase with vWA domain, involved in ribosome maturation [Translation, ribosomal ...
1-180 4.49e-04

Midasin, AAA ATPase with vWA domain, involved in ribosome maturation [Translation, ribosomal structure and biogenesis];


The actual alignment was detected with superfamily member COG5271:

Pssm-ID: 227596 [Multi-domain]  Cd Length: 4600  Bit Score: 44.60  E-value: 4.49e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291575188    1 MKVTNYNTVVETNSDSDDEDKLHIVEEESVTDAADCEGVPEDDLPTDQTVLPgrSSEREGNAKNCWEDDRKEGQEilGPE 80
Cdd:COG5271  3993 LKLDEKEGDVSKDSDLEDMDMEAADENKEEADAEKDEPMQDEDPLEENNTLD--EDIQQDDFSDLAEDDEKMNED--GFE 4068
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291575188   81 AQADEAGCTVKDDeCESDAENEQNHDPNVEEF--LQQQDTAVIFPEApEEDQRQGTPEASGHDE----------NGTPD- 147
Cdd:COG5271  4069 ENVQENEESTEDG-VKSDEELEQGEVPEDQAIdnHPKMDAKSTFASA-EADEENTDKGIVGENEelgeedgvrgNGTADg 4146
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|.
gi 291575188  148 AFSQL---LTCPY-----CDRGYKrftSLKEHIKYRHEKNE 180
Cdd:COG5271  4147 EFEQVqedTSTPKeamseADRQYQ---SLGDHLREWQQANR 4184
homeodomain super family cl00084
Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic ...
564-612 6.83e-04

Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner.


The actual alignment was detected with superfamily member pfam00046:

Pssm-ID: 412151  Cd Length: 55  Bit Score: 38.63  E-value: 6.83e-04
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|....*....
gi 291575188   564 NLSPSQpplknlLSLLKAYYALNAQPSAEELSKIADSVNLPLDVVKKWF 612
Cdd:pfam00046    4 TFTPEQ------LEELEKEFQKNPYPSREEREELAAQLGLTERQVKVWF 46
zf-C2H2 pfam00096
Zinc finger, C2H2 type; The C2H2 zinc finger is the classical zinc finger domain. The two ...
183-205 4.33e-03

Zinc finger, C2H2 type; The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter.


:

Pssm-ID: 395048 [Multi-domain]  Cd Length: 23  Bit Score: 35.74  E-value: 4.33e-03
                           10        20
                   ....*....|....*....|...
gi 291575188   183 FSCSLCSYTFAYRTQLERHMTSH 205
Cdd:pfam00096    1 YKCPDCGKSFSRKSNLKRHLRTH 23
 
Name Accession Description Interval E-value
zf-H2C2_2 pfam13465
Zinc-finger double domain;
929-954 4.23e-07

Zinc-finger double domain;


Pssm-ID: 404364 [Multi-domain]  Cd Length: 26  Bit Score: 46.96  E-value: 4.23e-07
                           10        20
                   ....*....|....*....|....*.
gi 291575188   929 HLIEHMRLHSGEKPYQCDKCGKRFSH 954
Cdd:pfam13465    1 NLKRHMRKHTGEKPYKCPECGKSFKS 26
zf-H2C2_2 pfam13465
Zinc-finger double domain;
237-260 7.98e-07

Zinc-finger double domain;


Pssm-ID: 404364 [Multi-domain]  Cd Length: 26  Bit Score: 46.19  E-value: 7.98e-07
                           10        20
                   ....*....|....*....|....
gi 291575188   237 HLKEHLRIHSGEKPYECPNCKKRF 260
Cdd:pfam13465    1 NLKRHMRKHTGEKPYKCPECGKSF 24
zf-C2H2 pfam00096
Zinc finger, C2H2 type; The C2H2 zinc finger is the classical zinc finger domain. The two ...
223-245 3.73e-06

Zinc finger, C2H2 type; The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter.


Pssm-ID: 395048 [Multi-domain]  Cd Length: 23  Bit Score: 44.21  E-value: 3.73e-06
                           10        20
                   ....*....|....*....|...
gi 291575188   223 FKCTECGKAFKYKHHLKEHLRIH 245
Cdd:pfam00096    1 YKCPDCGKSFSRKSNLKRHLRTH 23
zf-C2H2 pfam00096
Zinc finger, C2H2 type; The C2H2 zinc finger is the classical zinc finger domain. The two ...
915-937 3.15e-05

Zinc finger, C2H2 type; The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter.


Pssm-ID: 395048 [Multi-domain]  Cd Length: 23  Bit Score: 41.52  E-value: 3.15e-05
                           10        20
                   ....*....|....*....|...
gi 291575188   915 HECGICKKAFKHKHHLIEHMRLH 937
Cdd:pfam00096    1 YKCPDCGKSFSRKSNLKRHLRTH 23
zf-H2C2_2 pfam13465
Zinc-finger double domain;
901-926 6.31e-05

Zinc-finger double domain;


Pssm-ID: 404364 [Multi-domain]  Cd Length: 26  Bit Score: 40.80  E-value: 6.31e-05
                           10        20
                   ....*....|....*....|....*.
gi 291575188   901 SLLRHKYEHTGKRPHECGICKKAFKH 926
Cdd:pfam13465    1 NLKRHMRKHTGEKPYKCPECGKSFKS 26
ZnF_C2H2 smart00355
zinc finger;
223-245 4.04e-04

zinc finger;


Pssm-ID: 197676  Cd Length: 23  Bit Score: 38.60  E-value: 4.04e-04
                            10        20
                    ....*....|....*....|...
gi 291575188    223 FKCTECGKAFKYKHHLKEHLRIH 245
Cdd:smart00355    1 YRCPECGKVFKSKSALREHMRTH 23
MDN1 COG5271
Midasin, AAA ATPase with vWA domain, involved in ribosome maturation [Translation, ribosomal ...
1-180 4.49e-04

Midasin, AAA ATPase with vWA domain, involved in ribosome maturation [Translation, ribosomal structure and biogenesis];


Pssm-ID: 227596 [Multi-domain]  Cd Length: 4600  Bit Score: 44.60  E-value: 4.49e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291575188    1 MKVTNYNTVVETNSDSDDEDKLHIVEEESVTDAADCEGVPEDDLPTDQTVLPgrSSEREGNAKNCWEDDRKEGQEilGPE 80
Cdd:COG5271  3993 LKLDEKEGDVSKDSDLEDMDMEAADENKEEADAEKDEPMQDEDPLEENNTLD--EDIQQDDFSDLAEDDEKMNED--GFE 4068
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291575188   81 AQADEAGCTVKDDeCESDAENEQNHDPNVEEF--LQQQDTAVIFPEApEEDQRQGTPEASGHDE----------NGTPD- 147
Cdd:COG5271  4069 ENVQENEESTEDG-VKSDEELEQGEVPEDQAIdnHPKMDAKSTFASA-EADEENTDKGIVGENEelgeedgvrgNGTADg 4146
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|.
gi 291575188  148 AFSQL---LTCPY-----CDRGYKrftSLKEHIKYRHEKNE 180
Cdd:COG5271  4147 EFEQVqedTSTPKeamseADRQYQ---SLGDHLREWQQANR 4184
Homeobox pfam00046
Homeobox domain;
564-612 6.83e-04

Homeobox domain;


Pssm-ID: 395001  Cd Length: 55  Bit Score: 38.63  E-value: 6.83e-04
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|....*....
gi 291575188   564 NLSPSQpplknlLSLLKAYYALNAQPSAEELSKIADSVNLPLDVVKKWF 612
Cdd:pfam00046    4 TFTPEQ------LEELEKEFQKNPYPSREEREELAAQLGLTERQVKVWF 46
GET2 pfam08690
GET complex subunit GET2; This family corresponds to the GET complex subunit GET2. The GET ...
43-153 2.45e-03

GET complex subunit GET2; This family corresponds to the GET complex subunit GET2. The GET complex is involved in the retrieval of ER resident proteins from the Golgi.


Pssm-ID: 400847  Cd Length: 308  Bit Score: 41.23  E-value: 2.45e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291575188    43 DLPTDQTVLPgrSSEREGNAKNCWEDDRKEGQEILGPEAQADEAGCTVKDDECESDAENEqnhDPNVEEFLQQQDTAvif 122
Cdd:pfam08690   45 DEPAAPSTTP--ASTTASSSPSADEHDDPEIVDISEIASQPKKTASVPKKPPSSEESDPE---NPQLDQMFKQLLGQ--- 116
                           90       100       110
                   ....*....|....*....|....*....|.
gi 291575188   123 peapeedQRQGTPEASGHDENGTPDAFSQLL 153
Cdd:pfam08690  117 -------QQQGGGENGQPAGSSTPDLFSQMM 140
ZnF_C2H2 smart00355
zinc finger;
915-937 2.46e-03

zinc finger;


Pssm-ID: 197676  Cd Length: 23  Bit Score: 36.29  E-value: 2.46e-03
                            10        20
                    ....*....|....*....|...
gi 291575188    915 HECGICKKAFKHKHHLIEHMRLH 937
Cdd:smart00355    1 YRCPECGKVFKSKSALREHMRTH 23
zf-C2H2 pfam00096
Zinc finger, C2H2 type; The C2H2 zinc finger is the classical zinc finger domain. The two ...
183-205 4.33e-03

Zinc finger, C2H2 type; The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter.


Pssm-ID: 395048 [Multi-domain]  Cd Length: 23  Bit Score: 35.74  E-value: 4.33e-03
                           10        20
                   ....*....|....*....|...
gi 291575188   183 FSCSLCSYTFAYRTQLERHMTSH 205
Cdd:pfam00096    1 YKCPDCGKSFSRKSNLKRHLRTH 23
ZnF_C2H2 smart00355
zinc finger;
183-205 5.39e-03

zinc finger;


Pssm-ID: 197676  Cd Length: 23  Bit Score: 35.13  E-value: 5.39e-03
                            10        20
                    ....*....|....*....|...
gi 291575188    183 FSCSLCSYTFAYRTQLERHMTSH 205
Cdd:smart00355    1 YRCPECGKVFKSKSALREHMRTH 23
 
Name Accession Description Interval E-value
zf-H2C2_2 pfam13465
Zinc-finger double domain;
929-954 4.23e-07

Zinc-finger double domain;


Pssm-ID: 404364 [Multi-domain]  Cd Length: 26  Bit Score: 46.96  E-value: 4.23e-07
                           10        20
                   ....*....|....*....|....*.
gi 291575188   929 HLIEHMRLHSGEKPYQCDKCGKRFSH 954
Cdd:pfam13465    1 NLKRHMRKHTGEKPYKCPECGKSFKS 26
zf-H2C2_2 pfam13465
Zinc-finger double domain;
237-260 7.98e-07

Zinc-finger double domain;


Pssm-ID: 404364 [Multi-domain]  Cd Length: 26  Bit Score: 46.19  E-value: 7.98e-07
                           10        20
                   ....*....|....*....|....
gi 291575188   237 HLKEHLRIHSGEKPYECPNCKKRF 260
Cdd:pfam13465    1 NLKRHMRKHTGEKPYKCPECGKSF 24
zf-C2H2 pfam00096
Zinc finger, C2H2 type; The C2H2 zinc finger is the classical zinc finger domain. The two ...
223-245 3.73e-06

Zinc finger, C2H2 type; The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter.


Pssm-ID: 395048 [Multi-domain]  Cd Length: 23  Bit Score: 44.21  E-value: 3.73e-06
                           10        20
                   ....*....|....*....|...
gi 291575188   223 FKCTECGKAFKYKHHLKEHLRIH 245
Cdd:pfam00096    1 YKCPDCGKSFSRKSNLKRHLRTH 23
zf-C2H2 pfam00096
Zinc finger, C2H2 type; The C2H2 zinc finger is the classical zinc finger domain. The two ...
915-937 3.15e-05

Zinc finger, C2H2 type; The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter.


Pssm-ID: 395048 [Multi-domain]  Cd Length: 23  Bit Score: 41.52  E-value: 3.15e-05
                           10        20
                   ....*....|....*....|...
gi 291575188   915 HECGICKKAFKHKHHLIEHMRLH 937
Cdd:pfam00096    1 YKCPDCGKSFSRKSNLKRHLRTH 23
zf-H2C2_2 pfam13465
Zinc-finger double domain;
901-926 6.31e-05

Zinc-finger double domain;


Pssm-ID: 404364 [Multi-domain]  Cd Length: 26  Bit Score: 40.80  E-value: 6.31e-05
                           10        20
                   ....*....|....*....|....*.
gi 291575188   901 SLLRHKYEHTGKRPHECGICKKAFKH 926
Cdd:pfam13465    1 NLKRHMRKHTGEKPYKCPECGKSFKS 26
ZnF_C2H2 smart00355
zinc finger;
223-245 4.04e-04

zinc finger;


Pssm-ID: 197676  Cd Length: 23  Bit Score: 38.60  E-value: 4.04e-04
                            10        20
                    ....*....|....*....|...
gi 291575188    223 FKCTECGKAFKYKHHLKEHLRIH 245
Cdd:smart00355    1 YRCPECGKVFKSKSALREHMRTH 23
MDN1 COG5271
Midasin, AAA ATPase with vWA domain, involved in ribosome maturation [Translation, ribosomal ...
1-180 4.49e-04

Midasin, AAA ATPase with vWA domain, involved in ribosome maturation [Translation, ribosomal structure and biogenesis];


Pssm-ID: 227596 [Multi-domain]  Cd Length: 4600  Bit Score: 44.60  E-value: 4.49e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291575188    1 MKVTNYNTVVETNSDSDDEDKLHIVEEESVTDAADCEGVPEDDLPTDQTVLPgrSSEREGNAKNCWEDDRKEGQEilGPE 80
Cdd:COG5271  3993 LKLDEKEGDVSKDSDLEDMDMEAADENKEEADAEKDEPMQDEDPLEENNTLD--EDIQQDDFSDLAEDDEKMNED--GFE 4068
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291575188   81 AQADEAGCTVKDDeCESDAENEQNHDPNVEEF--LQQQDTAVIFPEApEEDQRQGTPEASGHDE----------NGTPD- 147
Cdd:COG5271  4069 ENVQENEESTEDG-VKSDEELEQGEVPEDQAIdnHPKMDAKSTFASA-EADEENTDKGIVGENEelgeedgvrgNGTADg 4146
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|.
gi 291575188  148 AFSQL---LTCPY-----CDRGYKrftSLKEHIKYRHEKNE 180
Cdd:COG5271  4147 EFEQVqedTSTPKeamseADRQYQ---SLGDHLREWQQANR 4184
Homeobox pfam00046
Homeobox domain;
564-612 6.83e-04

Homeobox domain;


Pssm-ID: 395001  Cd Length: 55  Bit Score: 38.63  E-value: 6.83e-04
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|....*....
gi 291575188   564 NLSPSQpplknlLSLLKAYYALNAQPSAEELSKIADSVNLPLDVVKKWF 612
Cdd:pfam00046    4 TFTPEQ------LEELEKEFQKNPYPSREEREELAAQLGLTERQVKVWF 46
GET2 pfam08690
GET complex subunit GET2; This family corresponds to the GET complex subunit GET2. The GET ...
43-153 2.45e-03

GET complex subunit GET2; This family corresponds to the GET complex subunit GET2. The GET complex is involved in the retrieval of ER resident proteins from the Golgi.


Pssm-ID: 400847  Cd Length: 308  Bit Score: 41.23  E-value: 2.45e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291575188    43 DLPTDQTVLPgrSSEREGNAKNCWEDDRKEGQEILGPEAQADEAGCTVKDDECESDAENEqnhDPNVEEFLQQQDTAvif 122
Cdd:pfam08690   45 DEPAAPSTTP--ASTTASSSPSADEHDDPEIVDISEIASQPKKTASVPKKPPSSEESDPE---NPQLDQMFKQLLGQ--- 116
                           90       100       110
                   ....*....|....*....|....*....|.
gi 291575188   123 peapeedQRQGTPEASGHDENGTPDAFSQLL 153
Cdd:pfam08690  117 -------QQQGGGENGQPAGSSTPDLFSQMM 140
ZnF_C2H2 smart00355
zinc finger;
915-937 2.46e-03

zinc finger;


Pssm-ID: 197676  Cd Length: 23  Bit Score: 36.29  E-value: 2.46e-03
                            10        20
                    ....*....|....*....|...
gi 291575188    915 HECGICKKAFKHKHHLIEHMRLH 937
Cdd:smart00355    1 YRCPECGKVFKSKSALREHMRTH 23
zf-C2H2_4 pfam13894
C2H2-type zinc finger; This family contains a number of divergent C2H2 type zinc fingers.
223-245 4.15e-03

C2H2-type zinc finger; This family contains a number of divergent C2H2 type zinc fingers.


Pssm-ID: 404733  Cd Length: 24  Bit Score: 35.70  E-value: 4.15e-03
                           10        20
                   ....*....|....*....|...
gi 291575188   223 FKCTECGKAFKYKHHLKEHLRIH 245
Cdd:pfam13894    1 FKCPICGKSFSSKKSLKRHLKTH 23
zf-C2H2 pfam00096
Zinc finger, C2H2 type; The C2H2 zinc finger is the classical zinc finger domain. The two ...
943-963 4.24e-03

Zinc finger, C2H2 type; The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter.


Pssm-ID: 395048 [Multi-domain]  Cd Length: 23  Bit Score: 35.74  E-value: 4.24e-03
                           10        20
                   ....*....|....*....|.
gi 291575188   943 YQCDKCGKRFSHSGSYSQHMN 963
Cdd:pfam00096    1 YKCPDCGKSFSRKSNLKRHLR 21
zf-C2H2 pfam00096
Zinc finger, C2H2 type; The C2H2 zinc finger is the classical zinc finger domain. The two ...
183-205 4.33e-03

Zinc finger, C2H2 type; The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter.


Pssm-ID: 395048 [Multi-domain]  Cd Length: 23  Bit Score: 35.74  E-value: 4.33e-03
                           10        20
                   ....*....|....*....|...
gi 291575188   183 FSCSLCSYTFAYRTQLERHMTSH 205
Cdd:pfam00096    1 YKCPDCGKSFSRKSNLKRHLRTH 23
ZnF_C2H2 smart00355
zinc finger;
183-205 5.39e-03

zinc finger;


Pssm-ID: 197676  Cd Length: 23  Bit Score: 35.13  E-value: 5.39e-03
                            10        20
                    ....*....|....*....|...
gi 291575188    183 FSCSLCSYTFAYRTQLERHMTSH 205
Cdd:smart00355    1 YRCPECGKVFKSKSALREHMRTH 23
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH