NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|594346510|ref|NP_001277481|]
View 

DNA repair protein SWI5 homolog isoform a [Mus musculus]

Protein Classification

Swi5 domain-containing protein (domain architecture ID 10537184)

Swi5 domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Swi5 pfam07061
Swi5; Swi5 is involved in meiotic DNA repair synthesis and meiotic joint molecule formation. ...
45-120 2.42e-27

Swi5; Swi5 is involved in meiotic DNA repair synthesis and meiotic joint molecule formation. It is known to interact with Swi2, Rhp51 and Swi6.


:

Pssm-ID: 399800  Cd Length: 79  Bit Score: 96.09  E-value: 2.42e-27
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 594346510   45 LSSDIKKLKEKHDMLDKEISQLIAEGY---RVIELEKHISLLHEYNDIKDVSQMLLGKLAVTRGVTTKELYPDFDLNLN 120
Cdd:pfam07061   1 LEAEIAELEAQLEELEKELAELKAELKnpdPKETVKRHIKLLHEYNEIKDVGQGLIGLIADERGVTIKEVYEEFGVEMN 79
 
Name Accession Description Interval E-value
Swi5 pfam07061
Swi5; Swi5 is involved in meiotic DNA repair synthesis and meiotic joint molecule formation. ...
45-120 2.42e-27

Swi5; Swi5 is involved in meiotic DNA repair synthesis and meiotic joint molecule formation. It is known to interact with Swi2, Rhp51 and Swi6.


Pssm-ID: 399800  Cd Length: 79  Bit Score: 96.09  E-value: 2.42e-27
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 594346510   45 LSSDIKKLKEKHDMLDKEISQLIAEGY---RVIELEKHISLLHEYNDIKDVSQMLLGKLAVTRGVTTKELYPDFDLNLN 120
Cdd:pfam07061   1 LEAEIAELEAQLEELEKELAELKAELKnpdPKETVKRHIKLLHEYNEIKDVGQGLIGLIADERGVTIKEVYEEFGVEMN 79
 
Name Accession Description Interval E-value
Swi5 pfam07061
Swi5; Swi5 is involved in meiotic DNA repair synthesis and meiotic joint molecule formation. ...
45-120 2.42e-27

Swi5; Swi5 is involved in meiotic DNA repair synthesis and meiotic joint molecule formation. It is known to interact with Swi2, Rhp51 and Swi6.


Pssm-ID: 399800  Cd Length: 79  Bit Score: 96.09  E-value: 2.42e-27
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 594346510   45 LSSDIKKLKEKHDMLDKEISQLIAEGY---RVIELEKHISLLHEYNDIKDVSQMLLGKLAVTRGVTTKELYPDFDLNLN 120
Cdd:pfam07061   1 LEAEIAELEAQLEELEKELAELKAELKnpdPKETVKRHIKLLHEYNEIKDVGQGLIGLIADERGVTIKEVYEEFGVEMN 79
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH