NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|295444948|ref|NP_001171368|]
View 

RIKEN cDNA 9830107B12 isoform 3 precursor [Mus musculus]

Protein Classification

immunoglobulin domain-containing protein (domain architecture ID 10542315)

immunoglobulin (Ig) domain-containing protein adopts a fold comprised of a sandwich of two beta sheets, similar to Homo sapiens T-cell antigen CD7 and voltage-gated sodium channel beta3 subunit Ig Domain

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
V-set pfam07686
Immunoglobulin V-set domain; This domain is found in antibodies as well as neural protein P0 ...
20-72 1.43e-10

Immunoglobulin V-set domain; This domain is found in antibodies as well as neural protein P0 and CTL4 amongst others.


:

Pssm-ID: 400157  Cd Length: 109  Bit Score: 54.77  E-value: 1.43e-10
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|...
gi 295444948   20 GAEKPRFSILQSSKFNFFTVTMSKLRMSDSGIYHCGIAANTRITYLRGIQLVV 72
Cdd:pfam07686  56 GKKKGRFSLRGDPSNSDGSLTIQNLTLSDSGTYTCAVIPSGEGVFGKGTRLTV 108
 
Name Accession Description Interval E-value
V-set pfam07686
Immunoglobulin V-set domain; This domain is found in antibodies as well as neural protein P0 ...
20-72 1.43e-10

Immunoglobulin V-set domain; This domain is found in antibodies as well as neural protein P0 and CTL4 amongst others.


Pssm-ID: 400157  Cd Length: 109  Bit Score: 54.77  E-value: 1.43e-10
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|...
gi 295444948   20 GAEKPRFSILQSSKFNFFTVTMSKLRMSDSGIYHCGIAANTRITYLRGIQLVV 72
Cdd:pfam07686  56 GKKKGRFSLRGDPSNSDGSLTIQNLTLSDSGTYTCAVIPSGEGVFGKGTRLTV 108
IG smart00409
Immunoglobulin;
21-72 7.23e-06

Immunoglobulin;


Pssm-ID: 214652  Cd Length: 85  Bit Score: 41.72  E-value: 7.23e-06
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|..
gi 295444948    21 AEKPRFSILQSSkfNFFTVTMSKLRMSDSGIYHCgIAANTRITYLRGIQLVV 72
Cdd:smart00409  37 AESGRFSVSRSG--STSTLTISNVTPEDSGTYTC-AATNSSGSASSGTTLTV 85
IgV_pIgR_like cd05716
Immunoglobulin (Ig)-like domain in the polymeric Ig receptor (pIgR) and similar proteins; The ...
22-73 3.18e-05

Immunoglobulin (Ig)-like domain in the polymeric Ig receptor (pIgR) and similar proteins; The members here are composed of the immunoglobulin (Ig)-like domain in the polymeric Ig receptor (pIgR) and similar proteins. pIgR delivers dimeric IgA and pentameric IgM to mucosal secretions. Polymeric immunoglobulin (pIgs) are the first defense against pathogens and toxins. IgA and IgM can form polymers via an 18-residue extension at their C-termini referred to as the tailpiece. pIgR transports pIgs across mucosal epithelia into mucosal secretions. Human pIgR is a glycosylated type I transmembrane protein, comprised of a 620-residue extracellular region, a 23-residue transmembrane region, and a 103-residue cytoplasmic tail. The extracellular region contains five domains that share sequence similarity with Ig variable (v) regions. This group also contains the Ig-like extracellular domains of other receptors such as NK cell receptor Nkp44 and myeloid receptors, among others.


Pssm-ID: 409381  Cd Length: 100  Bit Score: 40.46  E-value: 3.18e-05
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|..
gi 295444948  22 EKPRFSILQSSKFNFFTVTMSKLRMSDSGIYHCGIaaNTRITYLRGIQLVVS 73
Cdd:cd05716   51 PGGRISLTDDPDNGVFTVTLNQLRKEDAGWYWCGV--GDDGDRGLTVQVKLV 100
 
Name Accession Description Interval E-value
V-set pfam07686
Immunoglobulin V-set domain; This domain is found in antibodies as well as neural protein P0 ...
20-72 1.43e-10

Immunoglobulin V-set domain; This domain is found in antibodies as well as neural protein P0 and CTL4 amongst others.


Pssm-ID: 400157  Cd Length: 109  Bit Score: 54.77  E-value: 1.43e-10
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|...
gi 295444948   20 GAEKPRFSILQSSKFNFFTVTMSKLRMSDSGIYHCGIAANTRITYLRGIQLVV 72
Cdd:pfam07686  56 GKKKGRFSLRGDPSNSDGSLTIQNLTLSDSGTYTCAVIPSGEGVFGKGTRLTV 108
IG smart00409
Immunoglobulin;
21-72 7.23e-06

Immunoglobulin;


Pssm-ID: 214652  Cd Length: 85  Bit Score: 41.72  E-value: 7.23e-06
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|..
gi 295444948    21 AEKPRFSILQSSkfNFFTVTMSKLRMSDSGIYHCgIAANTRITYLRGIQLVV 72
Cdd:smart00409  37 AESGRFSVSRSG--STSTLTISNVTPEDSGTYTC-AATNSSGSASSGTTLTV 85
IG_like smart00410
Immunoglobulin like; IG domains that cannot be classified into one of IGv1, IGc1, IGc2, IG.
21-72 7.23e-06

Immunoglobulin like; IG domains that cannot be classified into one of IGv1, IGc1, IGc2, IG.


Pssm-ID: 214653  Cd Length: 85  Bit Score: 41.72  E-value: 7.23e-06
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|..
gi 295444948    21 AEKPRFSILQSSkfNFFTVTMSKLRMSDSGIYHCgIAANTRITYLRGIQLVV 72
Cdd:smart00410  37 AESGRFSVSRSG--STSTLTISNVTPEDSGTYTC-AATNSSGSASSGTTLTV 85
IgV_pIgR_like cd05716
Immunoglobulin (Ig)-like domain in the polymeric Ig receptor (pIgR) and similar proteins; The ...
22-73 3.18e-05

Immunoglobulin (Ig)-like domain in the polymeric Ig receptor (pIgR) and similar proteins; The members here are composed of the immunoglobulin (Ig)-like domain in the polymeric Ig receptor (pIgR) and similar proteins. pIgR delivers dimeric IgA and pentameric IgM to mucosal secretions. Polymeric immunoglobulin (pIgs) are the first defense against pathogens and toxins. IgA and IgM can form polymers via an 18-residue extension at their C-termini referred to as the tailpiece. pIgR transports pIgs across mucosal epithelia into mucosal secretions. Human pIgR is a glycosylated type I transmembrane protein, comprised of a 620-residue extracellular region, a 23-residue transmembrane region, and a 103-residue cytoplasmic tail. The extracellular region contains five domains that share sequence similarity with Ig variable (v) regions. This group also contains the Ig-like extracellular domains of other receptors such as NK cell receptor Nkp44 and myeloid receptors, among others.


Pssm-ID: 409381  Cd Length: 100  Bit Score: 40.46  E-value: 3.18e-05
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|..
gi 295444948  22 EKPRFSILQSSKFNFFTVTMSKLRMSDSGIYHCGIaaNTRITYLRGIQLVVS 73
Cdd:cd05716   51 PGGRISLTDDPDNGVFTVTLNQLRKEDAGWYWCGV--GDDGDRGLTVQVKLV 100
IGv smart00406
Immunoglobulin V-Type;
23-54 1.09e-04

Immunoglobulin V-Type;


Pssm-ID: 214650  Cd Length: 81  Bit Score: 38.52  E-value: 1.09e-04
                           10        20        30
                   ....*....|....*....|....*....|..
gi 295444948    23 KPRFSILQSSKFNFFTVTMSKLRMSDSGIYHC 54
Cdd:smart00406  48 KGRFTISKDTSKNDVSLTISNLRVEDTGTYYC 79
IgV_CD8_beta cd07700
Immunoglobulin (Ig) variable (V) domain of Cluster of Differentiation (CD) 8 beta chain; The ...
20-72 2.35e-03

Immunoglobulin (Ig) variable (V) domain of Cluster of Differentiation (CD) 8 beta chain; The members here are composed of the immunoglobulin (Ig)-like domain in Cluster of Differentiation (CD) 8 beta. The CD8 glycoprotein plays an essential role in the control of T-cell selection, maturation, and the T-cell receptor (TCR)-mediated response to peptide antigen. CD8 is comprised of alpha and beta subunits and is expressed as either an alpha/alpha or alpha/beta dimer. Both dimeric isoforms can serve as a coreceptor for T cell activation and differentiation, however they have distinct physiological roles, different cellular distributions, unique binding partners, etc. Each CD8 subunit is comprised of an extracellular domain containing a V-type Ig-like domain, a single pass transmembrane portion, and a short intracellular domain. Members of this group contain standard Ig superfamily V-set AGFCC'C"/DEB domain topology.


Pssm-ID: 409497  Cd Length: 116  Bit Score: 35.50  E-value: 2.35e-03
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|...
gi 295444948  20 GAEKPRFSILQSSKFNFFTVTMSKLRMSDSGIYHCGIAANTRITYLRGIQLVV 72
Cdd:cd07700   63 GVDQEKLIILSDSDSSRYILSLMSVKPEDSGTYFCMTVGSPELIFGTGTKLSV 115
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH