NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|665408902|ref|NP_001286119|]
View 

mitochondrial aconitase 1, isoform F [Drosophila melanogaster]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
aconitase_mito super family cl36873
aconitate hydratase, mitochondrial; This model represents mitochondrial forms of the TCA cycle ...
52-782 0e+00

aconitate hydratase, mitochondrial; This model represents mitochondrial forms of the TCA cycle enzyme aconitate hydratase, also known as aconitase and citrate hydro-lyase. [Energy metabolism, TCA cycle]


The actual alignment was detected with superfamily member TIGR01340:

Pssm-ID: 273561 [Multi-domain]  Cd Length: 745  Bit Score: 1416.95  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902   52 YEKLNKRLEVVRGRLN-RPLTLSEKVLYSHLDDPAN----QDI--VRGTSYLRLRPDRVAMQDATAQMALLQFISSGLKK 124
Cdd:TIGR01340   1 YEKLYNNLDEVRRRLNsRPLTLAEKILYSHLDDPEEsllsQDIgdVRGKSYLKLRPDRVAMQDASAQMALLQFMTCGLPQ 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902  125 VAVPSTVHCDHLIEAQIGGPKDLARAKDLNKEVYDFLASTCAKYGLGFWKPGSGIIHQIILENYAFPGLLMIGTDSHTPN 204
Cdd:TIGR01340  81 VAVPASIHCDHLIVGQKGGDKDLARAIATNKEVFDFLESAGKKYGIGFWKPGSGIIHQIVLENYAFPGLMMLGTDSHTPN 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902  205 GGGLGGLCIGVGGADAVDVMADIPWELKCPKVIGVNLTGKISGWTSPKDVILKVADILTVKGGTGAIIEYHGKGVDSISC 284
Cdd:TIGR01340 161 AGGLGTIAIGVGGADAVDALAGAPWELKAPKILGVKLTGKLNGWTSPKDIILKLAGLLTVRGGTGYIVEYFGPGVESLSC 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902  285 TGMATICNMGAEIGATTSLFPFNQRMADYLKSTGRAGIASEAQ--KYQAKILSADKNCEYDELIEINLDTLEPHVNGPFT 362
Cdd:TIGR01340 241 TGMATICNMGAEIGATTSIFPFNEAMSRYLKATNRAQIAEDAKtgQYSFFKLKADEGAQYDELIEIDLSKLEPHINGPFT 320
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902  363 PDLGHPISKLGENSKKNGYPMDIRVGLIGSCTNSSYEDMGRCASIAKDAMSHGLKSKIPFNVTPGSEQIRATIERDGISE 442
Cdd:TIGR01340 321 PDLSTPISKFKETVQKNGWPEKLSAGLIGSCTNSSYEDMSRCASIVKDAEQAGLKPKSPFYVTPGSEQIRATLERDGILQ 400
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902  443 VFDKFGGTVLANACGPCIGQWDRKD-VKKGDKNTIVTSYNRNFTGRNDANPATHCFVTSPELVTALSIAGRLDFNPLTDE 521
Cdd:TIGR01340 401 TFEKFGGIVLANACGPCIGQWDRKDdVKKGEPNTILTSYNRNFRGRNDGNPATMNFLASPEIVTAMSYAGSLTFNPLTDS 480
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902  522 LTGADGKKFKLKAPFGDELPAKGFDPGQDTYTAPPPS-GENVKVAVDPKSTRLQLLEPFDKWNGQDLTDLTVLIKVKGKC 600
Cdd:TIGR01340 481 LTTPDGKEFKFPAPKGDELPEKGFEAGRDTFQAPPGSpNPNVEVAVSPSSDRLQLLEPFEPWNGKDLSGLRVLIKVTGKC 560
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902  601 TTDHISAAGPWLKYRGHLDNISNNMFIGATNYENNEMNNIKNQrNGSWGGVPDVARDYKANGIKWVAVGDENYGEGSSRE 680
Cdd:TIGR01340 561 TTDHISAAGPWLKYKGHLDNISNNTLIGAVNAETGEVNKAYDL-DGSKGTIPELARDWKARGQPWVVVAEHNYGEGSARE 639
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902  681 HAALEPRHLGGRAIIVKSFARIHETNLKKQGLLPLTFANPADYDKIQPTSKISLLNLKSLAP---GKPVDAEIKN-GDKV 756
Cdd:TIGR01340 640 HAALEPRHLGGRIIITKSFARIHETNLKKQGVLPLTFANEADYDKIQPGDEVATLNLYEMLKnggGGEVDLRVTKkNGKV 719
                         730       740
                  ....*....|....*....|....*.
gi 665408902  757 ERIKLNHTLNDLQIGWFKAGSALNRM 782
Cdd:TIGR01340 720 FEIKLKHTVSKDQIGFFKAGSALNLM 745
 
Name Accession Description Interval E-value
aconitase_mito TIGR01340
aconitate hydratase, mitochondrial; This model represents mitochondrial forms of the TCA cycle ...
52-782 0e+00

aconitate hydratase, mitochondrial; This model represents mitochondrial forms of the TCA cycle enzyme aconitate hydratase, also known as aconitase and citrate hydro-lyase. [Energy metabolism, TCA cycle]


Pssm-ID: 273561 [Multi-domain]  Cd Length: 745  Bit Score: 1416.95  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902   52 YEKLNKRLEVVRGRLN-RPLTLSEKVLYSHLDDPAN----QDI--VRGTSYLRLRPDRVAMQDATAQMALLQFISSGLKK 124
Cdd:TIGR01340   1 YEKLYNNLDEVRRRLNsRPLTLAEKILYSHLDDPEEsllsQDIgdVRGKSYLKLRPDRVAMQDASAQMALLQFMTCGLPQ 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902  125 VAVPSTVHCDHLIEAQIGGPKDLARAKDLNKEVYDFLASTCAKYGLGFWKPGSGIIHQIILENYAFPGLLMIGTDSHTPN 204
Cdd:TIGR01340  81 VAVPASIHCDHLIVGQKGGDKDLARAIATNKEVFDFLESAGKKYGIGFWKPGSGIIHQIVLENYAFPGLMMLGTDSHTPN 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902  205 GGGLGGLCIGVGGADAVDVMADIPWELKCPKVIGVNLTGKISGWTSPKDVILKVADILTVKGGTGAIIEYHGKGVDSISC 284
Cdd:TIGR01340 161 AGGLGTIAIGVGGADAVDALAGAPWELKAPKILGVKLTGKLNGWTSPKDIILKLAGLLTVRGGTGYIVEYFGPGVESLSC 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902  285 TGMATICNMGAEIGATTSLFPFNQRMADYLKSTGRAGIASEAQ--KYQAKILSADKNCEYDELIEINLDTLEPHVNGPFT 362
Cdd:TIGR01340 241 TGMATICNMGAEIGATTSIFPFNEAMSRYLKATNRAQIAEDAKtgQYSFFKLKADEGAQYDELIEIDLSKLEPHINGPFT 320
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902  363 PDLGHPISKLGENSKKNGYPMDIRVGLIGSCTNSSYEDMGRCASIAKDAMSHGLKSKIPFNVTPGSEQIRATIERDGISE 442
Cdd:TIGR01340 321 PDLSTPISKFKETVQKNGWPEKLSAGLIGSCTNSSYEDMSRCASIVKDAEQAGLKPKSPFYVTPGSEQIRATLERDGILQ 400
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902  443 VFDKFGGTVLANACGPCIGQWDRKD-VKKGDKNTIVTSYNRNFTGRNDANPATHCFVTSPELVTALSIAGRLDFNPLTDE 521
Cdd:TIGR01340 401 TFEKFGGIVLANACGPCIGQWDRKDdVKKGEPNTILTSYNRNFRGRNDGNPATMNFLASPEIVTAMSYAGSLTFNPLTDS 480
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902  522 LTGADGKKFKLKAPFGDELPAKGFDPGQDTYTAPPPS-GENVKVAVDPKSTRLQLLEPFDKWNGQDLTDLTVLIKVKGKC 600
Cdd:TIGR01340 481 LTTPDGKEFKFPAPKGDELPEKGFEAGRDTFQAPPGSpNPNVEVAVSPSSDRLQLLEPFEPWNGKDLSGLRVLIKVTGKC 560
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902  601 TTDHISAAGPWLKYRGHLDNISNNMFIGATNYENNEMNNIKNQrNGSWGGVPDVARDYKANGIKWVAVGDENYGEGSSRE 680
Cdd:TIGR01340 561 TTDHISAAGPWLKYKGHLDNISNNTLIGAVNAETGEVNKAYDL-DGSKGTIPELARDWKARGQPWVVVAEHNYGEGSARE 639
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902  681 HAALEPRHLGGRAIIVKSFARIHETNLKKQGLLPLTFANPADYDKIQPTSKISLLNLKSLAP---GKPVDAEIKN-GDKV 756
Cdd:TIGR01340 640 HAALEPRHLGGRIIITKSFARIHETNLKKQGVLPLTFANEADYDKIQPGDEVATLNLYEMLKnggGGEVDLRVTKkNGKV 719
                         730       740
                  ....*....|....*....|....*.
gi 665408902  757 ERIKLNHTLNDLQIGWFKAGSALNRM 782
Cdd:TIGR01340 720 FEIKLKHTVSKDQIGFFKAGSALNLM 745
PRK07229 PRK07229
aconitate hydratase; Validated
68-784 0e+00

aconitate hydratase; Validated


Pssm-ID: 235974 [Multi-domain]  Cd Length: 646  Bit Score: 903.36  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902  68 RPLTLSEKVLYSHLDDPanqDIVRGTSyLRLRPDRVAMQDATAQMALLQFISSGLKKVAVPSTV-HCDHlieaqiggpkD 146
Cdd:PRK07229   1 MGLTLTEKILYAHLVEG---ELEPGEE-IAIRIDQTLTQDATGTMAYLQFEAMGLDRVKTELSVqYVDH----------N 66
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 147 LARAKDLNKEVYDFLASTCAKYGLGFWKPGSGIIHQIILENYAFPGLLMIGTDSHTPNGGGLGGLCIGVGGADAVDVMAD 226
Cdd:PRK07229  67 LLQADFENADDHRFLQSVAAKYGIYFSKPGNGICHQVHLERFAFPGKTLLGSDSHTPTAGGLGMLAIGAGGLDVALAMAG 146
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 227 IPWELKCPKVIGVNLTGKISGWTSPKDVILKVADILTVKGGTGAIIEYHGKGVDSISCTGMATICNMGAEIGATTSLFPF 306
Cdd:PRK07229 147 GPYYLKMPKVVGVKLTGKLPPWVSAKDVILELLRRLTVKGGVGKIIEYFGPGVATLSVPERATITNMGAELGATTSIFPS 226
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 307 NQRMADYLKSTGRAGIASEaqkyqakiLSADKNCEYDELIEINLDTLEPHVNGPFTPDLGHPISKLGEnskkngypMDIR 386
Cdd:PRK07229 227 DERTREFLKAQGREDDWVE--------LLADPDAEYDEVIEIDLSELEPLIAGPHSPDNVVPVSEVAG--------IKVD 290
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 387 VGLIGSCTNSSYEDMGRCASIAKDamsHGLKSKIPFNVTPGSEQIRATIERDGISEVFDKFGGTVLANACGPCIGQwdrk 466
Cdd:PRK07229 291 QVLIGSCTNSSYEDLMRAASILKG---KKVHPKVSLVINPGSRQVLEMLARDGALADLIAAGARILENACGPCIGM---- 363
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 467 DVKKGDKNTIVTSYNRNFTGRNdANPATHCFVTSPELVTALSIAGRLDfNPLTDELTGadGKKFKLKAPfgdelpaKGFD 546
Cdd:PRK07229 364 GQAPATGNVSLRTFNRNFPGRS-GTKDAQVYLASPETAAASALTGVIT-DPRTLALEN--GEYPKLEEP-------EGFA 432
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 547 PGQDTYTAPPPSGENVKVAVDPKSTRLQLLEPFDkwngqDLTDLTVLIKVKGKCTTDHISAAGP-WLKYRGHLDNISNNM 625
Cdd:PRK07229 433 VDDAGIIAPAEDGSDVEVVRGPNIKPLPLLEPLP-----DLLEGKVLLKVGDNITTDHIMPAGAkWLPYRSNIPNISEFV 507
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 626 FIGAtnyennemnniknqrngswggVPDVARDYKANGiKWVAVGDENYGEGSSREHAALEPRHLGGRAIIVKSFARIHET 705
Cdd:PRK07229 508 FEGV---------------------DNTFPERAKEQG-GGIVVGGENYGQGSSREHAALAPRYLGVKAVLAKSFARIHKA 565
                        650       660       670       680       690       700       710
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 665408902 706 NLKKQGLLPLTFANPADYDKIQPTSKISLLNLKSLAPGKPVDAEIKNGDkvERIKLNHTLNDLQIGWFKAGSALNRMKE 784
Cdd:PRK07229 566 NLINFGILPLTFADPADYDKIEEGDVLEIEDLREFLPGGPLTVVNVTKD--EEIEVRHTLSERQIEILLAGGALNLIKK 642
AcnA_Mitochondrial cd01584
Aconitase catalyzes the reversible isomerization of citrate and isocitrate as part of the TCA ...
102-513 0e+00

Aconitase catalyzes the reversible isomerization of citrate and isocitrate as part of the TCA cycle; Mitochondrial aconitase A catalytic domain. Aconitase (also known as aconitate hydratase and citrate hydro-lyase) catalyzes the reversible isomerization of citrate and isocitrate as part of the TCA cycle. Cis-aconitate is formed as an intermediary product during the course of the reaction. In eukaryotes two isozymes of aconitase are known to exist: one found in the mitochondrial matrix and the other found in the cytoplasm. This is the mitochondrial form. The mitochondrial product is coded by a nuclear gene. Most members of this subfamily are mitochondrial but there are some bacterial members.


Pssm-ID: 153134  Cd Length: 412  Bit Score: 842.87  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 102 RVAMQDATAQMALLQFISSGLKKVAVPSTVHCDHLIEAQIGGPKDLARAKDLNKEVYDFLASTCAKYGLGFWKPGSGIIH 181
Cdd:cd01584    1 RVAMQDATAQMALLQFMSSGLPKVAVPSTIHCDHLIEAQVGGEKDLKRAKDINKEVYDFLASAGAKYGIGFWKPGSGIIH 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 182 QIILENYAFPGLLMIGTDSHTPNGGGLGGLCIGVGGADAVDVMADIPWELKCPKVIGVNLTGKISGWTSPKDVILKVADI 261
Cdd:cd01584   81 QIVLENYAFPGLLMIGTDSHTPNAGGLGGIAIGVGGADAVDVMAGIPWELKCPKVIGVKLTGKLSGWTSPKDVILKVAGI 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 262 LTVKGGTGAIIEYHGKGVDSISCTGMATICNMGAEIGATTSLFPFNQRMADYLKSTGRAGIASEAQKYQAKILSADKNCE 341
Cdd:cd01584  161 LTVKGGTGAIVEYFGPGVDSLSCTGMGTICNMGAEIGATTSVFPYNERMKKYLKATGRAEIADLADEFKDDLLVADEGAE 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 342 YDELIEINLDTLEPHVNGPFTPDLGHPISKLGENSKKNGYPMDIRVGLIGSCTNSSYEDMGRCASIAKDAMSHGLKSKIP 421
Cdd:cd01584  241 YDQLIEINLSELEPHINGPFTPDLATPVSKFKEVAEKNGWPLDLRVGLIGSCTNSSYEDMGRAASIAKQALAHGLKCKSI 320
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 422 FNVTPGSEQIRATIERDGISEVFDKFGGTVLANACGPCIGQWDRKDVKKGDKNTIVTSYNRNFTGRNDANPATHCFVTSP 501
Cdd:cd01584  321 FTITPGSEQIRATIERDGLLQTFRDAGGIVLANACGPCIGQWDRKDIKKGEKNTIVTSYNRNFTGRNDANPATHAFVASP 400
                        410
                 ....*....|..
gi 665408902 502 ELVTALSIAGRL 513
Cdd:cd01584  401 EIVTAMAIAGTL 412
AcnA COG1048
Aconitase A [Energy production and conversion];
60-784 0e+00

Aconitase A [Energy production and conversion];


Pssm-ID: 223977 [Multi-domain]  Cd Length: 861  Bit Score: 691.76  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902  60 EVVRGRLNRPLTLSEKVLYSHLDDPAN------QDIVRG------TSYLRLRPDRVAMQDATAQMAllQFISSGLKKVA- 126
Cdd:COG1048   23 KLEESGKISKLPYSLKILLENLLRGEDgteehiEALARWlpsgkpEKEIAFRPARVVMQDFTGVPA--VVDLAAMRDAMv 100
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 127 ------------VPSTVHCDHLIEAQIGG-----PKDLARAKDLNKEVYDFLASTC-AKYGLGFWKPGSGIIHQIILENY 188
Cdd:COG1048  101 elggdpakinpvVPVDLVIDHSVQVDVGGdpdafEKNVELEFERNGERYKFLKWAAkAFYNFRVVPPGTGIIHQVNLEYL 180
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 189 AF-----PGLL----MIGTDSHTPNGGGLGGLCIGVGGADAVDVMADIPWELKCPKVIGVNLTGKISGWTSPKDVILKVA 259
Cdd:COG1048  181 AKvvwakPGVAypdtLVGTDSHTTMIGGLGVLGWGVGGIEAEAAMLGQPWYMLIPEVVGVKLTGKLPEGVTATDLVLTVT 260
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 260 DILTVKGGTGAIIEYHGKGVDSISCTGMATICNMGAEIGATTSLFPFNQRMADYLKSTGRAGIASE-----AQKYQAKIL 334
Cdd:COG1048  261 GMLRKKGVVGKFVEFFGPGVASLSLADRATIANMGPEYGATSGFFPIDEETLDYLRLTGRSEEQVAlveayAKAQGLWYD 340
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 335 SADKNCEYDELIEINLDTLEPHVNGPFTPDLGHPISKLGENSKKNGY----------------PMDIRVGLIGSCTNSSY 398
Cdd:COG1048  341 PADKDAEYDKVLELDLSTVEPSLAGPKRPQDRVPLSEVAENFEKILReieikrvysllgkelgDGKVVIAAITSCTNTSN 420
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 399 EDMGRCASI-AKDAMSHGLKSK--IPFNVTPGSEQIRATIERDGISEVFDKFGGTVLANACGPCIGQWDRKD---VKKGD 472
Cdd:COG1048  421 PDVLIAAGLlAKKAVEKGLKVKpwVKTSVAPGSKVVTEYLEKAGLLPYLEKLGFNIVGYGCTTCIGNSGPLPeeiEKAIN 500
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 473 KNTIVT----SYNRNFTGRNdANPATHCFVTSPELVTALSIAGRLDFNPLTDEL-TGADGKKFKLK---APFGDELPAKG 544
Cdd:COG1048  501 DNDLVVtavlSGNRNFEGRI-GPLVKANYLASPPLVVAYALAGTINFDLTTDPLgTDNDGKPVYLKdiwPSTEEIAEAVG 579
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 545 FDPGQDTYTAPPPSG--------ENVKVAVDPKSTRLQLLEPFDKWNGQD---LTDLTVLIKVKGKCTTDHISAAG---- 609
Cdd:COG1048  580 KAVKPEMFRKEYADVfkwnaievPEGPLYDWPNISTYIRLPPFFDGMGAEpkpIKGARVLAKLGDSITTDHISPAGsika 659
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 610 ----PWLKYRGHLDNISNNMFIGATNYENNEMN------NIKNQ---RNGSW------GGVPDVARDYKANGIKWVAVGD 670
Cdd:COG1048  660 dspaGKYLYEHGVERIDFNSYGSRRGNHEVMMRgtfaniRIRNEmvpGEGGYtihqpsGEIYDAAMKYKEEGIPLVVVAG 739
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 671 ENYGEGSSREHAALEPRHLGGRAIIVKSFARIHETNLKKQGLLPLTFANPADYDKI--QPTSKISLLNLKSLAPGKPVDA 748
Cdd:COG1048  740 KNYGTGSSRDWAAKGPRLLGVKAVIAESFERIHRSNLIGMGVLPLQFPNGETYDKLglDGEETIDIGGLENLKPGATVTV 819
                        810       820       830
                 ....*....|....*....|....*....|....*...
gi 665408902 749 EIKNGD--KVERIKLNHTLNDLQIGWFKAGSALNRMKE 784
Cdd:COG1048  820 TVTRGDgpVEEFPVLCRIDTAEEIEYYKAGGILNYVKR 857
Aconitase pfam00330
Aconitase family (aconitate hydratase);
74-511 0e+00

Aconitase family (aconitate hydratase);


Pssm-ID: 395261  Cd Length: 458  Bit Score: 538.92  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902   74 EKVLYSHLDDPANQDIVRgtsylrlRPDRVAMQDATAQMALLQFISSGLKK-----------VAVPSTVHCDHLIEaqig 142
Cdd:pfam00330   1 EKIWDAHLVEELDGSLLY-------IPDRVLLHDVTSPQAFVDLRAAGRAVrrpggtpatidHLVPTDLVIDRDLD---- 69
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902  143 gpKDLARAKDLNKEVYDFLASTCAKYGLGFWKPGSGIIHQIILEN-YAFPGLLMIGTDSHTPNggglgglcigvggA--- 218
Cdd:pfam00330  70 --KNIEDEISRNKEQYDFLEWNAKKFGIRFVPPGQGIVHQVGLEYgLALPGMTIVGTDSHTTT-------------Hggl 134
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902  219 ----------DAVDVMADIPWELKCPKVIGVNLTGKISGWTSPKDVILKVADILTVKGGTGAIIEYHGKGVDSISCTGMA 288
Cdd:pfam00330 135 galafgvggsEAEHVLATQPLEMKKPKVVGVKLTGKLPPGVTAKDVILAIIGKLGVKGGTGKVVEFFGPGVRSLSMEGRA 214
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902  289 TICNMGAEIGATTSLFPFNQRMADYLKSTGRAGIA-----SEAQKYQAkiLSADKNCEYDELIEINLDTLEPHVNGPFTP 363
Cdd:pfam00330 215 TICNMAIEYGATAGLFPPDETTFEYLRATGRPEAPkgeayDKAVALWR--LASDPGAVYDKVVEIDLSTIEPMVTGPTSP 292
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902  364 DLGHPISKLGENS-------------------KKNGYPM---DIRVGLIGSCTNSSYEDMGRCASIAKDAMSHGLKSK-- 419
Cdd:pfam00330 293 QDAVPLSELVPDPafaddvereaaeraleymgLEPGTPLedgKVDIAFIGSCTNSSIEDLRAAAGLLKKAVEKGLKVApg 372
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902  420 IPFNVTPGSEQIRATIERDGISEVFDKFGGTVLANACGPCIGQWDRkdVKKGDknTIVTSYNRNFTGRNdaNPATHCFVT 499
Cdd:pfam00330 373 VKASVVPGSEVVRAYAEAEGLDKILEEAGFEWRGPGCSMCIGNSDR--LPPGE--RCVSSSNRNFEGRQ--GPGGRTHLA 446
                         490
                  ....*....|..
gi 665408902  500 SPELVTALSIAG 511
Cdd:pfam00330 447 SPALVAAAAIAG 458
 
Name Accession Description Interval E-value
aconitase_mito TIGR01340
aconitate hydratase, mitochondrial; This model represents mitochondrial forms of the TCA cycle ...
52-782 0e+00

aconitate hydratase, mitochondrial; This model represents mitochondrial forms of the TCA cycle enzyme aconitate hydratase, also known as aconitase and citrate hydro-lyase. [Energy metabolism, TCA cycle]


Pssm-ID: 273561 [Multi-domain]  Cd Length: 745  Bit Score: 1416.95  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902   52 YEKLNKRLEVVRGRLN-RPLTLSEKVLYSHLDDPAN----QDI--VRGTSYLRLRPDRVAMQDATAQMALLQFISSGLKK 124
Cdd:TIGR01340   1 YEKLYNNLDEVRRRLNsRPLTLAEKILYSHLDDPEEsllsQDIgdVRGKSYLKLRPDRVAMQDASAQMALLQFMTCGLPQ 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902  125 VAVPSTVHCDHLIEAQIGGPKDLARAKDLNKEVYDFLASTCAKYGLGFWKPGSGIIHQIILENYAFPGLLMIGTDSHTPN 204
Cdd:TIGR01340  81 VAVPASIHCDHLIVGQKGGDKDLARAIATNKEVFDFLESAGKKYGIGFWKPGSGIIHQIVLENYAFPGLMMLGTDSHTPN 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902  205 GGGLGGLCIGVGGADAVDVMADIPWELKCPKVIGVNLTGKISGWTSPKDVILKVADILTVKGGTGAIIEYHGKGVDSISC 284
Cdd:TIGR01340 161 AGGLGTIAIGVGGADAVDALAGAPWELKAPKILGVKLTGKLNGWTSPKDIILKLAGLLTVRGGTGYIVEYFGPGVESLSC 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902  285 TGMATICNMGAEIGATTSLFPFNQRMADYLKSTGRAGIASEAQ--KYQAKILSADKNCEYDELIEINLDTLEPHVNGPFT 362
Cdd:TIGR01340 241 TGMATICNMGAEIGATTSIFPFNEAMSRYLKATNRAQIAEDAKtgQYSFFKLKADEGAQYDELIEIDLSKLEPHINGPFT 320
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902  363 PDLGHPISKLGENSKKNGYPMDIRVGLIGSCTNSSYEDMGRCASIAKDAMSHGLKSKIPFNVTPGSEQIRATIERDGISE 442
Cdd:TIGR01340 321 PDLSTPISKFKETVQKNGWPEKLSAGLIGSCTNSSYEDMSRCASIVKDAEQAGLKPKSPFYVTPGSEQIRATLERDGILQ 400
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902  443 VFDKFGGTVLANACGPCIGQWDRKD-VKKGDKNTIVTSYNRNFTGRNDANPATHCFVTSPELVTALSIAGRLDFNPLTDE 521
Cdd:TIGR01340 401 TFEKFGGIVLANACGPCIGQWDRKDdVKKGEPNTILTSYNRNFRGRNDGNPATMNFLASPEIVTAMSYAGSLTFNPLTDS 480
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902  522 LTGADGKKFKLKAPFGDELPAKGFDPGQDTYTAPPPS-GENVKVAVDPKSTRLQLLEPFDKWNGQDLTDLTVLIKVKGKC 600
Cdd:TIGR01340 481 LTTPDGKEFKFPAPKGDELPEKGFEAGRDTFQAPPGSpNPNVEVAVSPSSDRLQLLEPFEPWNGKDLSGLRVLIKVTGKC 560
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902  601 TTDHISAAGPWLKYRGHLDNISNNMFIGATNYENNEMNNIKNQrNGSWGGVPDVARDYKANGIKWVAVGDENYGEGSSRE 680
Cdd:TIGR01340 561 TTDHISAAGPWLKYKGHLDNISNNTLIGAVNAETGEVNKAYDL-DGSKGTIPELARDWKARGQPWVVVAEHNYGEGSARE 639
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902  681 HAALEPRHLGGRAIIVKSFARIHETNLKKQGLLPLTFANPADYDKIQPTSKISLLNLKSLAP---GKPVDAEIKN-GDKV 756
Cdd:TIGR01340 640 HAALEPRHLGGRIIITKSFARIHETNLKKQGVLPLTFANEADYDKIQPGDEVATLNLYEMLKnggGGEVDLRVTKkNGKV 719
                         730       740
                  ....*....|....*....|....*.
gi 665408902  757 ERIKLNHTLNDLQIGWFKAGSALNRM 782
Cdd:TIGR01340 720 FEIKLKHTVSKDQIGFFKAGSALNLM 745
PRK07229 PRK07229
aconitate hydratase; Validated
68-784 0e+00

aconitate hydratase; Validated


Pssm-ID: 235974 [Multi-domain]  Cd Length: 646  Bit Score: 903.36  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902  68 RPLTLSEKVLYSHLDDPanqDIVRGTSyLRLRPDRVAMQDATAQMALLQFISSGLKKVAVPSTV-HCDHlieaqiggpkD 146
Cdd:PRK07229   1 MGLTLTEKILYAHLVEG---ELEPGEE-IAIRIDQTLTQDATGTMAYLQFEAMGLDRVKTELSVqYVDH----------N 66
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 147 LARAKDLNKEVYDFLASTCAKYGLGFWKPGSGIIHQIILENYAFPGLLMIGTDSHTPNGGGLGGLCIGVGGADAVDVMAD 226
Cdd:PRK07229  67 LLQADFENADDHRFLQSVAAKYGIYFSKPGNGICHQVHLERFAFPGKTLLGSDSHTPTAGGLGMLAIGAGGLDVALAMAG 146
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 227 IPWELKCPKVIGVNLTGKISGWTSPKDVILKVADILTVKGGTGAIIEYHGKGVDSISCTGMATICNMGAEIGATTSLFPF 306
Cdd:PRK07229 147 GPYYLKMPKVVGVKLTGKLPPWVSAKDVILELLRRLTVKGGVGKIIEYFGPGVATLSVPERATITNMGAELGATTSIFPS 226
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 307 NQRMADYLKSTGRAGIASEaqkyqakiLSADKNCEYDELIEINLDTLEPHVNGPFTPDLGHPISKLGEnskkngypMDIR 386
Cdd:PRK07229 227 DERTREFLKAQGREDDWVE--------LLADPDAEYDEVIEIDLSELEPLIAGPHSPDNVVPVSEVAG--------IKVD 290
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 387 VGLIGSCTNSSYEDMGRCASIAKDamsHGLKSKIPFNVTPGSEQIRATIERDGISEVFDKFGGTVLANACGPCIGQwdrk 466
Cdd:PRK07229 291 QVLIGSCTNSSYEDLMRAASILKG---KKVHPKVSLVINPGSRQVLEMLARDGALADLIAAGARILENACGPCIGM---- 363
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 467 DVKKGDKNTIVTSYNRNFTGRNdANPATHCFVTSPELVTALSIAGRLDfNPLTDELTGadGKKFKLKAPfgdelpaKGFD 546
Cdd:PRK07229 364 GQAPATGNVSLRTFNRNFPGRS-GTKDAQVYLASPETAAASALTGVIT-DPRTLALEN--GEYPKLEEP-------EGFA 432
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 547 PGQDTYTAPPPSGENVKVAVDPKSTRLQLLEPFDkwngqDLTDLTVLIKVKGKCTTDHISAAGP-WLKYRGHLDNISNNM 625
Cdd:PRK07229 433 VDDAGIIAPAEDGSDVEVVRGPNIKPLPLLEPLP-----DLLEGKVLLKVGDNITTDHIMPAGAkWLPYRSNIPNISEFV 507
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 626 FIGAtnyennemnniknqrngswggVPDVARDYKANGiKWVAVGDENYGEGSSREHAALEPRHLGGRAIIVKSFARIHET 705
Cdd:PRK07229 508 FEGV---------------------DNTFPERAKEQG-GGIVVGGENYGQGSSREHAALAPRYLGVKAVLAKSFARIHKA 565
                        650       660       670       680       690       700       710
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 665408902 706 NLKKQGLLPLTFANPADYDKIQPTSKISLLNLKSLAPGKPVDAEIKNGDkvERIKLNHTLNDLQIGWFKAGSALNRMKE 784
Cdd:PRK07229 566 NLINFGILPLTFADPADYDKIEEGDVLEIEDLREFLPGGPLTVVNVTKD--EEIEVRHTLSERQIEILLAGGALNLIKK 642
AcnA_Mitochondrial cd01584
Aconitase catalyzes the reversible isomerization of citrate and isocitrate as part of the TCA ...
102-513 0e+00

Aconitase catalyzes the reversible isomerization of citrate and isocitrate as part of the TCA cycle; Mitochondrial aconitase A catalytic domain. Aconitase (also known as aconitate hydratase and citrate hydro-lyase) catalyzes the reversible isomerization of citrate and isocitrate as part of the TCA cycle. Cis-aconitate is formed as an intermediary product during the course of the reaction. In eukaryotes two isozymes of aconitase are known to exist: one found in the mitochondrial matrix and the other found in the cytoplasm. This is the mitochondrial form. The mitochondrial product is coded by a nuclear gene. Most members of this subfamily are mitochondrial but there are some bacterial members.


Pssm-ID: 153134  Cd Length: 412  Bit Score: 842.87  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 102 RVAMQDATAQMALLQFISSGLKKVAVPSTVHCDHLIEAQIGGPKDLARAKDLNKEVYDFLASTCAKYGLGFWKPGSGIIH 181
Cdd:cd01584    1 RVAMQDATAQMALLQFMSSGLPKVAVPSTIHCDHLIEAQVGGEKDLKRAKDINKEVYDFLASAGAKYGIGFWKPGSGIIH 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 182 QIILENYAFPGLLMIGTDSHTPNGGGLGGLCIGVGGADAVDVMADIPWELKCPKVIGVNLTGKISGWTSPKDVILKVADI 261
Cdd:cd01584   81 QIVLENYAFPGLLMIGTDSHTPNAGGLGGIAIGVGGADAVDVMAGIPWELKCPKVIGVKLTGKLSGWTSPKDVILKVAGI 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 262 LTVKGGTGAIIEYHGKGVDSISCTGMATICNMGAEIGATTSLFPFNQRMADYLKSTGRAGIASEAQKYQAKILSADKNCE 341
Cdd:cd01584  161 LTVKGGTGAIVEYFGPGVDSLSCTGMGTICNMGAEIGATTSVFPYNERMKKYLKATGRAEIADLADEFKDDLLVADEGAE 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 342 YDELIEINLDTLEPHVNGPFTPDLGHPISKLGENSKKNGYPMDIRVGLIGSCTNSSYEDMGRCASIAKDAMSHGLKSKIP 421
Cdd:cd01584  241 YDQLIEINLSELEPHINGPFTPDLATPVSKFKEVAEKNGWPLDLRVGLIGSCTNSSYEDMGRAASIAKQALAHGLKCKSI 320
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 422 FNVTPGSEQIRATIERDGISEVFDKFGGTVLANACGPCIGQWDRKDVKKGDKNTIVTSYNRNFTGRNDANPATHCFVTSP 501
Cdd:cd01584  321 FTITPGSEQIRATIERDGLLQTFRDAGGIVLANACGPCIGQWDRKDIKKGEKNTIVTSYNRNFTGRNDANPATHAFVASP 400
                        410
                 ....*....|..
gi 665408902 502 ELVTALSIAGRL 513
Cdd:cd01584  401 EIVTAMAIAGTL 412
AcnA COG1048
Aconitase A [Energy production and conversion];
60-784 0e+00

Aconitase A [Energy production and conversion];


Pssm-ID: 223977 [Multi-domain]  Cd Length: 861  Bit Score: 691.76  E-value: 0e+00
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902  60 EVVRGRLNRPLTLSEKVLYSHLDDPAN------QDIVRG------TSYLRLRPDRVAMQDATAQMAllQFISSGLKKVA- 126
Cdd:COG1048   23 KLEESGKISKLPYSLKILLENLLRGEDgteehiEALARWlpsgkpEKEIAFRPARVVMQDFTGVPA--VVDLAAMRDAMv 100
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 127 ------------VPSTVHCDHLIEAQIGG-----PKDLARAKDLNKEVYDFLASTC-AKYGLGFWKPGSGIIHQIILENY 188
Cdd:COG1048  101 elggdpakinpvVPVDLVIDHSVQVDVGGdpdafEKNVELEFERNGERYKFLKWAAkAFYNFRVVPPGTGIIHQVNLEYL 180
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 189 AF-----PGLL----MIGTDSHTPNGGGLGGLCIGVGGADAVDVMADIPWELKCPKVIGVNLTGKISGWTSPKDVILKVA 259
Cdd:COG1048  181 AKvvwakPGVAypdtLVGTDSHTTMIGGLGVLGWGVGGIEAEAAMLGQPWYMLIPEVVGVKLTGKLPEGVTATDLVLTVT 260
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 260 DILTVKGGTGAIIEYHGKGVDSISCTGMATICNMGAEIGATTSLFPFNQRMADYLKSTGRAGIASE-----AQKYQAKIL 334
Cdd:COG1048  261 GMLRKKGVVGKFVEFFGPGVASLSLADRATIANMGPEYGATSGFFPIDEETLDYLRLTGRSEEQVAlveayAKAQGLWYD 340
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 335 SADKNCEYDELIEINLDTLEPHVNGPFTPDLGHPISKLGENSKKNGY----------------PMDIRVGLIGSCTNSSY 398
Cdd:COG1048  341 PADKDAEYDKVLELDLSTVEPSLAGPKRPQDRVPLSEVAENFEKILReieikrvysllgkelgDGKVVIAAITSCTNTSN 420
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 399 EDMGRCASI-AKDAMSHGLKSK--IPFNVTPGSEQIRATIERDGISEVFDKFGGTVLANACGPCIGQWDRKD---VKKGD 472
Cdd:COG1048  421 PDVLIAAGLlAKKAVEKGLKVKpwVKTSVAPGSKVVTEYLEKAGLLPYLEKLGFNIVGYGCTTCIGNSGPLPeeiEKAIN 500
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 473 KNTIVT----SYNRNFTGRNdANPATHCFVTSPELVTALSIAGRLDFNPLTDEL-TGADGKKFKLK---APFGDELPAKG 544
Cdd:COG1048  501 DNDLVVtavlSGNRNFEGRI-GPLVKANYLASPPLVVAYALAGTINFDLTTDPLgTDNDGKPVYLKdiwPSTEEIAEAVG 579
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 545 FDPGQDTYTAPPPSG--------ENVKVAVDPKSTRLQLLEPFDKWNGQD---LTDLTVLIKVKGKCTTDHISAAG---- 609
Cdd:COG1048  580 KAVKPEMFRKEYADVfkwnaievPEGPLYDWPNISTYIRLPPFFDGMGAEpkpIKGARVLAKLGDSITTDHISPAGsika 659
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 610 ----PWLKYRGHLDNISNNMFIGATNYENNEMN------NIKNQ---RNGSW------GGVPDVARDYKANGIKWVAVGD 670
Cdd:COG1048  660 dspaGKYLYEHGVERIDFNSYGSRRGNHEVMMRgtfaniRIRNEmvpGEGGYtihqpsGEIYDAAMKYKEEGIPLVVVAG 739
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 671 ENYGEGSSREHAALEPRHLGGRAIIVKSFARIHETNLKKQGLLPLTFANPADYDKI--QPTSKISLLNLKSLAPGKPVDA 748
Cdd:COG1048  740 KNYGTGSSRDWAAKGPRLLGVKAVIAESFERIHRSNLIGMGVLPLQFPNGETYDKLglDGEETIDIGGLENLKPGATVTV 819
                        810       820       830
                 ....*....|....*....|....*....|....*...
gi 665408902 749 EIKNGD--KVERIKLNHTLNDLQIGWFKAGSALNRMKE 784
Cdd:COG1048  820 TVTRGDgpVEEFPVLCRIDTAEEIEYYKAGGILNYVKR 857
Aconitase pfam00330
Aconitase family (aconitate hydratase);
74-511 0e+00

Aconitase family (aconitate hydratase);


Pssm-ID: 395261  Cd Length: 458  Bit Score: 538.92  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902   74 EKVLYSHLDDPANQDIVRgtsylrlRPDRVAMQDATAQMALLQFISSGLKK-----------VAVPSTVHCDHLIEaqig 142
Cdd:pfam00330   1 EKIWDAHLVEELDGSLLY-------IPDRVLLHDVTSPQAFVDLRAAGRAVrrpggtpatidHLVPTDLVIDRDLD---- 69
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902  143 gpKDLARAKDLNKEVYDFLASTCAKYGLGFWKPGSGIIHQIILEN-YAFPGLLMIGTDSHTPNggglgglcigvggA--- 218
Cdd:pfam00330  70 --KNIEDEISRNKEQYDFLEWNAKKFGIRFVPPGQGIVHQVGLEYgLALPGMTIVGTDSHTTT-------------Hggl 134
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902  219 ----------DAVDVMADIPWELKCPKVIGVNLTGKISGWTSPKDVILKVADILTVKGGTGAIIEYHGKGVDSISCTGMA 288
Cdd:pfam00330 135 galafgvggsEAEHVLATQPLEMKKPKVVGVKLTGKLPPGVTAKDVILAIIGKLGVKGGTGKVVEFFGPGVRSLSMEGRA 214
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902  289 TICNMGAEIGATTSLFPFNQRMADYLKSTGRAGIA-----SEAQKYQAkiLSADKNCEYDELIEINLDTLEPHVNGPFTP 363
Cdd:pfam00330 215 TICNMAIEYGATAGLFPPDETTFEYLRATGRPEAPkgeayDKAVALWR--LASDPGAVYDKVVEIDLSTIEPMVTGPTSP 292
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902  364 DLGHPISKLGENS-------------------KKNGYPM---DIRVGLIGSCTNSSYEDMGRCASIAKDAMSHGLKSK-- 419
Cdd:pfam00330 293 QDAVPLSELVPDPafaddvereaaeraleymgLEPGTPLedgKVDIAFIGSCTNSSIEDLRAAAGLLKKAVEKGLKVApg 372
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902  420 IPFNVTPGSEQIRATIERDGISEVFDKFGGTVLANACGPCIGQWDRkdVKKGDknTIVTSYNRNFTGRNdaNPATHCFVT 499
Cdd:pfam00330 373 VKASVVPGSEVVRAYAEAEGLDKILEEAGFEWRGPGCSMCIGNSDR--LPPGE--RCVSSSNRNFEGRQ--GPGGRTHLA 446
                         490
                  ....*....|..
gi 665408902  500 SPELVTALSIAG 511
Cdd:pfam00330 447 SPALVAAAAIAG 458
Aconitase cd01351
Aconitase catalytic domain; Aconitase catalyzes the reversible isomerization of citrate and ...
102-513 1.42e-138

Aconitase catalytic domain; Aconitase catalyzes the reversible isomerization of citrate and isocitrate as part of the TCA cycle; Aconitase catalytic domain. Aconitase (aconitate hydratase) catalyzes the reversible isomerization of citrate and isocitrate as part of the TCA cycle. Cis-aconitate is formed as an intermediate product during the course of the reaction. In eukaryotes two isozymes of aconitase are known to exist: one found in the mitochondrial matrix and the other found in the cytoplasm. Aconitase, in its active form, contains a 4Fe-4S iron-sulfur cluster; three cysteine residues have been shown to be ligands of the 4Fe-4S cluster. This is the Aconitase core domain, including structural domains 1, 2 and 3, which binds the Fe-S cluster. The aconitase family also contains the following proteins: - Iron-responsive element binding protein (IRE-BP), a cytosolic protein that binds to iron-responsive elements (IREs). IREs are stem-loop structures found in the 5'UTR of ferritin, and delta aminolevulinic acid synthase mRNAs, and in the 3'UTR of transferrin receptor mRNA. IRE-BP also express aconitase activity. - 3-isopropylmalate dehydratase (isopropylmalate isomerase), the enzyme that catalyzes the second step in the biosynthesis of leucine. - Homoaconitase (homoaconitate hydratase), an enzyme that participates in the alpha-aminoadipate pathway of lysine biosynthesis and that converts cis-homoaconitate into homoisocitric acid.


Pssm-ID: 153129  Cd Length: 389  Bit Score: 414.59  E-value: 1.42e-138
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 102 RVAMQDATAQMALLQFISSGLK-KVAVPSTVHCDHLIEAQIggpkdlarAKDLNKEVYDFLASTCAKYGLGFWKPGSGII 180
Cdd:cd01351    1 RVMLQDATGPMAMKAFEILAALgKVADPSQIACVHDHAVQL--------EKPVNNEGHKFLSFFAALQGIAFYRPGVGII 72
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 181 HQIILENYAFPGLLMIGTDSHTPNGGGLGGLCIGVGGADAVDVMADIPWELKCPKVIGVNLTGKISGWTSPKDVILKVAD 260
Cdd:cd01351   73 HQIMVENLALPGDLLVGSDSHTTSYGGLGAISTGAGGGDVAFVMAGGPAWLKKPEVVGVNLTGKLSPGVTGKDVVLKLGG 152
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 261 ILTVKGGTGAIIEYHGKGVDSISCTGMATICNMGAEIGATTSLFPFNQRMADYLKSTGRAGIASEAQKYQAKILsADKNC 340
Cdd:cd01351  153 IVGVDGVLNRIVEFYGEGVSSLSIEDRLTICNMMAELGATTGIFPEDKTTLKWLEATGRPLLKNLWLAFPEELL-ADEGA 231
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 341 EYDELIEINLDTLEPHVNGPFTPDLGHPISKLGEnskkngypMDIRVGLIGSCTNSSYEDMGRCASIAKDamsHGLKSKI 420
Cdd:cd01351  232 EYDQVIEIDLSELEPDISGPNRPDDAVSVSEVEG--------TKIDQVLIGSCTNNRYSDMLAAAKLLKG---AKVAPGV 300
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 421 PFNVTPGSEQIRATIERDGISEVFDKFGGTVLANACGPCIGQWDRkdvKKGDKNTIVTSYNRNFTGRNDANPAtHCFVTS 500
Cdd:cd01351  301 RLIVTPGSRMVYATLSREGYYEILVDSGARILPPGCGPCMGNGAR---LVADGEVGVSSGNRNFPGRLGTYER-HVYLAS 376
                        410
                 ....*....|...
gi 665408902 501 PELVTALSIAGRL 513
Cdd:cd01351  377 PELAAATAIAGKI 389
acon_putative TIGR01342
aconitate hydratase, putative, Aquifex type; This model represents a small family of proteins ...
71-784 4.04e-115

aconitate hydratase, putative, Aquifex type; This model represents a small family of proteins homologous (and likely functionally equivalent to) aconitase 1. Members are found, so far in the anaerobe Clostridium acetobutylicum, in the microaerophilic, early-branching bacterium Aquifex aeolicus, and in the halophilic archaeon Halobacterium sp. NRC-1. No member is experimentally characterized. [Energy metabolism, TCA cycle]


Pssm-ID: 130409 [Multi-domain]  Cd Length: 658  Bit Score: 363.15  E-value: 4.04e-115
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902   71 TLSEKVLYSHLddpANQDIVRGTSyLRLRPDRVAMQDATAQMALLQFISSGLKKVAVPSTV-HCDHlieaqiggpkDLAR 149
Cdd:TIGR01342   1 TLAEKIIDDHL---VEGDLEPGEE-IAIEIDQTLSQDATGTMCWLEFEALEMDEVKTELAAqYCDH----------NMLQ 66
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902  150 AKDLNKEVYDFLASTCAKYGLGFWKPGSGIIHQIILENYAFPGLLMIGTDSHTPNGGGLGGLCIGVGGADAVDVMADIPW 229
Cdd:TIGR01342  67 FDFKNADDHKFLMSAAGKFGAWFSKPGNGICHNVHKENFAAPGKTLLGSDSHTPTAGGLGMLAIGAGGIDIAAAMAGEAF 146
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902  230 ELKCPKVIGVNLTGKISGWTSPKDVILKVADILTVKGGTGAIIEYHGKGVDSISCTGMATICNMGAEIGATTSLFPFNQR 309
Cdd:TIGR01342 147 YLEMPEIVGVHLEGELPEWATAKDIILELLRRLSVKGGLGKIFEYFGEGVEELSVPERATITNMGAELGATSSIFPSDDI 226
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902  310 MADYLKSTGRAGIASEaqkyqakiLSADKNCEYDELIEINLDTLEPHVNGPFTPDLGHPISKLGenskknGYPMDIRVgl 389
Cdd:TIGR01342 227 TEAWLAAFDREDDFVD--------LLADADAEYADEIEIDLSDLEPLIAEPHMPDNVVPVREIA------GIEVDQVM-- 290
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902  390 IGSCTNSSYEDMGRCASIAKDAMSHglkSKIPFNVTPGSEQIRATIERDGISEVFDKFGGTVLANACGPCIGQwdrkDVK 469
Cdd:TIGR01342 291 IGSCTNGAFEDLLPAAKLLEGREVH---KDTEFAVAPGSKQALELIAQEGALAEFLAAGANFLEAACGACIGI----GFA 363
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902  470 KGDKNTIVTSYNRNFTGRNdANPATHCFVTSPELVTALSIAGRL-DFNPLTDELTgadgkkfKLKAPfGDELPAK---GF 545
Cdd:TIGR01342 364 PASDGVSLRSFNRNFEGRA-GIEDAKVYLASPETATAAAIAGEIiDPRDLADDEG-------DLEAI-GFEMGEKfpgGY 434
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902  546 DPGqDTYTAPPPSGENVKVAVDPKSTRLQLLEPFdkwnGQDLTDlTVLIKVKGKCTTDHISAAGP-WLKYRGHLDNISNN 624
Cdd:TIGR01342 435 DAA-DIDIIPKEEREDDDIIKGPNIKPLPEFDPL----GADIEG-ETALIMEDNITTDHIIPAGAdILKFRSNIEAISEF 508
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902  625 MFigatNYENNEMnniknqrngswggVPDvARDYKANGIKWVAVGDENYGEGSSREHAALEPRHLGGRAIIVKSFARIHE 704
Cdd:TIGR01342 509 TL----HRIDDEF-------------AER-AKAADEKGKAGIIIAGENYGQGSSREHAALAPMFLGVEAVIAKSFARIHH 570
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902  705 TNLKKQGLLPLTFANPADYDKIQPTSKISLLNLKSLAPGKPVDAEIKNGDKVERIKLNHTLNDLQIGWFKAGSALNRMKE 784
Cdd:TIGR01342 571 ANLFNFGILPLEFDNEEDYAKFELGDDIEIPDDLAAALADGEDEFTINKNDDEEALATLDASEREKEILAAGGKLNLIKN 650
AcnA_Mitochon_Swivel cd01578
Mitochondrial aconitase A swivel domain. Aconitase (also known as aconitate hydratase and ...
595-743 1.19e-104

Mitochondrial aconitase A swivel domain. Aconitase (also known as aconitate hydratase and citrate hydro-lyase) catalyzes the reversible isomerization of citrate and isocitrate as part of the TCA cycle. This is the aconitase swivel domain, which undergoes swivelling conformational change in the enzyme mechanism. In eukaryotes two isozymes of aconitase are known to exist: one found in the mitochondrial matrix and the other found in the cytoplasm. This is the mitochondrial form. The mitochondrial product is coded by a nuclear gene. Most members of this subfamily are mitochondrial but there are some bacterial members.


Pssm-ID: 238810 [Multi-domain]  Cd Length: 149  Bit Score: 317.49  E-value: 1.19e-104
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 595 KVKGKCTTDHISAAGPWLKYRGHLDNISNNMFIGATNYENNEMNNIKNQRNGSWGGVPDVARDYKANGIKWVAVGDENYG 674
Cdd:cd01578    1 KAKGKCTTDHISAAGPWLKYRGHLDNISNNLLIGAINAENGKANSVKNQVTGEYGPVPDTARDYKAHGIKWVVIGDENYG 80
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 665408902 675 EGSSREHAALEPRHLGGRAIIVKSFARIHETNLKKQGLLPLTFANPADYDKIQPTSKISLLNLKSLAPG 743
Cdd:cd01578   81 EGSSREHAALEPRHLGGRAIITKSFARIHETNLKKQGLLPLTFADPADYDKIHPDDKVDILGLTDFAPG 149
AcnA_Bact cd01585
Aconitase catalyzes the reversible isomerization of citrate and isocitrate as part of the TCA ...
101-513 1.74e-97

Aconitase catalyzes the reversible isomerization of citrate and isocitrate as part of the TCA cycle; Bacterial Aconitase-like catalytic domain. Aconitase (aconitate hydratase or citrate hydrolyase) catalyzes the reversible isomerization of citrate and isocitrate as part of the TCA cycle. Cis-aconitate is formed as an intermediate product during the course of the reaction. This distinct subfamily is found only in bacteria and Archaea. Its exact characteristics are not known.


Pssm-ID: 153135  Cd Length: 380  Bit Score: 307.84  E-value: 1.74e-97
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 101 DRVAMQDATAQMALLQFISSGLKKVAVPSTV-HCDHLIEAQigGPKdlarakdlNKEVYDFLASTCAKYGLGFWKPGSGI 179
Cdd:cd01585    1 DQTLTQDATGTMAYLQFEAMGVDRVRTELSVsYVDHNTLQT--DFE--------NADDHRFLQTVAARYGIYFSRPGNGI 70
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 180 IHQIILENYAFPGLLMIGTDSHTPNGGGLGGLCIGVGGADAVDVMADIPWELKCPKVIGVNLTGKISGWTSPKDVILKVA 259
Cdd:cd01585   71 CHQVHLERFAVPGKTLLGSDSHTPTAGGLGMLAIGAGGLDVALAMAGEPYYIPMPKVVGVRLTGELPPWVTAKDVILELL 150
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 260 DILTVKGGTGAIIEYHGKGVDSISCTGMATICNMGAEIGATTSLFPFNQRMADYLKSTGRAGIASEaqkyqakiLSADKN 339
Cdd:cd01585  151 RRLTVKGGVGKIFEYTGPGVATLSVPERATITNMGAELGATTSIFPSDERTREFLAAQGREDDWVE--------LAADAD 222
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 340 CEYDELIEINLDTLEPHVNGPFTPDLGHPISKLGenskknGYPMDiRVgLIGSCTNSSYEDMGRCASIAKDAMSHglkSK 419
Cdd:cd01585  223 AEYDEEIEIDLSELEPLIARPHSPDNVVPVREVA------GIKVD-QV-AIGSCTNSSYEDLMTVAAILKGRRVH---PH 291
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 420 IPFNVTPGSEQIRATIERDGISEVFDKFGGTVLANACGPCIGQWDrkdvKKGDKNTIVTSYNRNFTGRNdANPATHCFVT 499
Cdd:cd01585  292 VSMVVAPGSKQVLEMLARNGALADLLAAGARILESACGPCIGMGQ----APPTGGVSVRTFNRNFEGRS-GTKDDLVYLA 366
                        410
                 ....*....|....
gi 665408902 500 SPELVTALSIAGRL 513
Cdd:cd01585  367 SPEVAAAAALTGVI 380
acnA PRK12881
aconitate hydratase AcnA;
74-782 3.02e-70

aconitate hydratase AcnA;


Pssm-ID: 237246 [Multi-domain]  Cd Length: 889  Bit Score: 247.92  E-value: 3.02e-70
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902  74 EKVLYSHLDDPANQDIvRGTSYLRL--RPDRVAMQDATAQMALLQFisSGLKKVA-------------VPSTVHCDHLIE 138
Cdd:PRK12881  56 KKVTEEHLEALANWLP-ERKSDDEIpfVPARVVMQDFTGVPALVDL--AAMRDAAaeaggdpakinplVPVDLVVDHSVA 132
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 139 AQIGGPKDlARAKDL------NKEVYDFLA-STCAKYGLGFWKPGSGIIHQIILE--------------NYAFPGLLmIG 197
Cdd:PRK12881 133 VDYFGQKD-ALDLNMkiefqrNAERYQFLKwGMQAFDNFRVVPPGTGIMHQVNLEylarvvhtkeddgdTVAYPDTL-VG 210
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 198 TDSHTP--NGGGLGGLCIGVGGADAVdvMADIPWELKCPKVIGVNLTGKISGWTSPKDVILKVADILTVKGGTGAIIEYH 275
Cdd:PRK12881 211 TDSHTTmiNGIGVLGWGVGGIEAEAV--MLGQPVYMLIPDVVGVELTGKLREGVTATDLVLTVTEMLRKEGVVGKFVEFF 288
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 276 GKGVDSISCTGMATICNMGAEIGATTSLFPFNQRMADYLKSTGR--AGIASEAQKYQAKILSADKNCE--YDELIEINLD 351
Cdd:PRK12881 289 GEGVASLTLGDRATIANMAPEYGATMGFFPVDEQTLDYLRLTGRteAQIALVEAYAKAQGLWGDPKAEprYTRTLELDLS 368
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 352 TLEPHVNGP---------------FTPDLGHPISKLGENSK---KNGYPM---DIRVGLIGSCTNSSyeD---MGRCASI 407
Cdd:PRK12881 369 TVAPSLAGPkrpqdrialgnvksaFSDLFSKPVAENGFAKKaqtSNGVDLpdgAVAIAAITSCTNTS--NpsvLIAAGLL 446
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 408 AKDAMSHGLKSK--IPFNVTPGSEQIRATIERDGISEVFDKFGGTVLANACGPCIGQWD------RKDVKKGD-KNTIVT 478
Cdd:PRK12881 447 AKKAVERGLTVKpwVKTSLAPGSKVVTEYLERAGLLPYLEKLGFGIVGYGCTTCIGNSGpltpeiEQAITKNDlVAAAVL 526
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 479 SYNRNFTGRNDANpATHCFVTSPELVTALSIAGRLDFNPLTDEL-TGADGKKFKLKA--PFG---DELPAKGFDPGQ--- 549
Cdd:PRK12881 527 SGNRNFEGRIHPN-IKANFLASPPLVVAYALAGTVRRDLMTEPLgKGKDGRPVYLKDiwPSSaeiDALVAFAVDPEDfrk 605
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 550 --DTYTAPPPSGENVKVAV------DPKSTRLQllEP--FDKWNGQ-----DLTDLTVLIKVKGKCTTDHIS-------- 606
Cdd:PRK12881 606 nyAEVFKGSELWAAIEAPDgplydwDPKSTYIR--RPpfFDFSMGPaasiaTVKGARPLAVLGDSITTDHISpagaikad 683
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 607 -AAGPWLKYRG---------------HL---------DNISNNMFIGAtnyennEMNNIKNQRNGSWGGVPDVARDYKAN 661
Cdd:PRK12881 684 sPAGKYLKENGvpkadfnsygsrrgnHEvmmrgtfanVRIKNLMIPGK------EGGLTLHQPSGEVLSIYDAAMRYQAA 757
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 662 GIKWVAVGDENYGEGSSREHAALEPRHLGGRAIIVKSFARIHETNLKKQGLLPLTFA---NPADYdKIQPTSKISLLNLK 738
Cdd:PRK12881 758 GTPLVVIAGEEYGTGSSRDWAAKGTRLLGVKAVIAESFERIHRSNLVGMGVLPLQFKggdSRQSL-GLTGGETFDIEGLP 836
                        810       820       830       840
                 ....*....|....*....|....*....|....*....|....*....
gi 665408902 739 S-LAPGKPVDAEIKNGD-KVERIKLN---HTLNDLQIgwFKAGSALNRM 782
Cdd:PRK12881 837 GeIKPRQDVTLVIHRADgSTERVPVLcriDTPIEVDY--YKAGGILPYV 883
PRK09277 PRK09277
aconitate hydratase AcnA;
99-757 4.62e-67

aconitate hydratase AcnA;


Pssm-ID: 236445 [Multi-domain]  Cd Length: 888  Bit Score: 238.87  E-value: 4.62e-67
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902  99 RPDRVAMQDATAQMAL--LqfisSGLKKVAV-----PSTVH--------CDHLIEAQIGGPKD-LARAKDL----NKEVY 158
Cdd:PRK09277  83 RPARVVMQDFTGVPAVvdL----AAMRDAIAdlggdPAKINplvpvdlvIDHSVQVDYFGTPDaFEKNVELeferNEERY 158
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 159 DFLastcaKYGLGFWK------PGSGIIHQIILE-------------NYAFPGLLmIGTDSHTPnggglgglcigvggad 219
Cdd:PRK09277 159 QFL-----KWGQKAFDnfrvvpPGTGICHQVNLEylapvvwtredgeLVAYPDTL-VGTDSHTT---------------- 216
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 220 AVD----------------VMADIPWELKCPKVIGVNLTGKISGWTSPKDVILKVADILTVKGGTGAIIEYHGKGVDSIS 283
Cdd:PRK09277 217 MINglgvlgwgvggieaeaAMLGQPSSMLIPEVVGVKLTGKLPEGVTATDLVLTVTEMLRKKGVVGKFVEFFGEGLASLS 296
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 284 CTGMATICNMGAEIGATTSLFPFNQRMADYLKSTGRagiaSEAQ-----KYqAKI----LSADKNCEYDELIEINLDTLE 354
Cdd:PRK09277 297 LADRATIANMAPEYGATCGFFPIDEETLDYLRLTGR----DEEQvalveAY-AKAqglwRDPLEEPVYTDVLELDLSTVE 371
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 355 PHVNGP-------FTPDLGHPISKLGENSKKNGYPMDIRVGL-------------IGSCTNSS--YEDMGrCASIAKDAM 412
Cdd:PRK09277 372 PSLAGPkrpqdriPLSDVKEAFAKSAELGVQGFGLDEAEEGEdyelpdgavviaaITSCTNTSnpSVMIA-AGLLAKKAV 450
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 413 SHGLKSKiPFNVT---PGSEQIRATIERDGISEVFDKFGGTVLANACGPCIG---------QwdrKDVKKGD-KNTIVTS 479
Cdd:PRK09277 451 EKGLKVK-PWVKTslaPGSKVVTDYLEKAGLLPYLEALGFNLVGYGCTTCIGnsgplppeiE---KAINDNDlVVTAVLS 526
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 480 YNRNFTGR----NDANpathcFVTSPELVTALSIAGRLDFNPLTDEL-TGADGKKFKLKA--PFGDE---LPAKGFDPGQ 549
Cdd:PRK09277 527 GNRNFEGRihplVKAN-----YLASPPLVVAYALAGTVDIDLEKDPLgTDKDGNPVYLKDiwPSDEEidaVVAKAVKPEM 601
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 550 --DTYtAP----PPSGENVKVAV------DPKSTRLQlLEPFdkWNG--------QDLTDLTVLIKVKGKCTTDHIS--- 606
Cdd:PRK09277 602 frKEY-ADvfegDERWNAIEVPEgplydwDPDSTYIR-NPPY--FEGmlaepgpvRDIKGARVLALLGDSITTDHISpag 677
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 607 ------AAGPWLK-----------Y-----------RGHLDNIsnnmfigatnyennemnNIKNQ-RNGSWGGV----P- 652
Cdd:PRK09277 678 aikadsPAGKYLLehgvepkdfnsYgsrrgnhevmmRGTFANI-----------------RIRNEmVPGVEGGYtrhfPe 740
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 653 -------DVARDYKANGIKWVAVGDENYGEGSSREHAALEPRHLGGRAIIVKSFARIHETNLKKQGLLPLTFANPADYD- 724
Cdd:PRK09277 741 gevmsiyDAAMKYKEEGTPLVVIAGKEYGTGSSRDWAAKGTRLLGVKAVIAESFERIHRSNLVGMGVLPLQFKPGESRKt 820
                        810       820       830
                 ....*....|....*....|....*....|....*.
gi 665408902 725 -KIQPTSKISLLNLKSLAPGKPVDAEI--KNGDKVE 757
Cdd:PRK09277 821 lGLDGTETFDIEGLEDLKPGATVTVVItrADGEVVE 856
PRK00402 PRK00402
3-isopropylmalate dehydratase large subunit; Reviewed
69-513 1.70e-66

3-isopropylmalate dehydratase large subunit; Reviewed


Pssm-ID: 234748  Cd Length: 418  Bit Score: 226.60  E-value: 1.70e-66
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902  69 PLTLSEKVLYSHLDDPanqdiVRGTSYLRLRPDRVAMQDATAQMALLQFISSGLKKVAVPSTVH--CDHLIEAqiggpKD 146
Cdd:PRK00402   2 GMTLAEKILARHSGRD-----VSPGDIVEAKVDLVMAHDITGPLAIKEFEKIGGDKVFDPSKIVivFDHFVPA-----KD 71
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 147 LARAKDLnKEVYDFLAstcaKYGL-GFWKPGSGIIHQIILEN-YAFPGLLMIGTDSHTPNggglgglcigvggADAVDVM 224
Cdd:PRK00402  72 IKSAEQQ-KILREFAK----EQGIpNFFDVGEGICHQVLPEKgLVRPGDVVVGADSHTCT-------------YGALGAF 133
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 225 A------DIP--------WeLKCPKVIGVNLTGKISGWTSPKDVILKVADILTVKGGTGAIIEYHGKGVDSISCTGMATI 290
Cdd:PRK00402 134 AtgmgstDMAaamatgktW-FKVPETIKVVLEGKLPPGVTAKDVILHIIGDIGVDGATYKALEFTGETIEALSMDERMTL 212
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 291 CNMGAEIGATTSLFPFNQRMADYLKstgragiasEAQKYQAKILSADKNCEYDELIEINLDTLEPHVNGPFTPDLGHPIS 370
Cdd:PRK00402 213 ANMAIEAGAKAGIFAPDEKTLEYLK---------ERAGRDYKPWKSDEDAEYEEVYEIDLSKLEPQVAAPHLPDNVKPVS 283
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 371 KLGenskknGYPMDIRVglIGSCTNSSYEDMGRCASIAKDamsHGLKSKIPFNVTPGSEQIRATIERDGISEVFDKFGGT 450
Cdd:PRK00402 284 EVE------GTKVDQVF--IGSCTNGRLEDLRIAAEILKG---RKVAPGVRLIVIPASQKIYLQALKEGLIEIFVDAGAV 352
                        410       420       430       440       450       460
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 665408902 451 VLANACGPCIGqwdrkdvkkG------DKNTIVTSYNRNFTGRNdANPATHCFVTSPELVTALSIAGRL 513
Cdd:PRK00402 353 VSTPTCGPCLG---------GhmgvlaPGEVCLSTTNRNFKGRM-GSPESEVYLASPAVAAASAVTGKI 411
IPMI cd01583
3-isopropylmalate dehydratase catalyzes the isomerization between 2-isopropylmalate and ...
102-513 4.76e-66

3-isopropylmalate dehydratase catalyzes the isomerization between 2-isopropylmalate and 3-isopropylmalate; Aconatase-like catalytic domain of 3-isopropylmalate dehydratase and related uncharacterized proteins. 3-isopropylmalate dehydratase catalyzes the isomerization between 2-isopropylmalate and 3-isopropylmalate, via the formation of 2-isopropylmaleate 3-isopropylmalate. IPMI is involved in fungal and bacterial leucine biosynthesis and is also found in eukaryotes.


Pssm-ID: 153133 [Multi-domain]  Cd Length: 382  Bit Score: 224.38  E-value: 4.76e-66
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 102 RVAMQDATAQMALLQFISSGLKKVAVPSTVHC--DHLIEAqiggPKDLARakdlnkEVYDFLASTCAKYGLGFWKPG-SG 178
Cdd:cd01583    1 LHLVHDVTSPQAFEGLREAGREKVWDPEKIVAvfDHNVPT----PDIKAA------EQVKTLRKFAKEFGINFFDVGrQG 70
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 179 IIHQIILENYAF-PGLLMIGTDSHTPNGGGLGGLCIGVGGADAVDVMA--DIpWeLKCPKVIGVNLTGKISGWTSPKDVI 255
Cdd:cd01583   71 ICHVILPEKGLTlPGMTIVGGDSHTCTHGAFGAFATGIGTTDVAHVLAtgKL-W-FRVPETMRVNVEGKLPPGVTAKDVI 148
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 256 LKVADILTVKGGTGAIIEYHGKGVDSISCTGMATICNMGAEIGATTSLFPFNQRMADYLKSTGRAgiaseaqkyQAKILS 335
Cdd:cd01583  149 LYIIGKIGVDGATYKAMEFAGEAIESLSMEERMTLCNMAIEAGAKAGIVAPDETTFEYLKGRGKA---------YWKELK 219
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 336 ADKNCEYDELIEINLDTLEPHVNGPFTPDLGHPISKLGenskknGYPMDIRVglIGSCTNSSYEDMGRCASIAKDamsHG 415
Cdd:cd01583  220 SDEDAEYDKVVEIDASELEPQVAWPHSPDNVVPVSEVE------GIKIDQVF--IGSCTNGRLEDLRAAAEILKG---RK 288
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 416 LKSKIPFNVTPGSEQIRATIERDGISEVFDKFGGTVLANACGPCIGQWDrkDVKKGDKNTIVTSyNRNFTGR-NDANPAT 494
Cdd:cd01583  289 VADGVRLIVVPASQRVYKQAEKEGLIEIFIEAGAEVRPPGCGACLGGHM--GVLAPGERCVSTS-NRNFKGRmGSPGARI 365
                        410
                 ....*....|....*....
gi 665408902 495 HcfVTSPELVTALSIAGRL 513
Cdd:cd01583  366 Y--LASPATAAASAITGEI 382
PTZ00092 PTZ00092
aconitate hydratase-like protein; Provisional
101-780 3.01e-62

aconitate hydratase-like protein; Provisional


Pssm-ID: 240263 [Multi-domain]  Cd Length: 898  Bit Score: 225.28  E-value: 3.01e-62
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 101 DRVAMQDATAQMALlqfissGLKKV--AVPSTVHCDHLIEAQIGGPKDlARAKDL------NKEVYDFLastcaKYGLGF 172
Cdd:PTZ00092 106 DLAAMRDAMKRLGG------DPAKInpLVPVDLVIDHSVQVDFSRSPD-ALELNQeieferNLERFEFL-----KWGSKA 173
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 173 WK------PGSGIIHQIILENYA---FP--GLL----MIGTDSHTP--NGGGLGGLCIGVGGADAVdvMADIPWELKCPK 235
Cdd:PTZ00092 174 FKnllivpPGSGIVHQVNLEYLArvvFNkdGLLypdsVVGTDSHTTmiNGLGVLGWGVGGIEAEAV--MLGQPISMVLPE 251
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 236 VIGVNLTGKISGWTSPKDVILKVADILTVKGGTGAIIEYHGKGVDSISCTGMATICNMGAEIGATTSLFPFNQRMADYLK 315
Cdd:PTZ00092 252 VVGFKLTGKLSEHVTATDLVLTVTSMLRKRGVVGKFVEFYGPGVKTLSLADRATIANMAPEYGATMGFFPIDEKTLDYLK 331
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 316 STGRAgiaSEAQKYQAKILSA-------DKNCEYDELIEINLDTLEPHVNGP---------------FTPDLGHPISKLG 373
Cdd:PTZ00092 332 QTGRS---EEKVELIEKYLKAnglfrtyAEQIEYSDVLELDLSTVVPSVAGPkrphdrvplsdlkkdFTACLSAPVGFKG 408
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 374 -----ENSKK------NGYPMDIRVG-----LIGSCTNSSYED-MGRCASIAKDAMSHGLKSK--IPFNVTPGSEQIRAT 434
Cdd:PTZ00092 409 fgipeEKHEKkvkftyKGKEYTLTHGsvviaAITSCTNTSNPSvMLAAGLLAKKAVEKGLKVPpyIKTSLSPGSKVVTKY 488
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 435 IERDGISEVFDKFGGTVLANACGPCIGqwDRKDVKKGDKNTI---------VTSYNRNFTGRndANPATHC-FVTSPELV 504
Cdd:PTZ00092 489 LEASGLLKYLEKLGFYTAGYGCMTCIG--NSGDLDPEVSEAItnndlvaaaVLSGNRNFEGR--VHPLTRAnYLASPPLV 564
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 505 TALSIAGRLDFN----PLTDELTG-----------------------------------ADGKKF--KLKAPFGDELPak 543
Cdd:PTZ00092 565 VAYALAGRVNIDfetePLGSDKTGkpvflrdiwpsreeiqaleakyvkpemfkevysniTQGNKQwnELQVPKGKLYE-- 642
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 544 gFDPgQDTYTAPPPSGENVKVAVDPKstrlqllepfdkwngQDLTDLTVLIKVKGKCTTDHISAAG------PWLKY--- 614
Cdd:PTZ00092 643 -WDE-KSTYIHNPPFFQTMELEPPPI---------------KSIENAYCLLNLGDSITTDHISPAGniaknsPAAKYlme 705
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 615 ----------------------RGHLDNIS-NNMFIGATN-----YENNEMNNIKnqrngswggvpDVARDYKANGIKWV 666
Cdd:PTZ00092 706 rgverkdfntygarrgndevmvRGTFANIRlINKLCGKVGpntvhVPTGEKMSIY-----------DAAEKYKQEGVPLI 774
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 667 AVGDENYGEGSSREHAALEPRHLGGRAIIVKSFARIHETNLKKQGLLPLTFAN--PADYDKIQPTSKISL-LNLKSLAPG 743
Cdd:PTZ00092 775 VLAGKEYGSGSSRDWAAKGPYLQGVKAVIAESFERIHRSNLVGMGILPLQFLNgeNADSLGLTGKEQFSIdLNSGELKPG 854
                        810       820       830       840
                 ....*....|....*....|....*....|....*....|
gi 665408902 744 KPVDAEIKNG---DKVERIKlnhtlNDLQIGWFKAGSALN 780
Cdd:PTZ00092 855 QDVTVKTDTGktfDTILRID-----TEVEVEYFKHGGILQ 889
LeuC COG0065
Homoaconitase/3-isopropylmalate dehydratase large subunit [Amino acid transport and metabolism] ...
68-513 7.73e-62

Homoaconitase/3-isopropylmalate dehydratase large subunit [Amino acid transport and metabolism];


Pssm-ID: 223143  Cd Length: 423  Bit Score: 213.99  E-value: 7.73e-62
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902  68 RPLTLSEKVLYSHL--DDPANQDIVRgtsylrLRPDRVAMQDATAQMALLQFISSGlKKVAVPSTVHC--DHLIeaqigg 143
Cdd:COG0065    1 SAKTLYEKILDAHVgkEEVGAGETVL------LYIDLHLVHDVTSPQAFEGLREAG-RKVRDPEKTVAtfDHNV------ 67
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 144 PKDLARAKDLNKEVYDFlastCAKYGL-GFWKPGS-GIIHQIILEN-YAFPGLLMIGTDSHTPNGGGLGGLCIGVGGADA 220
Cdd:COG0065   68 PTPDIKAAEQQKELREN----AKEFGIvNFYDVGDqGIVHQVGPEQgLTLPGMTIVGGDSHTCTHGAFGAFAFGIGTTDV 143
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 221 VDVMADIPWELKCPKVIGVNLTGKISGWTSPKDVILKVADILTVKGGTGAIIEYHGKGVDSISCTGMATICNMGAEIGAT 300
Cdd:COG0065  144 AHVLATGKLWFRVPKTMKVEVEGKLPPGVTAKDIILALIGKIGVDGGTGYAIEFAGEAIRSLSMEGRMTLCNMAIEAGAK 223
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 301 TSLFPFNQRMADYLKstgragiASEAQKYQAKILSADKNCEYDELIEINLDTLEPHVNGPFTPDLGHPISKLGenskkng 380
Cdd:COG0065  224 AGIIAPDETTFEYLK-------EWDGAVAYWKTLKSDEDAVYDKVVELDASDLEPQVAWPTNPDNVVPVSEVE------- 289
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 381 yPMDIRVG--LIGSCTNSSYEDMGRCASIAKDamsHGLKSKIPFNVTPGSEQIRATIERDGISEVFDKFGGTVLANACGP 458
Cdd:COG0065  290 -PDPIKIDqvFIGSCTNGRIEDLRAAAEILKG---RKVAPGVRAIVVPGSRRVKEQAEKEGLDKIFIEAGFEWREPGCGP 365
                        410       420       430       440       450
                 ....*....|....*....|....*....|....*....|....*....|....*
gi 665408902 459 CIGQWDrkDVKKGDKNTIVTSyNRNFTGRNdANPATHCFVTSPELVTALSIAGRL 513
Cdd:COG0065  366 CLGMHP--GVLGPGERCASTS-NRNFEGRQ-GSPGARTYLASPAMAAAAAVEGEI 416
PLN00070 PLN00070
aconitate hydratase
99-753 2.15e-57

aconitate hydratase


Pssm-ID: 215047 [Multi-domain]  Cd Length: 936  Bit Score: 211.59  E-value: 2.15e-57
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902  99 RPDRVAMQDATAQMAL--LQFISSGLKKVA---------VPSTVHCDHLIEAQIGGPKDLARAK-----DLNKEVYDFLa 162
Cdd:PLN00070 121 KPARVLLQDFTGVPAVvdLACMRDAMNNLGgdpnkinplVPVDLVIDHSVQVDVARSENAVQANmelefQRNKERFAFL- 199
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 163 stcaKYGLGFWK------PGSGIIHQIILENYA-----FPGLL----MIGTDSHTPNGGGLGGLCIGVGGADAVDVMADI 227
Cdd:PLN00070 200 ----KWGSTAFQnmlvvpPGSGIVHQVNLEYLGrvvfnTDGILypdsVVGTDSHTTMIDGLGVAGWGVGGIEAEAAMLGQ 275
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 228 PWELKCPKVIGVNLTGKISGWTSPKDVILKVADILTVKGGTGAIIEYHGKGVDSISCTGMATICNMGAEIGATTSLFPFN 307
Cdd:PLN00070 276 PMSMVLPGVVGFKLSGKLRDGVTATDLVLTVTQMLRKHGVVGKFVEFYGEGMSELSLADRATIANMSPEYGATMGFFPVD 355
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 308 QRMADYLKSTGRAG-IASEAQKY-QAKILSADKNCE-----YDELIEINLDTLEPHVNGPFTPDLGHPI----------- 369
Cdd:PLN00070 356 HVTLQYLKLTGRSDeTVAMIEAYlRANKMFVDYNEPqqervYSSYLELDLEDVEPCISGPKRPHDRVPLkemkadwhscl 435
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 370 -SKLG--------ENSKK------NGYPMDIRVG-----LIGSCTNSSYED-MGRCASIAKDAMSHGLKSK--IPFNVTP 426
Cdd:PLN00070 436 dNKVGfkgfavpkEAQSKvakfsfHGQPAELRHGsvviaAITSCTNTSNPSvMLGAGLVAKKACELGLEVKpwIKTSLAP 515
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 427 GSEQIRATIERDGISEVFDKFGGTVLANACGPCI---GQWDRKDVKKGDKNTIVT----SYNRNFTGRndANPATHC-FV 498
Cdd:PLN00070 516 GSGVVTKYLLKSGLQKYLNQQGFHIVGYGCTTCIgnsGELDESVASAITENDIVAaavlSGNRNFEGR--VHPLTRAnYL 593
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 499 TSPELVTALSIAGRLDFNPLTDEL-TGADGKKFKLKA--PFGDE---------LPakgfDPGQDTYTA-----------P 555
Cdd:PLN00070 594 ASPPLVVAYALAGTVDIDFEKEPIgTGKDGKDVFFRDiwPSNEEvaevvqssvLP----DMFKSTYEAitkgnpmwnqlS 669
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 556 PPSGenVKVAVDPKSTRLQllEP-------FDKWNGQDLTDLTVLIKVKGKCTTDHISAAG------PWLKY---RGhLD 619
Cdd:PLN00070 670 VPSG--TLYSWDPKSTYIH--EPpyfknmtMSPPGPHGVKDAYCLLNFGDSITTDHISPAGsihkdsPAAKYlmeRG-VD 744
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 620 NISNNMFigATNYENNEM------NNIK--NQR-NGSWG------------GVPDVARDYKANGIKWVAVGDENYGEGSS 678
Cdd:PLN00070 745 RKDFNSY--GSRRGNDEImargtfANIRivNKLlKGEVGpktvhiptgeklSVFDAAMKYKSEGHDTIILAGAEYGSGSS 822
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 679 REHAALEPRHLGGRAIIVKSFARIHETNLKKQGLLPLTFANPADYDKIQPTS----KISL-LNLKSLAPGKPVDAEIKNG 753
Cdd:PLN00070 823 RDWAAKGPMLLGVKAVIAKSFERIHRSNLVGMGIIPLCFKSGEDADTLGLTGheryTIDLpSNISEIKPGQDVTVTTDNG 902
Aconitase_C pfam00694
Aconitase C-terminal domain; Members of this family usually also match to pfam00330. This ...
592-720 4.85e-51

Aconitase C-terminal domain; Members of this family usually also match to pfam00330. This domain undergoes conformational change in the enzyme mechanism.


Pssm-ID: 395564 [Multi-domain]  Cd Length: 131  Bit Score: 174.48  E-value: 4.85e-51
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902  592 VLIKVKGKCTTDHISAAGPWLKYRGHLDNISNNMFIGATNYENNEMNNIKNQRNGSWGGVPDVARDYKANGIKWVAVGDE 671
Cdd:pfam00694   3 RFLTLKGLTTPDFNSNVDTDLIIPKQFLGTIANIGIGNINFEGWRAGKTTHLPDGENPDFYDAAERYKQHGAPIVVIAGK 82
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*....
gi 665408902  672 NYGEGSSREHAALEPRHLGGRAIIVKSFARIHETNLKKQGLLPLTFANP 720
Cdd:pfam00694  83 NYGCGSSREHAAWALRDLGIKAVIAESFARIHRNNLIKNGLLPLEFPRE 131
AcnA_IRP cd01586
Aconitase A catalytic domain; Aconitase A catalytic domain. This is the major form of the TCA ...
102-512 4.45e-41

Aconitase A catalytic domain; Aconitase A catalytic domain. This is the major form of the TCA cycle enzyme aconitate hydratase, also known as aconitase and citrate hydrolyase. It includes bacterial and archaeal aconitase A, and the eukaryotic cytosolic form of aconitase. This group also includes sequences that have been shown to act as an iron-responsive element (IRE) binding protein in animals and may have the same role in other eukaryotes.


Pssm-ID: 153136  Cd Length: 404  Bit Score: 155.54  E-value: 4.45e-41
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 102 RVAMQDATAQMALLQFIS--SGLKKV---------AVPSTVHCDHLIEAQIGGPKDlARAKDL------NKEVYDFLast 164
Cdd:cd01586    1 RVILQDFTGVPAVVDLAAmrDAVKRLggdpekinpLIPVDLVIDHSVQVDFYGTAD-ALAKNMkleferNRERYEFL--- 76
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 165 caKYGLGFWK------PGSGIIHQIILE--------------NYAFPGLLmIGTDSHTPNGGGLGGLCIGVGGADAVDVM 224
Cdd:cd01586   77 --KWGQKAFKnlrvvpPGTGIIHQVNLEylarvvftseedgdGVAYPDSV-VGTDSHTTMINGLGVLGWGVGGIEAEAVM 153
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 225 ADIPWELKCPKVIGVNLTGKISGWTSPKDVILKVADILTVKGGTGAIIEYHGKGVDSISCTGMATICNMGAEIGATTSLF 304
Cdd:cd01586  154 LGQPISMLLPEVVGVKLTGKLRPGVTATDLVLTVTQMLRKVGVVGKFVEFFGPGVAKLSVADRATIANMAPEYGATCGFF 233
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 305 PFNqrmadylkstgragiaseaqkyqakilsadknceyDELIEINLDTLEPHVNGPFTPDLGHPIsklgenskkNGypmD 384
Cdd:cd01586  234 PVD-----------------------------------TQVVELDLSTVEPSVSGPKRPQDRVPL---------HG---S 266
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 385 IRVGLIGSCTNSSYED-MGRCASIAKDAMSHGLKSK--IPFNVTPGSEQIRATIERDGISEVFDKFGGTVLANACGPCIG 461
Cdd:cd01586  267 VVIAAITSCTNTSNPSvMLAAGLLAKKAVELGLKVKpyVKTSLAPGSRVVTKYLEASGLLPYLEKLGFHVVGYGCTTCIG 346
                        410       420       430       440       450
                 ....*....|....*....|....*....|....*....|....*....|....*....
gi 665408902 462 ------QWDRKDVKKGD-KNTIVTSYNRNFTGRndANPATHC-FVTSPELVTALSIAGR 512
Cdd:cd01586  347 nsgplpEEVEEAIKENDlVVAAVLSGNRNFEGR--IHPLVRAnYLASPPLVVAYALAGT 403
h_aconitase TIGR00139
homoaconitase; Homoaconitase is known only as a fungal enzyme from two species, where it is ...
69-715 6.91e-41

homoaconitase; Homoaconitase is known only as a fungal enzyme from two species, where it is part of an unusual lysine biosynthesis pathway. Because this model is based on just two sequences from a narrow taxonomic range, it may not recognize distant orthologs, should any exist. Homoaconitase, aconitase, and 3-isopropylmalate dehydratase have similar overall structures, but 3-isopropylmalate dehydratase is split into large (leuC) and small (leuD) chains in eubacteria. Several pairs of archaeal proteins resemble leuC and leuD over their lengths but are even closer to the respective domains of homoaconitase, and their identity is uncertain. [Amino acid biosynthesis, Aspartate family]


Pssm-ID: 129245 [Multi-domain]  Cd Length: 712  Bit Score: 160.21  E-value: 6.91e-41
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902   69 PLTLSEKVLYSHLDDPANQDIVRGTSYLRLRPDRVAMQDATAQMALlQFISSGLKKVAVPSTV--HCDHlieaqiggpkD 146
Cdd:TIGR00139   1 GQNLTEKIVQKYAVGLPEGKFVHSGDYVSIKPAHCMSHDNSWPCAL-KFMGIGASKIHNPDQIvmTLDH----------D 69
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902  147 LARAKDLNKEVYDFLASTCAKYGLGFWKPGSGIIHQIILEN-YAFPGLLMIGTDSHTPNGGGLGGLCIGVGGADAVDVMA 225
Cdd:TIGR00139  70 IQNKSDKNLKKYKNIEEFAKKHGIDFYPAGRGIGHQIMIEEgFAFPGNLAVASDSHSNMYGGLGCLGTPIVRTDAAAIWA 149
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902  226 DIPWELKCPKVIGVNLTGKISGWTSPKDVILKVADILTVKGGTGAIIEYHGKG--VDSISCTGMATICNMGAEIGATTSL 303
Cdd:TIGR00139 150 TGKTWWQIPPVAKVEFKGQLPPGVSGKDIIVALCGLFNKDDVLNHAIEFTGSEdsLNALPIDHRLTIANMTTEWGALSGL 229
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902  304 FPFNQRMADYLK---STGRAGIASEAQKYQAKI--------------LSADKNCEYDELIEINLDTLEPHVNGPFTPDLG 366
Cdd:TIGR00139 230 FPIDKTLIDWLKgkaTLAALGLADGPFINPAAErfthpaleekaeipLKADKDAHYAKELFIDLASLSHYVSGPNSVKVA 309
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902  367 HPISKLGENSKKngypmdIRVGLIGSCTNSSYEDMGRCASIAKDAMSHGlKSKIP-------FNVTPGSEQIRATIERDG 439
Cdd:TIGR00139 310 NPLKDLEAQDIK------IDKAYLVSCTNSRASDIAAAADVFCEAADKN-GGKINkiapgveFYIAAASIEEEAAAEGNG 382
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902  440 ISEVFDKFGGTVLANACGPCIGQwDRKDVKKGDKNtiVTSYNRNFTGRNDANPAThCFVTSPELVTALSIAGRLDfNPlt 519
Cdd:TIGR00139 383 AWEKLLEAGAIPLPAGCGPCIGL-GAGLLEPGEVG--ISASNRNFKGRMGSKDAK-AYLASPAVVAASALLGKIS-GP-- 455
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902  520 DELTGADGKKfklKAPFGDELPAKGFDPGQDTYTAPPPSGENVKVAVDPKSTRLQLLEPFDKWNGQDLTDLTVLI--KVK 597
Cdd:TIGR00139 456 AEVLSPEGWT---EIIFGEGDGIKEEDRMLTNEEALEKIIGIIDDLVADEEKNAASEAPAQEESEQGLTEILEGFpeEFS 532
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902  598 GK---CTTDHISAAGPWLKYRGHLDNISNNMF--IGATNYEnnemnniknqrngswggvPDVARDYKANGIkwvAVGDEN 672
Cdd:TIGR00139 533 GElvfCDADNINTDGIYPGKYTYQDDVPKEKMaqVCMENYD------------------AEFRTKAHEGDI---LVSGFN 591
                         650       660       670       680
                  ....*....|....*....|....*....|....*....|...
gi 665408902  673 YGEGSSREHAALEPRHLGGRAIIVKSFARIHETNLKKQGLLPL 715
Cdd:TIGR00139 592 FGCGSSREQAATAILAKGINLVVSGSFGNIFSRNSINNALLGL 634
Homoaconitase cd01582
Homoaconitase and other uncharacterized proteins of the Aconitase family; Homoaconitase ...
115-513 3.52e-32

Homoaconitase and other uncharacterized proteins of the Aconitase family; Homoaconitase catalytic domain. Homoaconitase and other uncharacterized proteins of the Aconitase family. Homoaconitase is part of an unusual lysine biosynthesis pathway found only in filamentous fungi, in which lysine is synthesized via the alpha-aminoadipate pathway. In this pathway, homoaconitase catalyzes the conversion of cis-homoaconitic acid into homoisocitric acid. The reaction mechanism is believed to be similar to that of other aconitases.


Pssm-ID: 153132  Cd Length: 363  Bit Score: 128.50  E-value: 3.52e-32
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 115 LQFISSGLKKVAVPSTVHC--DHlieaqiggpkDLARAKDLNKEVYDFLASTCAKYGLGFWKPGSGIIHQIILEN-YAFP 191
Cdd:cd01582   13 LKFMSIGATKIHNPDQIVMtlDH----------DVQNKSEKNLKKYKNIESFAKKHGIDFYPAGRGIGHQIMIEEgYAFP 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 192 GLLMIGTDSHTPNGGGLGGLCIGVGGADAVDVMADIPWELKCPKVIGVNLTGKISGWTSPKDVILKVADILTVKGGTGAI 271
Cdd:cd01582   83 GTLAVASDSHSNMYGGVGCLGTPIVRTDAAAIWATGQTWWQIPPVAKVELKGQLPKGVTGKDVIVALCGLFNKDQVLNHA 162
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 272 IEYHGKGVDSISCTGMATICNMGAEIGATTSLFPFNQRmadylkstgragiaseaqkyqakilsadknceydELIeINLD 351
Cdd:cd01582  163 IEFTGSGLNSLSVDTRLTIANMTTEWGALSGLFPTDAK----------------------------------HLI-LDLS 207
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 352 TLEPHVNGPFTPDLGHPISKLgenSKKNgypMDIRVGLIGSCTNSSYEDMGRCASIAKDAMSHGLKSK----IPFNVTPG 427
Cdd:cd01582  208 TLSPYVSGPNSVKVSTPLKEL---EAQN---IKINKAYLVSCTNSRASDIAAAADVVKGKKEKNGKIPvapgVEFYVAAA 281
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 428 SEQIRATIERDGISEVFDKFGGTVLANACGPCI--GQWDRKDVKKGdkntiVTSYNRNFTGRNdANPATHCFVTSPELVT 505
Cdd:cd01582  282 SSEVQAAAEKNGDWQTLLEAGATPLPAGCGPCIglGQGLLEPGEVG-----ISATNRNFKGRM-GSTEALAYLASPAVVA 355

                 ....*...
gi 665408902 506 ALSIAGRL 513
Cdd:cd01582  356 ASAISGKI 363
PRK05478 PRK05478
3-isopropylmalate dehydratase large subunit;
161-513 1.95e-30

3-isopropylmalate dehydratase large subunit;


Pssm-ID: 235490  Cd Length: 466  Bit Score: 125.62  E-value: 1.95e-30
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 161 LASTCAKYGLGFWKPGS---GIIHQIILENYA-FPGLLMIGTDSHTpnggglgglcigvggadAV--------------- 221
Cdd:PRK05478  86 LEKNCKEFGITLFDLGDprqGIVHVVGPEQGLtLPGMTIVCGDSHT-----------------SThgafgalafgigtse 148
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 222 --DVMADIPWELKCPKVIGVNLTGKISGWTSPKDVILKVADILTVKGGTGAIIEYHGKGVDSISCTGMATICNMGAEIGA 299
Cdd:PRK05478 149 veHVLATQTLLQKKPKTMKIEVDGKLPPGVTAKDIILAIIGKIGTAGGTGYVIEFAGEAIRALSMEGRMTICNMSIEAGA 228
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 300 TTSLFPFNQRMADYLKstGRA----GIASEAQKYQAKILSADKNCEYDELIEINLDTLEPHVNGPFTPDLGHPISK---- 371
Cdd:PRK05478 229 RAGLVAPDETTFEYLK--GRPfapkGEDWDKAVAYWKTLKSDEDAVFDKVVTLDAADIEPQVTWGTNPGQVISIDGkvpd 306
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 372 ----LGENSKKN------------GYPM-DIRVG--LIGSCTNSSYEDMGRCASIAKDamshglkSKIPFNVT----PGS 428
Cdd:PRK05478 307 pedfADPVKRASaeralaymglkpGTPItDIKIDkvFIGSCTNSRIEDLRAAAAVVKG-------RKVAPGVRalvvPGS 379
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 429 EQIRATIERDGISEVFDKFG------GtvlanaCGPCIGQWDrkDVKKGDKNTIVTSyNRNFTGRNDANPATHcfVTSPE 502
Cdd:PRK05478 380 GLVKAQAEAEGLDKIFIEAGfewrepG------CSMCLAMNP--DKLPPGERCASTS-NRNFEGRQGKGGRTH--LVSPA 448
                        410
                 ....*....|.
gi 665408902 503 LVTALSIAGRL 513
Cdd:PRK05478 449 MAAAAAITGHF 459
AcnA_Bact_Swivel cd01579
Bacterial Aconitase-like swivel domain. Aconitase (aconitate hydratase or citrate hydrolyase) ...
595-734 3.41e-30

Bacterial Aconitase-like swivel domain. Aconitase (aconitate hydratase or citrate hydrolyase) catalyzes the reversible isomerization of citrate and isocitrate as part of the TCA cycle. Cis-aconitate is formed as an intermediate product during the course of the reaction. This is the aconitase-like swivel domain, which is believed to undergo swivelling conformational change in the enzyme mechanism. This distinct subfamily is found only in bacteria and archea. Its exact characteristics are not known.


Pssm-ID: 238811 [Multi-domain]  Cd Length: 121  Bit Score: 115.23  E-value: 3.41e-30
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 595 KVKGKCTTDHISAAGP-WLKYRGHLDNISNNMFIGATnyennemnniknqrngswggvPDVARDYKANGiKWVAVGDENY 673
Cdd:cd01579    1 KVGDNITTDHIMPAGAkVLPLRSNIPAISEFVFHRVD---------------------PTFAERAKAAG-PGFIVGGENY 58
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 665408902 674 GEGSSREHAALEPRHLGGRAIIVKSFARIHETNLKKQGLLPLTFANPADYDKIQPTSKISL 734
Cdd:cd01579   59 GQGSSREHAALAPMYLGVRAVLAKSFARIHRANLINFGILPLTFADEDDYDRFEQGDQLEL 119
PRK12466 PRK12466
3-isopropylmalate dehydratase large subunit;
67-521 3.72e-29

3-isopropylmalate dehydratase large subunit;


Pssm-ID: 183543  Cd Length: 471  Bit Score: 121.94  E-value: 3.72e-29
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902  67 NRPLTLSEKVLYSH----LDDpanqdivrGTSYLRLrpDRVAMQDATAQMALlqfisSGLK----KVAVPSTVHC--DHL 136
Cdd:PRK12466   1 MMPRTLYDKLWDSHtvarLDD--------GHVLLYI--DRHLLNEYTSPQAF-----SGLRargrTVRRPDLTLAvvDHV 65
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 137 IEAQIGGpkDLARAKDLNKEVYDFLASTCAKYGL---GFWKPGSGIIHQIILE-NYAFPGLLMIGTDSHTPNGGGLGGLC 212
Cdd:PRK12466  66 VPTRPGR--DRGITDPGGALQVDYLRENCADFGIrlfDVDDPRQGIVHVVAPElGLTLPGMVIVCGDSHTTTYGALGALA 143
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 213 IGVGGADAVDVMADIPWELKCPKVIGVNLTGKISGWTSPKDVILKVADILTVKGGTGAIIEYHGKGVDSISCTGMATICN 292
Cdd:PRK12466 144 FGIGTSEVEHVLATQTLVYRKPKTMRVRVDGELPPGVTAKDLILALIARIGADGATGYAIEFAGEAIRALSMEGRMTLCN 223
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 293 MGAEIGATTSLFPFNQRMADYLKstGRAGIASEAQKYQA----KILSADKNCEYDELIEINLDTLEPHVNGPFTPDLGHP 368
Cdd:PRK12466 224 MAVEAGARGGLIAPDETTFDYLR--GRPRAPKGALWDAAlaywRTLRSDADAVFDREVEIDAADIAPQVTWGTSPDQAVP 301
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 369 IS-------------KLGENSKKNGYpMDIRVG-----------LIGSCTNSSYEDMGRCASIAK--------DAMshgl 416
Cdd:PRK12466 302 ITgrvpdpaaeadpaRRAAMERALDY-MGLTPGtplagipidrvFIGSCTNGRIEDLRAAAAVLRgrkvapgvRAM---- 376
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 417 kskipfnVTPGSEQIRATIERDGISEVFDKFGGTVLANACGPCIGQWDRKdVKKGDKntIVTSYNRNFTGRNDANPATHc 496
Cdd:PRK12466 377 -------VVPGSGAVRRQAEAEGLARIFIAAGFEWREPGCSMCLAMNDDV-LAPGER--CASTTNRNFEGRQGPGARTH- 445
                        490       500
                 ....*....|....*....|....*.
gi 665408902 497 fVTSPELVTALSIAGRL-DFNPLTDE 521
Cdd:PRK12466 446 -LMSPAMVAAAAVAGHItDVRSLLQA 470
Aconitase_swivel cd00404
Aconitase swivel domain. Aconitase (aconitate hydratase) catalyzes the reversible ...
595-734 4.90e-25

Aconitase swivel domain. Aconitase (aconitate hydratase) catalyzes the reversible isomerization of citrate and isocitrate as part of the TCA cycle. This is the aconitase swivel domain, which undergoes swivelling conformational change in the enzyme mechanism. The aconitase family contains the following proteins: - Iron-responsive element binding protein (IRE-BP). IRE-BP is a cytosolic protein that binds to iron-responsive elements (IREs). IREs are stem-loop structures found in the 5'UTR of ferritin, and delta aminolevulinic acid synthase mRNAs, and in the 3'UTR of transferrin receptor mRNA. IRE-BP also express aconitase activity. - 3-isopropylmalate dehydratase (isopropylmalate isomerase), the enzyme that catalyzes the second step in the biosynthesis of leucine. - Homoaconitase (homoaconitate hydratase), an enzyme that participates in the alpha-aminoadipate pathway of lysine biosynthesis and that converts cis-homoaconitate into homoisocitric acid.


Pssm-ID: 238236 [Multi-domain]  Cd Length: 88  Bit Score: 99.46  E-value: 4.90e-25
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 595 KVKGKCTTDHISAAGPWlkyrghldnisnnmfigatnyennemnniknqrngswggvpdvardykangikwVAVGDENYG 674
Cdd:cd00404    1 KVAGNITTDHISPAGPG------------------------------------------------------VVIGDENYG 26
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 675 EGSSREHAALEPRHLGGRAIIVKSFARIHETNLKKQGLLPLTFANPADYDKIQPTSKISL 734
Cdd:cd00404   27 TGSSREHAALELRLLGGRAVIAKSFARIFFRNLVDQGLLPLEFADPEDYLKLHTGDELDI 86
PRK11413 PRK11413
putative hydratase; Provisional
96-725 4.61e-17

putative hydratase; Provisional


Pssm-ID: 183125 [Multi-domain]  Cd Length: 751  Bit Score: 85.83  E-value: 4.61e-17
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902  96 LRLRPDRVAMQDAT----AQMAllqfISSGLKKVAVPSTVHCDHLIEAQIGGpkdlarakDLNKEVYDFLASTCAKYGLG 171
Cdd:PRK11413  54 LKIKFDSLASHDITfvgiIQTA----KASGMERFPLPYVLTNCHNSLCAVGG--------TINEDDHVFGLSAAQKYGGI 121
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 172 FWKPGSGIIHQIILENYAFPGLLMIGTDSHTpnggglgglcigvgGADAVDVMA-------------DIPWELKCPKVIG 238
Cdd:PRK11413 122 FVPPHIAVIHQYMREMMAGGGKMILGSDSHT--------------RYGALGTMAvgegggelvkqllNDTYDIDYPGVVA 187
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 239 VNLTGKISGWTSPKDVILkvADILTV-KGG--TGAIIEYHGKGVDSISCTGMATICNMGAEIGATTSLFPFNQRMADYLK 315
Cdd:PRK11413 188 VYLTGKPAPGVGPQDVAL--AIIGAVfKNGyvKNKVMEFVGPGVSALSTDFRNGVDVMTTETTCLSSIWQTDEEVHNWLA 265
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 316 STGRAGIASEaqkyqakiLSADKNCEYDELIEINLDTLEPHVNGPFTPDLGHPISKLGEN----------------SKKN 379
Cdd:PRK11413 266 LHGRGQDYCE--------LNPQPMAYYDGCISVDLSAIKPMIALPFHPSNVYEIDELNQNltdilreveieservaHGKA 337
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 380 GYPM-------DIRV--GLIGSCTNSSYE------DMGRCASIAKDAMShglkskipFNVTPGSEQIRATIERDG-ISEV 443
Cdd:PRK11413 338 KLSLldkiengRLKVqqGIIAGCSGGNYEnviaaaNALRGQSCGNDTFS--------LSVYPSSQPVFMDLAKKGvVADL 409
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 444 FDkfGGTVLANA-CGPCIGQwdrKDVKKGDKNTIVTSyNRNFTGRNDANPATHCfVTSPELVTALSIA------GRldfn 516
Cdd:PRK11413 410 MG--AGAIIRTAfCGPCFGA---GDTPANNGLSIRHT-TRNFPNREGSKPANGQ-MSAVALMDARSIAataangGY---- 478
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 517 pltdeLTGADGkkfklkAPFGDELPAKGFDPG------QDTYTAPPPS-----GENVKvavdpkstrlqllepfdKWngQ 585
Cdd:PRK11413 479 -----LTSATE------LDCWDNVPEYAFDVTpyknrvYQGFGKGATQqpliyGPNIK-----------------DW--P 528
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 586 DLTDLT--VLIKVKGK-----CTTDHISAAGPWLKYRghldniSNNM-------------FIGAT--------NYENNEM 637
Cdd:PRK11413 529 EMGALTdnILLKVCSKildpvTTTDELIPSGETSSYR------SNPLglaeftlsrrdpgYVGRSkavaelenQRLAGNV 602
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 638 NNIKN--QRNGSWGGVPDVArdykangIKWVAVGDENY----GEGSSREHAALEPRHLGGRAIIVKSFA-RIHETNLKKQ 710
Cdd:PRK11413 603 SELTEvfARIKQIAGQEHID-------PLQTEIGSMVYavkpGDGSAREQAASCQRVLGGLANIAEEYAtKRYRSNVINW 675
                        730
                 ....*....|....*
gi 665408902 711 GLLPLTFANPADYDK 725
Cdd:PRK11413 676 GMLPFQMAEEPTFEV 690
AcnA_IRP_Swivel cd01580
Aconitase A swivel domain. This is the major form of the TCA cycle enzyme aconitate hydratase, ...
601-735 2.35e-16

Aconitase A swivel domain. This is the major form of the TCA cycle enzyme aconitate hydratase, also known as aconitase and citrate hydro-lyase. It includes bacterial and archaeal aconitase A, and the eukaryotic cytosolic form of aconitase. This group also includes sequences that have been shown to act as an iron-responsive element (IRE) binding protein in animals and may have the same role in other eukaryotes. This is the aconitase-like swivel domain, which is believed to undergo swivelling conformational change in the enzyme mechanism.


Pssm-ID: 238812 [Multi-domain]  Cd Length: 171  Bit Score: 77.32  E-value: 2.35e-16
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 601 TTDHISAAG------PWLKY-------------------------RGHLDNISN-NMFIGATnyennEMNNIKNQRNGSW 648
Cdd:cd01580    7 TTDHISPAGsiakdsPAGKYlaergvkprdfnsygsrrgndevmmRGTFANIRLrNKLVPGT-----EGGTTHHPPTGEV 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 649 GGVPDVARDYKANGIKWVAVGDENYGEGSSREHAALEPRHLGGRAIIVKSFARIHETNLKKQGLLPLTFANP--ADYDKI 726
Cdd:cd01580   82 MSIYDAAMRYKEEGVPLVILAGKEYGSGSSRDWAAKGPFLLGVKAVIAESFERIHRSNLVGMGILPLQFPPGenADSLGL 161

                 ....*....
gi 665408902 727 QPTSKISLL 735
Cdd:cd01580  162 TGEETYDII 170
AcnB COG1049
Aconitase B [Energy production and conversion];
90-521 7.49e-15

Aconitase B [Energy production and conversion];


Pssm-ID: 223978 [Multi-domain]  Cd Length: 852  Bit Score: 78.64  E-value: 7.49e-15
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902  90 VRGTSYLRLRPDRVAMQDATAQM--------ALLQF-----ISSGLKKVAVPStvhcdhlieaqiggPKDLARAKDLNke 156
Cdd:COG1049  389 IRPGTYCEPKMTTVGSQDTTGPMtrdelkdlACLGFsadlvMQSFCHTAAYPK--------------PVDVKTHHTLP-- 452
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 157 vyDFLAStcakYGLGFWKPGSGIIHQIiLENYAFPGLLMIGTDSHT--PNGGGLGGLCIGVGGADAVDVMAdipweLKCP 234
Cdd:COG1049  453 --DFIMN----RGGVSLRPGDGVIHSW-LNRMLLPDTVGTGGDSHTrfPIGISFPAGSGLVAFAAATGVMP-----LDMP 520
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 235 KVIGVNLTGKISGWTSPKDVILKVA------DILTVKGG------TGAIIEYHGkgVDSISCTGMATICNMGAEIGATTS 302
Cdd:COG1049  521 ESVLVRFKGEMQPGITLRDLVHAIPyyaikqGLLTVEKKgkknifSGRILEIEG--LPDLKVEQAFELTDASAERSAAGC 598
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 303 LFPFNQR-MADYLKST-------------GRAGIASEAQKYQAKI-----LSADKNCEYDELIEINLDTL-EPHVNGPFT 362
Cdd:COG1049  599 TIKLNKEpIIEYLKSNivllkwmiaegygDARTLERRIDKMEAWLanpelLEADADAEYAAVIEIDLADIkEPILAAPND 678
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 363 PDLGHPISKLgenskkNGYPMDIrvGLIGSC-TNssyedMGRCASIAKDAMSHGLKSKIPFNVTPGSEQIRATIERDGIS 441
Cdd:COG1049  679 PDDVRLLSEV------AGDKIDE--VFIGSCmTN-----IGHFRAAGKLLENAKGELPTRLWVAPPTKMDAAQLTEEGYY 745
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 442 EVFDKFGGTVLANACGPCIGQWDRkdVKKGDknTIVTSYNRNFTGR--NDANpathCFVTSPELVTALSIAGRLdfnPLT 519
Cdd:COG1049  746 SIFGKAGARIEMPGCSLCMGNQAR--VADGA--TVFSTSTRNFPNRlgKGAN----VYLASAELAAVCAILGKI---PTV 814

                 ..
gi 665408902 520 DE 521
Cdd:COG1049  815 EE 816
AcnB cd01581
Aconitate hydratase B catalyses the formation of cis-aconitate from citrate as part of the TCA ...
90-513 1.55e-13

Aconitate hydratase B catalyses the formation of cis-aconitate from citrate as part of the TCA cycle; Aconitase B catalytic domain. Aconitate hydratase B catalyses the formation of cis-aconitate from citrate as part of the TCA cycle. Aconitase has an active (4FE-4S) and an inactive (3FE-4S) form. The active cluster is part of the catalytic site that interconverts citrate, cis-aconitase and isocitrate. The domain architecture of aconitase B is different from other aconitases in that the catalytic domain is normally found at C-terminus for other aconitases, but it is at N-terminus for B family. It also has a HEAT domain before domain 4 which plays a role in protein-protein interaction. This alignment is the core domain including domains 1,2 and 3.


Pssm-ID: 153131  Cd Length: 436  Bit Score: 73.30  E-value: 1.55e-13
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902  90 VRGTSYLRLRPDRVAMQDATAQM--------ALLQFISSGlkkvAVPSTVHCdhlieAQIGGPKDLArakdLNKEVYDFL 161
Cdd:cd01581   15 VRPGTYCEPKMTTVGSQDTTGPMtrdelkelACLGFSADL----VMQSFCHT-----AAYPKPVDVK----THRTLPDFI 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 162 AStcakYGLGFWKPGSGIIHQIiLENYAFPGLLMIGTDSHT--PNGGGLGGLCIGVGGADAVDVMAdipweLKCPKVIGV 239
Cdd:cd01581   82 SN----RGGVALRPGDGVIHSW-LNRMLLPDTVGTGGDSHTrfPIGISFPAGSGLVAFAAATGVMP-----LDMPESVLV 151
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 240 NLTGKISGWTSPKDVILKV------ADILTV--KGG----TGAIIEYHGkgVDSISCTGMATICNMGAEIGATTSLFPFN 307
Cdd:cd01581  152 RFKGKMQPGITLRDLVNAIpyyaiqQGLLTVekKGKknvfNGRILEIEG--LPDLKVEQAFELTDASAERSAAACTVRLD 229
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 308 QR-MADYLKS------------------TGRAGIASEAQKYQAKILSADKNCEYDELIEINLDTL-EPHVNGPFTPDlgh 367
Cdd:cd01581  230 KEpVIEYLESnvvlmkimiangyddartLLRRIIAMEEWLANPPLLEPDADAEYAAVIEIDLDDIkEPILACPNDPD--- 306
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 368 PISKLGENSKKNgypmdIRVGLIGSC-TNssyedMGRCASIAKdaMSHGLKSKIP-FNVTPGSEQIRATIERDGISEVFD 445
Cdd:cd01581  307 DVKLLSEVAGKK-----IDEVFIGSCmTN-----IGHFRAAAK--ILRGKEFKPTrLWVAPPTRMDWAILQEEGYYSIFG 374
                        410       420       430       440       450       460       470
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 446 KFGGTVLANACGPCIGQWDRkdVKKGDknTIVTSYNRNFTGR--NDANpathCFVTSPELVTALSIAGRL 513
Cdd:cd01581  375 DAGARTEMPGCSLCMGNQAR--VADGA--TVFSTSTRNFDNRvgKGAE----VYLGSAELAAVCALLGRI 436
IPMI_Swivel cd01577
Aconatase-like swivel domain of 3-isopropylmalate dehydratase and related uncharacterized ...
668-727 3.17e-11

Aconatase-like swivel domain of 3-isopropylmalate dehydratase and related uncharacterized proteins. 3-isopropylmalate dehydratase catalyzes the isomerization between 2-isopropylmalate and 3-isopropylmalate, via the formation of 2-isopropylmaleate 3-isopropylmalate. IPMI is involved in fungal and bacterial leucine biosynthesis and is also found in eukaryotes. This is the aconitase-like swivel domain, which is believed to undergo swivelling conformational change in the enzyme mechanism.


Pssm-ID: 238809 [Multi-domain]  Cd Length: 91  Bit Score: 60.29  E-value: 3.17e-11
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 668 VGDENYGEGSSREHAALEPRHLGGRAIIVKSFARIHETNLKKQGLLPLTFANPADYDKIQ 727
Cdd:cd01577   22 VAGKNFGCGSSREHAPWALKDAGIRAVIAESFARIFFRNAINNGLLPVTLADEDVEEVEA 81
PRK09238 PRK09238
bifunctional aconitate hydratase 2/2-methylisocitrate dehydratase; Validated
334-513 5.29e-11

bifunctional aconitate hydratase 2/2-methylisocitrate dehydratase; Validated


Pssm-ID: 236424 [Multi-domain]  Cd Length: 835  Bit Score: 66.35  E-value: 5.29e-11
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 334 LSADKNCEYDELIEINLDTL-EPHVNGPFTPDLGHPISKLGENSkkngypmdIRVGLIGSC-TNssyedMGRCASIAKDA 411
Cdd:PRK09238 647 LEADADAEYAAVIEIDLAEIkEPILACPNDPDDVRLLSEVAGTK--------IDEVFIGSCmTN-----IGHFRAAGKLL 713
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 412 MSHGLKSKIPFNVTPGSEQIRATIERDGISEVFDKFGGTVLANACGPCIGQWDRkdVKKGDknTIVTSYNRNFTGR--ND 489
Cdd:PRK09238 714 EGKKGQLPTRLWVAPPTKMDADQLTEEGYYSIFGKAGARIEMPGCSLCMGNQAR--VADGA--TVFSTSTRNFPNRlgKG 789
                        170       180
                 ....*....|....*....|....
gi 665408902 490 ANpathCFVTSPELVTALSIAGRL 513
Cdd:PRK09238 790 AN----VYLGSAELAAVCALLGRI 809
LeuD COG0066
3-isopropylmalate dehydratase small subunit [Amino acid transport and metabolism];
666-757 9.64e-11

3-isopropylmalate dehydratase small subunit [Amino acid transport and metabolism];


Pssm-ID: 223144 [Multi-domain]  Cd Length: 191  Bit Score: 61.45  E-value: 9.64e-11
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 666 VAVGDENYGEGSSREHAALEPRHLGGRAIIVKSFARIHETNLKKQGLLPLTFANPADYDKIQPTSKISL-LNLKslapgk 744
Cdd:COG0066   65 ILVAGENFGCGSSREHAPWALKDYGIRAVIAPSFADIFYRNAINNGLLPIVLAEEDVTELFEDVPGDEVtVDLE------ 138
                         90
                 ....*....|...
gi 665408902 745 pvDAEIKNGDKVE 757
Cdd:COG0066  139 --TGEVTNPTGGE 149
PRK14023 PRK14023
homoaconitate hydratase small subunit; Provisional
652-734 2.68e-09

homoaconitate hydratase small subunit; Provisional


Pssm-ID: 184460 [Multi-domain]  Cd Length: 166  Bit Score: 56.74  E-value: 2.68e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 652 PDVARDYKANGIkwvAVGDENYGEGSSREHAALEPRHLGGRAIIVKSFARIHETNLKKQGLLPltFANPADYDKIQPTSK 731
Cdd:PRK14023  41 PEFASTVRPGDI---LVAGRNFGLGSSREYAPEALKMLGIGAIIAKSYARIFYRNLVNLGIPP--FESEEVVDALEDGDE 115

                 ...
gi 665408902 732 ISL 734
Cdd:PRK14023 116 VEL 118
leuD PRK00439
3-isopropylmalate dehydratase small subunit; Reviewed
668-762 3.50e-09

3-isopropylmalate dehydratase small subunit; Reviewed


Pssm-ID: 234762 [Multi-domain]  Cd Length: 163  Bit Score: 56.37  E-value: 3.50e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 668 VGDENYGEGSSREHAALEPRHLGGRAIIVKSFARIHETNLKKQGLLPLTFanPADYDKIQPTSKISllnlkslapgkpVD 747
Cdd:PRK00439  53 VAGKNFGCGSSREHAPIALKAAGVSAVIAKSFARIFYRNAINIGLPVLEC--DEAVDKIEDGDEVE------------VD 118
                         90
                 ....*....|....*...
gi 665408902 748 AE---IKNGDKVERIKLN 762
Cdd:PRK00439 119 LEtgvITNLTTGEEYKFK 136
LEUD_arch TIGR02087
3-isopropylmalate dehydratase, small subunit; This subfamily is most closely related to the ...
666-724 6.59e-08

3-isopropylmalate dehydratase, small subunit; This subfamily is most closely related to the 3-isopropylmalate dehydratase, small subunits which form TIGR00171. This subfamily includes the members of TIGR02084 which are gene clustered with other genes of leucine biosynthesis. The rest of the subfamily includes mainly archaeal species which exhibit two hits to this model. In these cases it is possible that one or the other of the hits does not have a 3-isopropylmalate dehydratase activity but rather one of the other related aconitase-like activities.


Pssm-ID: 273961 [Multi-domain]  Cd Length: 154  Bit Score: 52.42  E-value: 6.59e-08
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....*....
gi 665408902  666 VAVGDENYGEGSSREHAALEPRHLGGRAIIVKSFARIHETNLKKQGLLPLTFANPADYD 724
Cdd:TIGR02087  50 VIVAGKNFGCGSSREQAALALKAAGIAAVIAESFARIFYRNAINIGLPLIEAKTEGIKD 108
PLN00094 PLN00094
aconitate hydratase 2; Provisional
174-521 1.16e-07

aconitate hydratase 2; Provisional


Pssm-ID: 215053 [Multi-domain]  Cd Length: 938  Bit Score: 55.31  E-value: 1.16e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 174 KPGSGIIHQIiLENYAFPGLLMIGTDSHT--PNGGGLGGLCIGVGGADAVDVMAdipweLKCPKVIGVNLTGKISGWTSP 251
Cdd:PLN00094 536 RPGDGVIHSW-LNRMLLPDTVGTGGDSHTrfPIGISFPAGSGLVAFGAATGVIP-----LDMPESVLVRFTGTMQPGITL 609
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 252 KDVILKV------ADILTV-KGG-----TGAIIEYhgKGVDSISCTGMATICNMGAEIGATTSLFPFNQR-MADYLKST- 317
Cdd:PLN00094 610 RDLVHAIpytaiqDGLLTVeKKGkknvfSGRILEI--EGLPHLKCEQAFELSDASAERSAAGCTIKLDKEpIIEYLNSNv 687
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 318 -----------------GRAGIASEAQKYQAKILSADKNCEYDELIEINLDTL-EPHVNGPFTPDLGHPISKLGENSkkn 379
Cdd:PLN00094 688 vmlkwmiaegygdrrtlERRIARMQQWLADPELLEADPDAEYAAVIEIDMDEIkEPILCAPNDPDDARLLSEVTGDK--- 764
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 380 gypmdIRVGLIGSC-TNssyedMGRCASIAKdaMSHGLKSKIPFN--VTPGSEQIRATIERDGISEVFDKFGGTVLANAC 456
Cdd:PLN00094 765 -----IDEVFIGSCmTN-----IGHFRAAGK--LLNDNLSQLPTRlwVAPPTKMDEAQLKAEGYYSTFGTVGARTEMPGC 832
                        330       340       350       360       370       380
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 665408902 457 GPCIGQWDRkdvkKGDKNTIVTSYNRNFTGRndANPATHCFVTSPELVTALSIAGRLdfnPLTDE 521
Cdd:PLN00094 833 SLCMGNQAR----VAEKSTVVSTSTRNFPNR--LGKGANVYLASAELAAVAAILGRL---PTVEE 888
leuD PRK01641
3-isopropylmalate dehydratase small subunit;
668-727 4.65e-07

3-isopropylmalate dehydratase small subunit;


Pssm-ID: 179314 [Multi-domain]  Cd Length: 200  Bit Score: 50.90  E-value: 4.65e-07
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 665408902 668 VGDENYGEGSSREHA--ALEprHLGGRAIIVKSFARIHETNLKKQGLLPLTfANPADYDKIQ 727
Cdd:PRK01641  72 LAGDNFGCGSSREHApwALA--DYGFRAVIAPSFADIFYNNCFKNGLLPIV-LPEEDVDELF 130
PLN00072 PLN00072
3-isopropylmalate isomerase/dehydratase small subunit; Provisional
666-702 3.06e-04

3-isopropylmalate isomerase/dehydratase small subunit; Provisional


Pssm-ID: 177701 [Multi-domain]  Cd Length: 246  Bit Score: 43.31  E-value: 3.06e-04
                         10        20        30
                 ....*....|....*....|....*....|....*..
gi 665408902 666 VAVGDENYGEGSSREHAALEPRHLGGRAIIVKSFARI 702
Cdd:PLN00072 132 IIIGGENFGCGSSREHAPVALGAAGAKAVVAESYARI 168
PRK14812 PRK14812
hypothetical protein; Provisional
676-770 2.20e-03

hypothetical protein; Provisional


Pssm-ID: 173273 [Multi-domain]  Cd Length: 119  Bit Score: 38.55  E-value: 2.20e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 665408902 676 GSSREHAALEPRHLGGRAIIVKSFARIHETNLKKQGLLPLTfaNPAD----YDKIQPTSKIS--LLNLKSLAPGKPVDAE 749
Cdd:PRK14812   3 GSSREHAAWALADYGFKVVIAGSFGDIHYNNELNNGMLPIV--QPREvrekLAQLKPTDQVTvdLEQQKIISPVEEFTFE 80
                         90       100
                 ....*....|....*....|.
gi 665408902 750 IkngDKVERIKLNHTLNDLQI 770
Cdd:PRK14812  81 I---DSEWKHKLLNSLDDIGI 98
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH