NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|1108846868|ref|NP_001334370|]
View 

very low-density lipoprotein receptor isoform c precursor [Mus musculus]

Protein Classification

LDLa and Ldl_recept_b domain-containing protein (domain architecture ID 10819527)

protein containing domains LDLa, FXa_inhibition, LY, and Ldl_recept_b

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Ldl_recept_b pfam00058
Low-density lipoprotein receptor repeat class B; This domain is also known as the YWTD motif ...
527-567 1.73e-15

Low-density lipoprotein receptor repeat class B; This domain is also known as the YWTD motif after the most conserved region of the repeat. The YWTD repeat is found in multiple tandem repeats and has been predicted to form a beta-propeller structure.


:

Pssm-ID: 395012  Cd Length: 41  Bit Score: 70.66  E-value: 1.73e-15
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|.
gi 1108846868 527 GFVYWSDWGEPAKIEKAGMNGFDRRPLVTEDIQWPNGITLD 567
Cdd:pfam00058   1 GRLYWTDSSLRASISSADLNGSDRKTLLSEDLQHPNGIAVD 41
Ldl_recept_a pfam00057
Low-density lipoprotein receptor domain class A;
196-232 3.67e-12

Low-density lipoprotein receptor domain class A;


:

Pssm-ID: 395011  Cd Length: 37  Bit Score: 61.11  E-value: 3.67e-12
                          10        20        30
                  ....*....|....*....|....*....|....*..
gi 1108846868 196 TKCPTSEIQCGSGECIHKKWRCDGDPDCKDGSDEVNC 232
Cdd:pfam00057   1 STCSPNEFQCGSGECIPRSWVCDGDPDCGDGSDEENC 37
LDLa cd00112
Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central ...
33-67 2.19e-11

Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure


:

Pssm-ID: 238060  Cd Length: 35  Bit Score: 58.76  E-value: 2.19e-11
                          10        20        30
                  ....*....|....*....|....*....|....*
gi 1108846868  33 CDSSQFQCTNGRCITLLWKCDGDEDCADGSDEKNC 67
Cdd:cd00112     1 CPPNEFRCANGRCIPSSWVCDGEDDCGDGSDEENC 35
Ldl_recept_a pfam00057
Low-density lipoprotein receptor domain class A;
235-271 3.82e-11

Low-density lipoprotein receptor domain class A;


:

Pssm-ID: 395011  Cd Length: 37  Bit Score: 58.03  E-value: 3.82e-11
                          10        20        30
                  ....*....|....*....|....*....|....*..
gi 1108846868 235 RTCRPDQFECEDGSCIHGSRQCNGIRDCVDGSDEVNC 271
Cdd:pfam00057   1 STCSPNEFQCGSGECIPRSWVCDGDPDCGDGSDEENC 37
Ldl_recept_a pfam00057
Low-density lipoprotein receptor domain class A;
112-147 9.77e-11

Low-density lipoprotein receptor domain class A;


:

Pssm-ID: 395011  Cd Length: 37  Bit Score: 56.87  E-value: 9.77e-11
                          10        20        30
                  ....*....|....*....|....*....|....*.
gi 1108846868 112 TCSADEFTCSSGRCVSRNFVCNGQDDCDDGSDELDC 147
Cdd:pfam00057   2 TCSPNEFQCGSGECIPRSWVCDGDPDCGDGSDEENC 37
LDLa smart00192
Low-density lipoprotein receptor domain class A; Cysteine-rich repeat in the low-density ...
71-103 3.50e-10

Low-density lipoprotein receptor domain class A; Cysteine-rich repeat in the low-density lipoprotein (LDL) receptor that plays a central role in mammalian cholesterol metabolism. The N-terminal type A repeats in LDL receptor bind the lipoproteins. Other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement. Mutations in the LDL receptor gene cause familial hypercholesterolemia.


:

Pssm-ID: 197566  Cd Length: 33  Bit Score: 55.33  E-value: 3.50e-10
                           10        20        30
                   ....*....|....*....|....*....|...
gi 1108846868   71 TCAESDFVCKNGQCVPNRWQCDGDPDCEDGSDE 103
Cdd:smart00192   1 TCPPGEFQCDNGRCIPSSWVCDGVDDCGDGSDE 33
LY smart00135
Low-density lipoprotein-receptor YWTD domain; Type "B" repeats in low-density lipoprotein (LDL) ...
467-506 4.50e-10

Low-density lipoprotein-receptor YWTD domain; Type "B" repeats in low-density lipoprotein (LDL) receptor that plays a central role in mammalian cholesterol metabolism. Also present in a variety of molecules similar to gp300/megalin.


:

Pssm-ID: 214531  Cd Length: 43  Bit Score: 55.30  E-value: 4.50e-10
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|
gi 1108846868  467 MIDNVYNPAAIAVDWVYKTIYWTDAASKTISVATLDGAKR 506
Cdd:smart00135   4 LSSGLGHPNGLAVDWIEGRLYWTDWGLDVIEVANLDGTNR 43
Ldl_recept_a pfam00057
Low-density lipoprotein receptor domain class A;
151-183 2.74e-09

Low-density lipoprotein receptor domain class A;


:

Pssm-ID: 395011  Cd Length: 37  Bit Score: 53.02  E-value: 2.74e-09
                          10        20        30
                  ....*....|....*....|....*....|...
gi 1108846868 151 TCGAHEFQCSTSSCIPLSWVCDDDADCSDQSDE 183
Cdd:pfam00057   2 TCSPNEFQCGSGECIPRSWVCDGDPDCGDGSDE 34
LY smart00135
Low-density lipoprotein-receptor YWTD domain; Type "B" repeats in low-density lipoprotein (LDL) ...
551-593 3.06e-09

Low-density lipoprotein-receptor YWTD domain; Type "B" repeats in low-density lipoprotein (LDL) receptor that plays a central role in mammalian cholesterol metabolism. Also present in a variety of molecules similar to gp300/megalin.


:

Pssm-ID: 214531  Cd Length: 43  Bit Score: 52.99  E-value: 3.06e-09
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|...
gi 1108846868  551 RPLVTEDIQWPNGITLDLVKSRLYWLDSKLHMLSSVDLNGQDR 593
Cdd:smart00135   1 RTLLSSGLGHPNGLAVDWIEGRLYWTDWGLDVIEVANLDGTNR 43
Ldl_recept_a pfam00057
Low-density lipoprotein receptor domain class A;
279-309 7.88e-08

Low-density lipoprotein receptor domain class A;


:

Pssm-ID: 395011  Cd Length: 37  Bit Score: 48.78  E-value: 7.88e-08
                          10        20        30
                  ....*....|....*....|....*....|.
gi 1108846868 279 GPGKFKCRSGECIDMSKVCDQEQDCRDWSDE 309
Cdd:pfam00057   4 SPNEFQCGSGECIPRSWVCDGDPDCGDGSDE 34
FXa_inhibition pfam14670
Coagulation Factor Xa inhibitory site; This short domain on coagulation enzyme factor Xa is ...
319-353 2.95e-07

Coagulation Factor Xa inhibitory site; This short domain on coagulation enzyme factor Xa is found to be the target for a potent inhibitor of coagulation, TAK-442.


:

Pssm-ID: 405372  Cd Length: 36  Bit Score: 47.23  E-value: 2.95e-07
                          10        20        30
                  ....*....|....*....|....*....|....*.
gi 1108846868 319 CLVNNGGCSHICKDLVIGYECDCAAGFELI-DRKTC 353
Cdd:pfam14670   1 CSVNNGGCSHLCLNTPGGYTCSCPEGYKLQeDGRTC 36
Ldl_recept_b pfam00058
Low-density lipoprotein receptor repeat class B; This domain is also known as the YWTD motif ...
440-480 3.08e-07

Low-density lipoprotein receptor repeat class B; This domain is also known as the YWTD motif after the most conserved region of the repeat. The YWTD repeat is found in multiple tandem repeats and has been predicted to form a beta-propeller structure.


:

Pssm-ID: 395012  Cd Length: 41  Bit Score: 47.16  E-value: 3.08e-07
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|..
gi 1108846868 440 QKLFWADLSQKA-IFSASIDDKVgRHFKMIDNVYNPAAIAVD 480
Cdd:pfam00058   1 GRLYWTDSSLRAsISSADLNGSD-RKTLLSEDLQHPNGIAVD 41
Ldl_recept_b pfam00058
Low-density lipoprotein receptor repeat class B; This domain is also known as the YWTD motif ...
614-653 4.56e-07

Low-density lipoprotein receptor repeat class B; This domain is also known as the YWTD motif after the most conserved region of the repeat. The YWTD repeat is found in multiple tandem repeats and has been predicted to form a beta-propeller structure.


:

Pssm-ID: 395012  Cd Length: 41  Bit Score: 46.78  E-value: 4.56e-07
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|.
gi 1108846868 614 DRVYWIDGENEAVYGANKFTGSELATLV-NNLNDAQDIIVY 653
Cdd:pfam00058   1 GRLYWTDSSLRASISSADLNGSDRKTLLsEDLQHPNGIAVD 41
EGF_CA smart00179
Calcium-binding EGF-like domain;
355-385 5.25e-06

Calcium-binding EGF-like domain;


:

Pssm-ID: 214542  Cd Length: 39  Bit Score: 43.77  E-value: 5.25e-06
                           10        20        30
                   ....*....|....*....|....*....|...
gi 1108846868  355 DIDECQNPGICSQ--ICINLKGGYKCECSRGYQ 385
Cdd:smart00179   1 DIDECASGNPCQNggTCVNTVGSYRCECPPGYT 33
FXa_inhibition pfam14670
Coagulation Factor Xa inhibitory site; This short domain on coagulation enzyme factor Xa is ...
665-708 3.54e-05

Coagulation Factor Xa inhibitory site; This short domain on coagulation enzyme factor Xa is found to be the target for a potent inhibitor of coagulation, TAK-442.


:

Pssm-ID: 405372  Cd Length: 36  Bit Score: 41.45  E-value: 3.54e-05
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....
gi 1108846868 665 CEDDmeNGGCEYLCLPAPQindhspKYTCSCPNGYNLEENGREC 708
Cdd:pfam14670   1 CSVN--NGGCSHLCLNTPG------GYTCSCPEGYKLQEDGRTC 36
LY smart00135
Low-density lipoprotein-receptor YWTD domain; Type "B" repeats in low-density lipoprotein (LDL) ...
420-458 8.68e-03

Low-density lipoprotein-receptor YWTD domain; Type "B" repeats in low-density lipoprotein (LDL) receptor that plays a central role in mammalian cholesterol metabolism. Also present in a variety of molecules similar to gp300/megalin.


:

Pssm-ID: 214531  Cd Length: 43  Bit Score: 34.88  E-value: 8.68e-03
                           10        20        30
                   ....*....|....*....|....*....|....*....
gi 1108846868  420 YIQLVEQLRNTVALDADIAAQKLFWADLSQKAIFSASID 458
Cdd:smart00135   1 RTLLSSGLGHPNGLAVDWIEGRLYWTDWGLDVIEVANLD 39
 
Name Accession Description Interval E-value
Ldl_recept_b pfam00058
Low-density lipoprotein receptor repeat class B; This domain is also known as the YWTD motif ...
527-567 1.73e-15

Low-density lipoprotein receptor repeat class B; This domain is also known as the YWTD motif after the most conserved region of the repeat. The YWTD repeat is found in multiple tandem repeats and has been predicted to form a beta-propeller structure.


Pssm-ID: 395012  Cd Length: 41  Bit Score: 70.66  E-value: 1.73e-15
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|.
gi 1108846868 527 GFVYWSDWGEPAKIEKAGMNGFDRRPLVTEDIQWPNGITLD 567
Cdd:pfam00058   1 GRLYWTDSSLRASISSADLNGSDRKTLLSEDLQHPNGIAVD 41
Ldl_recept_a pfam00057
Low-density lipoprotein receptor domain class A;
196-232 3.67e-12

Low-density lipoprotein receptor domain class A;


Pssm-ID: 395011  Cd Length: 37  Bit Score: 61.11  E-value: 3.67e-12
                          10        20        30
                  ....*....|....*....|....*....|....*..
gi 1108846868 196 TKCPTSEIQCGSGECIHKKWRCDGDPDCKDGSDEVNC 232
Cdd:pfam00057   1 STCSPNEFQCGSGECIPRSWVCDGDPDCGDGSDEENC 37
LDLa cd00112
Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central ...
33-67 2.19e-11

Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure


Pssm-ID: 238060  Cd Length: 35  Bit Score: 58.76  E-value: 2.19e-11
                          10        20        30
                  ....*....|....*....|....*....|....*
gi 1108846868  33 CDSSQFQCTNGRCITLLWKCDGDEDCADGSDEKNC 67
Cdd:cd00112     1 CPPNEFRCANGRCIPSSWVCDGEDDCGDGSDEENC 35
Ldl_recept_a pfam00057
Low-density lipoprotein receptor domain class A;
235-271 3.82e-11

Low-density lipoprotein receptor domain class A;


Pssm-ID: 395011  Cd Length: 37  Bit Score: 58.03  E-value: 3.82e-11
                          10        20        30
                  ....*....|....*....|....*....|....*..
gi 1108846868 235 RTCRPDQFECEDGSCIHGSRQCNGIRDCVDGSDEVNC 271
Cdd:pfam00057   1 STCSPNEFQCGSGECIPRSWVCDGDPDCGDGSDEENC 37
LDLa cd00112
Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central ...
198-232 3.98e-11

Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure


Pssm-ID: 238060  Cd Length: 35  Bit Score: 57.99  E-value: 3.98e-11
                          10        20        30
                  ....*....|....*....|....*....|....*
gi 1108846868 198 CPTSEIQCGSGECIHKKWRCDGDPDCKDGSDEVNC 232
Cdd:cd00112     1 CPPNEFRCANGRCIPSSWVCDGEDDCGDGSDEENC 35
Ldl_recept_a pfam00057
Low-density lipoprotein receptor domain class A;
112-147 9.77e-11

Low-density lipoprotein receptor domain class A;


Pssm-ID: 395011  Cd Length: 37  Bit Score: 56.87  E-value: 9.77e-11
                          10        20        30
                  ....*....|....*....|....*....|....*.
gi 1108846868 112 TCSADEFTCSSGRCVSRNFVCNGQDDCDDGSDELDC 147
Cdd:pfam00057   2 TCSPNEFQCGSGECIPRSWVCDGDPDCGDGSDEENC 37
LDLa cd00112
Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central ...
113-147 3.13e-10

Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure


Pssm-ID: 238060  Cd Length: 35  Bit Score: 55.68  E-value: 3.13e-10
                          10        20        30
                  ....*....|....*....|....*....|....*
gi 1108846868 113 CSADEFTCSSGRCVSRNFVCNGQDDCDDGSDELDC 147
Cdd:cd00112     1 CPPNEFRCANGRCIPSSWVCDGEDDCGDGSDEENC 35
LDLa smart00192
Low-density lipoprotein receptor domain class A; Cysteine-rich repeat in the low-density ...
71-103 3.50e-10

Low-density lipoprotein receptor domain class A; Cysteine-rich repeat in the low-density lipoprotein (LDL) receptor that plays a central role in mammalian cholesterol metabolism. The N-terminal type A repeats in LDL receptor bind the lipoproteins. Other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement. Mutations in the LDL receptor gene cause familial hypercholesterolemia.


Pssm-ID: 197566  Cd Length: 33  Bit Score: 55.33  E-value: 3.50e-10
                           10        20        30
                   ....*....|....*....|....*....|...
gi 1108846868   71 TCAESDFVCKNGQCVPNRWQCDGDPDCEDGSDE 103
Cdd:smart00192   1 TCPPGEFQCDNGRCIPSSWVCDGVDDCGDGSDE 33
LY smart00135
Low-density lipoprotein-receptor YWTD domain; Type "B" repeats in low-density lipoprotein (LDL) ...
467-506 4.50e-10

Low-density lipoprotein-receptor YWTD domain; Type "B" repeats in low-density lipoprotein (LDL) receptor that plays a central role in mammalian cholesterol metabolism. Also present in a variety of molecules similar to gp300/megalin.


Pssm-ID: 214531  Cd Length: 43  Bit Score: 55.30  E-value: 4.50e-10
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|
gi 1108846868  467 MIDNVYNPAAIAVDWVYKTIYWTDAASKTISVATLDGAKR 506
Cdd:smart00135   4 LSSGLGHPNGLAVDWIEGRLYWTDWGLDVIEVANLDGTNR 43
Ldl_recept_b pfam00058
Low-density lipoprotein receptor repeat class B; This domain is also known as the YWTD motif ...
486-523 5.63e-10

Low-density lipoprotein receptor repeat class B; This domain is also known as the YWTD motif after the most conserved region of the repeat. The YWTD repeat is found in multiple tandem repeats and has been predicted to form a beta-propeller structure.


Pssm-ID: 395012  Cd Length: 41  Bit Score: 54.87  E-value: 5.63e-10
                          10        20        30
                  ....*....|....*....|....*....|....*....
gi 1108846868 486 IYWTDAAS-KTISVATLDGAKRKFLFNSDLREPASIAVD 523
Cdd:pfam00058   3 LYWTDSSLrASISSADLNGSDRKTLLSEDLQHPNGIAVD 41
Ldl_recept_a pfam00057
Low-density lipoprotein receptor domain class A;
32-67 6.97e-10

Low-density lipoprotein receptor domain class A;


Pssm-ID: 395011  Cd Length: 37  Bit Score: 54.56  E-value: 6.97e-10
                          10        20        30
                  ....*....|....*....|....*....|....*.
gi 1108846868  32 KCDSSQFQCTNGRCITLLWKCDGDEDCADGSDEKNC 67
Cdd:pfam00057   2 TCSPNEFQCGSGECIPRSWVCDGDPDCGDGSDEENC 37
LDLa smart00192
Low-density lipoprotein receptor domain class A; Cysteine-rich repeat in the low-density ...
32-64 1.03e-09

Low-density lipoprotein receptor domain class A; Cysteine-rich repeat in the low-density lipoprotein (LDL) receptor that plays a central role in mammalian cholesterol metabolism. The N-terminal type A repeats in LDL receptor bind the lipoproteins. Other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement. Mutations in the LDL receptor gene cause familial hypercholesterolemia.


Pssm-ID: 197566  Cd Length: 33  Bit Score: 54.18  E-value: 1.03e-09
                           10        20        30
                   ....*....|....*....|....*....|...
gi 1108846868   32 KCDSSQFQCTNGRCITLLWKCDGDEDCADGSDE 64
Cdd:smart00192   1 TCPPGEFQCDNGRCIPSSWVCDGVDDCGDGSDE 33
LDLa cd00112
Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central ...
72-103 1.03e-09

Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure


Pssm-ID: 238060  Cd Length: 35  Bit Score: 54.13  E-value: 1.03e-09
                          10        20        30
                  ....*....|....*....|....*....|..
gi 1108846868  72 CAESDFVCKNGQCVPNRWQCDGDPDCEDGSDE 103
Cdd:cd00112     1 CPPNEFRCANGRCIPSSWVCDGEDDCGDGSDE 32
Ldl_recept_a pfam00057
Low-density lipoprotein receptor domain class A;
70-103 1.22e-09

Low-density lipoprotein receptor domain class A;


Pssm-ID: 395011  Cd Length: 37  Bit Score: 53.79  E-value: 1.22e-09
                          10        20        30
                  ....*....|....*....|....*....|....
gi 1108846868  70 KTCAESDFVCKNGQCVPNRWQCDGDPDCEDGSDE 103
Cdd:pfam00057   1 STCSPNEFQCGSGECIPRSWVCDGDPDCGDGSDE 34
LDLa smart00192
Low-density lipoprotein receptor domain class A; Cysteine-rich repeat in the low-density ...
197-229 1.32e-09

Low-density lipoprotein receptor domain class A; Cysteine-rich repeat in the low-density lipoprotein (LDL) receptor that plays a central role in mammalian cholesterol metabolism. The N-terminal type A repeats in LDL receptor bind the lipoproteins. Other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement. Mutations in the LDL receptor gene cause familial hypercholesterolemia.


Pssm-ID: 197566  Cd Length: 33  Bit Score: 53.79  E-value: 1.32e-09
                           10        20        30
                   ....*....|....*....|....*....|...
gi 1108846868  197 KCPTSEIQCGSGECIHKKWRCDGDPDCKDGSDE 229
Cdd:smart00192   1 TCPPGEFQCDNGRCIPSSWVCDGVDDCGDGSDE 33
LY smart00135
Low-density lipoprotein-receptor YWTD domain; Type "B" repeats in low-density lipoprotein (LDL) ...
509-550 1.93e-09

Low-density lipoprotein-receptor YWTD domain; Type "B" repeats in low-density lipoprotein (LDL) receptor that plays a central role in mammalian cholesterol metabolism. Also present in a variety of molecules similar to gp300/megalin.


Pssm-ID: 214531  Cd Length: 43  Bit Score: 53.37  E-value: 1.93e-09
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|..
gi 1108846868  509 LFNSDLREPASIAVDPLSGFVYWSDWGEPaKIEKAGMNGFDR 550
Cdd:smart00135   3 LLSSGLGHPNGLAVDWIEGRLYWTDWGLD-VIEVANLDGTNR 43
Ldl_recept_a pfam00057
Low-density lipoprotein receptor domain class A;
151-183 2.74e-09

Low-density lipoprotein receptor domain class A;


Pssm-ID: 395011  Cd Length: 37  Bit Score: 53.02  E-value: 2.74e-09
                          10        20        30
                  ....*....|....*....|....*....|...
gi 1108846868 151 TCGAHEFQCSTSSCIPLSWVCDDDADCSDQSDE 183
Cdd:pfam00057   2 TCSPNEFQCGSGECIPRSWVCDGDPDCGDGSDE 34
LDLa cd00112
Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central ...
237-271 2.94e-09

Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure


Pssm-ID: 238060  Cd Length: 35  Bit Score: 52.98  E-value: 2.94e-09
                          10        20        30
                  ....*....|....*....|....*....|....*
gi 1108846868 237 CRPDQFECEDGSCIHGSRQCNGIRDCVDGSDEVNC 271
Cdd:cd00112     1 CPPNEFRCANGRCIPSSWVCDGEDDCGDGSDEENC 35
LY smart00135
Low-density lipoprotein-receptor YWTD domain; Type "B" repeats in low-density lipoprotein (LDL) ...
551-593 3.06e-09

Low-density lipoprotein-receptor YWTD domain; Type "B" repeats in low-density lipoprotein (LDL) receptor that plays a central role in mammalian cholesterol metabolism. Also present in a variety of molecules similar to gp300/megalin.


Pssm-ID: 214531  Cd Length: 43  Bit Score: 52.99  E-value: 3.06e-09
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|...
gi 1108846868  551 RPLVTEDIQWPNGITLDLVKSRLYWLDSKLHMLSSVDLNGQDR 593
Cdd:smart00135   1 RTLLSSGLGHPNGLAVDWIEGRLYWTDWGLDVIEVANLDGTNR 43
LDLa smart00192
Low-density lipoprotein receptor domain class A; Cysteine-rich repeat in the low-density ...
151-183 3.13e-09

Low-density lipoprotein receptor domain class A; Cysteine-rich repeat in the low-density lipoprotein (LDL) receptor that plays a central role in mammalian cholesterol metabolism. The N-terminal type A repeats in LDL receptor bind the lipoproteins. Other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement. Mutations in the LDL receptor gene cause familial hypercholesterolemia.


Pssm-ID: 197566  Cd Length: 33  Bit Score: 52.64  E-value: 3.13e-09
                           10        20        30
                   ....*....|....*....|....*....|...
gi 1108846868  151 TCGAHEFQCSTSSCIPLSWVCDDDADCSDQSDE 183
Cdd:smart00192   1 TCPPGEFQCDNGRCIPSSWVCDGVDDCGDGSDE 33
LDLa smart00192
Low-density lipoprotein receptor domain class A; Cysteine-rich repeat in the low-density ...
112-144 3.58e-09

Low-density lipoprotein receptor domain class A; Cysteine-rich repeat in the low-density lipoprotein (LDL) receptor that plays a central role in mammalian cholesterol metabolism. The N-terminal type A repeats in LDL receptor bind the lipoproteins. Other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement. Mutations in the LDL receptor gene cause familial hypercholesterolemia.


Pssm-ID: 197566  Cd Length: 33  Bit Score: 52.64  E-value: 3.58e-09
                           10        20        30
                   ....*....|....*....|....*....|...
gi 1108846868  112 TCSADEFTCSSGRCVSRNFVCNGQDDCDDGSDE 144
Cdd:smart00192   1 TCPPGEFQCDNGRCIPSSWVCDGVDDCGDGSDE 33
exchanger_TraA NF033759
outer membrane exchange protein TraA; TraA, together with its partner TraB, mediates a large ...
39-252 3.37e-08

outer membrane exchange protein TraA; TraA, together with its partner TraB, mediates a large scale exchange of outer membrane lipoproteins, and lipids, between closely related strains or clonally identical cells, certain delta-proteobacterial species such as Myxococcus xanthus. The exchange mechanism is likely to involve fusion of outer membrane, probably done to coordinate the social behaviors these bacteria display.


Pssm-ID: 411343 [Multi-domain]  Cd Length: 662  Bit Score: 57.09  E-value: 3.37e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1108846868  39 QCTNGRCITLLWKCDG---DEDCADGSDEKNCVKKTcaeSDFVCKNGQ-CVPNRWQ---CDGDPDCEDGsdespEQCRNI 111
Cdd:NF033759  310 QCPNGRCDLTTNQCRGcneDSDCVCDEPTFTCVECN---TDEQCPNGQvCATDLNEcreCNQDSHCPRG-----ESCSNN 381
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1108846868 112 TCSadefTCSSgrcvsrNFVCNGqDDCDDGSDELDCAPPTCGAhefqcsTSSCIPlswvCDDDADCSDQsdeslEQC--- 188
Cdd:NF033759  382 TCQ----PCST------NDSCAG-NSCNCCPNGTQCAAPTPGA------SPSCVE----CTTDSQCADG-----QRCdta 435
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 1108846868 189 -GRQPVIHTKCPTSEiQCGSGeCIhkkwRCDGD-PDCKDGSDEVncpsrTCRPDqFECEDGS-CIHG 252
Cdd:NF033759  436 nGRCVDQVPECNTSD-RCGPG-CV----KCPGDrPYCLDGQVCV-----QCRND-LECGDGQfCLSG 490
LDLa cd00112
Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central ...
152-183 4.17e-08

Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure


Pssm-ID: 238060  Cd Length: 35  Bit Score: 49.51  E-value: 4.17e-08
                          10        20        30
                  ....*....|....*....|....*....|..
gi 1108846868 152 CGAHEFQCSTSSCIPLSWVCDDDADCSDQSDE 183
Cdd:cd00112     1 CPPNEFRCANGRCIPSSWVCDGEDDCGDGSDE 32
LDLa smart00192
Low-density lipoprotein receptor domain class A; Cysteine-rich repeat in the low-density ...
236-268 5.77e-08

Low-density lipoprotein receptor domain class A; Cysteine-rich repeat in the low-density lipoprotein (LDL) receptor that plays a central role in mammalian cholesterol metabolism. The N-terminal type A repeats in LDL receptor bind the lipoproteins. Other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement. Mutations in the LDL receptor gene cause familial hypercholesterolemia.


Pssm-ID: 197566  Cd Length: 33  Bit Score: 49.17  E-value: 5.77e-08
                           10        20        30
                   ....*....|....*....|....*....|...
gi 1108846868  236 TCRPDQFECEDGSCIHGSRQCNGIRDCVDGSDE 268
Cdd:smart00192   1 TCPPGEFQCDNGRCIPSSWVCDGVDDCGDGSDE 33
Ldl_recept_a pfam00057
Low-density lipoprotein receptor domain class A;
279-309 7.88e-08

Low-density lipoprotein receptor domain class A;


Pssm-ID: 395011  Cd Length: 37  Bit Score: 48.78  E-value: 7.88e-08
                          10        20        30
                  ....*....|....*....|....*....|.
gi 1108846868 279 GPGKFKCRSGECIDMSKVCDQEQDCRDWSDE 309
Cdd:pfam00057   4 SPNEFQCGSGECIPRSWVCDGDPDCGDGSDE 34
FXa_inhibition pfam14670
Coagulation Factor Xa inhibitory site; This short domain on coagulation enzyme factor Xa is ...
319-353 2.95e-07

Coagulation Factor Xa inhibitory site; This short domain on coagulation enzyme factor Xa is found to be the target for a potent inhibitor of coagulation, TAK-442.


Pssm-ID: 405372  Cd Length: 36  Bit Score: 47.23  E-value: 2.95e-07
                          10        20        30
                  ....*....|....*....|....*....|....*.
gi 1108846868 319 CLVNNGGCSHICKDLVIGYECDCAAGFELI-DRKTC 353
Cdd:pfam14670   1 CSVNNGGCSHLCLNTPGGYTCSCPEGYKLQeDGRTC 36
Ldl_recept_b pfam00058
Low-density lipoprotein receptor repeat class B; This domain is also known as the YWTD motif ...
440-480 3.08e-07

Low-density lipoprotein receptor repeat class B; This domain is also known as the YWTD motif after the most conserved region of the repeat. The YWTD repeat is found in multiple tandem repeats and has been predicted to form a beta-propeller structure.


Pssm-ID: 395012  Cd Length: 41  Bit Score: 47.16  E-value: 3.08e-07
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|..
gi 1108846868 440 QKLFWADLSQKA-IFSASIDDKVgRHFKMIDNVYNPAAIAVD 480
Cdd:pfam00058   1 GRLYWTDSSLRAsISSADLNGSD-RKTLLSEDLQHPNGIAVD 41
Ldl_recept_b pfam00058
Low-density lipoprotein receptor repeat class B; This domain is also known as the YWTD motif ...
572-612 3.64e-07

Low-density lipoprotein receptor repeat class B; This domain is also known as the YWTD motif after the most conserved region of the repeat. The YWTD repeat is found in multiple tandem repeats and has been predicted to form a beta-propeller structure.


Pssm-ID: 395012  Cd Length: 41  Bit Score: 47.16  E-value: 3.64e-07
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|..
gi 1108846868 572 RLYWLDSKLHM-LSSVDLNGQDRRIVLKSLefLAHPLALTIF 612
Cdd:pfam00058   2 RLYWTDSSLRAsISSADLNGSDRKTLLSED--LQHPNGIAVD 41
Ldl_recept_b pfam00058
Low-density lipoprotein receptor repeat class B; This domain is also known as the YWTD motif ...
614-653 4.56e-07

Low-density lipoprotein receptor repeat class B; This domain is also known as the YWTD motif after the most conserved region of the repeat. The YWTD repeat is found in multiple tandem repeats and has been predicted to form a beta-propeller structure.


Pssm-ID: 395012  Cd Length: 41  Bit Score: 46.78  E-value: 4.56e-07
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|.
gi 1108846868 614 DRVYWIDGENEAVYGANKFTGSELATLV-NNLNDAQDIIVY 653
Cdd:pfam00058   1 GRLYWTDSSLRASISSADLNGSDRKTLLsEDLQHPNGIAVD 41
LDLa smart00192
Low-density lipoprotein receptor domain class A; Cysteine-rich repeat in the low-density ...
279-309 5.44e-07

Low-density lipoprotein receptor domain class A; Cysteine-rich repeat in the low-density lipoprotein (LDL) receptor that plays a central role in mammalian cholesterol metabolism. The N-terminal type A repeats in LDL receptor bind the lipoproteins. Other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement. Mutations in the LDL receptor gene cause familial hypercholesterolemia.


Pssm-ID: 197566  Cd Length: 33  Bit Score: 46.47  E-value: 5.44e-07
                           10        20        30
                   ....*....|....*....|....*....|.
gi 1108846868  279 GPGKFKCRSGECIDMSKVCDQEQDCRDWSDE 309
Cdd:smart00192   3 PPGEFQCDNGRCIPSSWVCDGVDDCGDGSDE 33
LDLa cd00112
Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central ...
279-309 9.03e-07

Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure


Pssm-ID: 238060  Cd Length: 35  Bit Score: 45.66  E-value: 9.03e-07
                          10        20        30
                  ....*....|....*....|....*....|.
gi 1108846868 279 GPGKFKCRSGECIDMSKVCDQEQDCRDWSDE 309
Cdd:cd00112     2 PPNEFRCANGRCIPSSWVCDGEDDCGDGSDE 32
EGF_CA smart00179
Calcium-binding EGF-like domain;
355-385 5.25e-06

Calcium-binding EGF-like domain;


Pssm-ID: 214542  Cd Length: 39  Bit Score: 43.77  E-value: 5.25e-06
                           10        20        30
                   ....*....|....*....|....*....|...
gi 1108846868  355 DIDECQNPGICSQ--ICINLKGGYKCECSRGYQ 385
Cdd:smart00179   1 DIDECASGNPCQNggTCVNTVGSYRCECPPGYT 33
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
355-385 2.30e-05

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


Pssm-ID: 238011  Cd Length: 38  Bit Score: 41.85  E-value: 2.30e-05
                          10        20        30
                  ....*....|....*....|....*....|...
gi 1108846868 355 DIDECQNPGICS--QICINLKGGYKCECSRGYQ 385
Cdd:cd00054     1 DIDECASGNPCQngGTCVNTVGSYRCSCPPGYT 33
FXa_inhibition pfam14670
Coagulation Factor Xa inhibitory site; This short domain on coagulation enzyme factor Xa is ...
665-708 3.54e-05

Coagulation Factor Xa inhibitory site; This short domain on coagulation enzyme factor Xa is found to be the target for a potent inhibitor of coagulation, TAK-442.


Pssm-ID: 405372  Cd Length: 36  Bit Score: 41.45  E-value: 3.54e-05
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....
gi 1108846868 665 CEDDmeNGGCEYLCLPAPQindhspKYTCSCPNGYNLEENGREC 708
Cdd:pfam14670   1 CSVN--NGGCSHLCLNTPG------GYTCSCPEGYKLQEDGRTC 36
NHL_like_5 cd14963
Uncharacterized NHL-repeat domain in bacterial proteins; The NHL (NCL-1, HT2A and LIN-41) ...
474-640 1.56e-03

Uncharacterized NHL-repeat domain in bacterial proteins; The NHL (NCL-1, HT2A and LIN-41) repeat is found in multiple tandem copies, typically as 6 instances. It is about 40 residues long and resembles the WD repeat and other beta-propeller structures.


Pssm-ID: 271333 [Multi-domain]  Cd Length: 268  Bit Score: 41.12  E-value: 1.56e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1108846868 474 PAAIAVDWVYKtIYWTDAASKTISVATLDGAKRKFLFNSDLRE----PASIAVDplSGFVYWSDWG---------EPAKI 540
Cdd:cd14963    58 PYGIAVDSDGN-IYVADLYNGRIQVFDPDGKFLKYFPEKKDRVklisPAGLAID--DGKLYVSDVKkhkvivfdlEGKLL 134
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1108846868 541 EKAGMNGFDRrplvtEDIQWPNGITLDlVKSRLYWLDSKLHMLSSVDLNGQDRRIVLKS---LEFLAHPLALTIFED-RV 616
Cdd:cd14963   135 LEFGKPGSEP-----GELSYPNGIAVD-EDGNIYVADSGNGRIQVFDKNGKFIKELNGSpdgKSGFVNPRGIAVDPDgNL 208
                         170       180
                  ....*....|....*....|....
gi 1108846868 617 YWIDGENEAVYGANKfTGSELATL 640
Cdd:cd14963   209 YVVDNLSHRVYVFDE-QGKELFTF 231
EGF_CA pfam07645
Calcium-binding EGF domain;
355-393 3.87e-03

Calcium-binding EGF domain;


Pssm-ID: 311536  Cd Length: 42  Bit Score: 35.79  E-value: 3.87e-03
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|..
gi 1108846868 355 DIDECQNPG-ICSQ--ICINLKGGYKCECSRGYQMDLATGVC 393
Cdd:pfam07645   1 DVDECADGThNCPAntVCVNTIGSFECVCPDGYENNEDGTNC 42
LY smart00135
Low-density lipoprotein-receptor YWTD domain; Type "B" repeats in low-density lipoprotein (LDL) ...
420-458 8.68e-03

Low-density lipoprotein-receptor YWTD domain; Type "B" repeats in low-density lipoprotein (LDL) receptor that plays a central role in mammalian cholesterol metabolism. Also present in a variety of molecules similar to gp300/megalin.


Pssm-ID: 214531  Cd Length: 43  Bit Score: 34.88  E-value: 8.68e-03
                           10        20        30
                   ....*....|....*....|....*....|....*....
gi 1108846868  420 YIQLVEQLRNTVALDADIAAQKLFWADLSQKAIFSASID 458
Cdd:smart00135   1 RTLLSSGLGHPNGLAVDWIEGRLYWTDWGLDVIEVANLD 39
 
Name Accession Description Interval E-value
Ldl_recept_b pfam00058
Low-density lipoprotein receptor repeat class B; This domain is also known as the YWTD motif ...
527-567 1.73e-15

Low-density lipoprotein receptor repeat class B; This domain is also known as the YWTD motif after the most conserved region of the repeat. The YWTD repeat is found in multiple tandem repeats and has been predicted to form a beta-propeller structure.


Pssm-ID: 395012  Cd Length: 41  Bit Score: 70.66  E-value: 1.73e-15
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|.
gi 1108846868 527 GFVYWSDWGEPAKIEKAGMNGFDRRPLVTEDIQWPNGITLD 567
Cdd:pfam00058   1 GRLYWTDSSLRASISSADLNGSDRKTLLSEDLQHPNGIAVD 41
Ldl_recept_a pfam00057
Low-density lipoprotein receptor domain class A;
196-232 3.67e-12

Low-density lipoprotein receptor domain class A;


Pssm-ID: 395011  Cd Length: 37  Bit Score: 61.11  E-value: 3.67e-12
                          10        20        30
                  ....*....|....*....|....*....|....*..
gi 1108846868 196 TKCPTSEIQCGSGECIHKKWRCDGDPDCKDGSDEVNC 232
Cdd:pfam00057   1 STCSPNEFQCGSGECIPRSWVCDGDPDCGDGSDEENC 37
LDLa cd00112
Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central ...
33-67 2.19e-11

Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure


Pssm-ID: 238060  Cd Length: 35  Bit Score: 58.76  E-value: 2.19e-11
                          10        20        30
                  ....*....|....*....|....*....|....*
gi 1108846868  33 CDSSQFQCTNGRCITLLWKCDGDEDCADGSDEKNC 67
Cdd:cd00112     1 CPPNEFRCANGRCIPSSWVCDGEDDCGDGSDEENC 35
Ldl_recept_a pfam00057
Low-density lipoprotein receptor domain class A;
235-271 3.82e-11

Low-density lipoprotein receptor domain class A;


Pssm-ID: 395011  Cd Length: 37  Bit Score: 58.03  E-value: 3.82e-11
                          10        20        30
                  ....*....|....*....|....*....|....*..
gi 1108846868 235 RTCRPDQFECEDGSCIHGSRQCNGIRDCVDGSDEVNC 271
Cdd:pfam00057   1 STCSPNEFQCGSGECIPRSWVCDGDPDCGDGSDEENC 37
LDLa cd00112
Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central ...
198-232 3.98e-11

Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure


Pssm-ID: 238060  Cd Length: 35  Bit Score: 57.99  E-value: 3.98e-11
                          10        20        30
                  ....*....|....*....|....*....|....*
gi 1108846868 198 CPTSEIQCGSGECIHKKWRCDGDPDCKDGSDEVNC 232
Cdd:cd00112     1 CPPNEFRCANGRCIPSSWVCDGEDDCGDGSDEENC 35
Ldl_recept_a pfam00057
Low-density lipoprotein receptor domain class A;
112-147 9.77e-11

Low-density lipoprotein receptor domain class A;


Pssm-ID: 395011  Cd Length: 37  Bit Score: 56.87  E-value: 9.77e-11
                          10        20        30
                  ....*....|....*....|....*....|....*.
gi 1108846868 112 TCSADEFTCSSGRCVSRNFVCNGQDDCDDGSDELDC 147
Cdd:pfam00057   2 TCSPNEFQCGSGECIPRSWVCDGDPDCGDGSDEENC 37
LDLa cd00112
Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central ...
113-147 3.13e-10

Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure


Pssm-ID: 238060  Cd Length: 35  Bit Score: 55.68  E-value: 3.13e-10
                          10        20        30
                  ....*....|....*....|....*....|....*
gi 1108846868 113 CSADEFTCSSGRCVSRNFVCNGQDDCDDGSDELDC 147
Cdd:cd00112     1 CPPNEFRCANGRCIPSSWVCDGEDDCGDGSDEENC 35
LDLa smart00192
Low-density lipoprotein receptor domain class A; Cysteine-rich repeat in the low-density ...
71-103 3.50e-10

Low-density lipoprotein receptor domain class A; Cysteine-rich repeat in the low-density lipoprotein (LDL) receptor that plays a central role in mammalian cholesterol metabolism. The N-terminal type A repeats in LDL receptor bind the lipoproteins. Other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement. Mutations in the LDL receptor gene cause familial hypercholesterolemia.


Pssm-ID: 197566  Cd Length: 33  Bit Score: 55.33  E-value: 3.50e-10
                           10        20        30
                   ....*....|....*....|....*....|...
gi 1108846868   71 TCAESDFVCKNGQCVPNRWQCDGDPDCEDGSDE 103
Cdd:smart00192   1 TCPPGEFQCDNGRCIPSSWVCDGVDDCGDGSDE 33
LY smart00135
Low-density lipoprotein-receptor YWTD domain; Type "B" repeats in low-density lipoprotein (LDL) ...
467-506 4.50e-10

Low-density lipoprotein-receptor YWTD domain; Type "B" repeats in low-density lipoprotein (LDL) receptor that plays a central role in mammalian cholesterol metabolism. Also present in a variety of molecules similar to gp300/megalin.


Pssm-ID: 214531  Cd Length: 43  Bit Score: 55.30  E-value: 4.50e-10
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|
gi 1108846868  467 MIDNVYNPAAIAVDWVYKTIYWTDAASKTISVATLDGAKR 506
Cdd:smart00135   4 LSSGLGHPNGLAVDWIEGRLYWTDWGLDVIEVANLDGTNR 43
Ldl_recept_b pfam00058
Low-density lipoprotein receptor repeat class B; This domain is also known as the YWTD motif ...
486-523 5.63e-10

Low-density lipoprotein receptor repeat class B; This domain is also known as the YWTD motif after the most conserved region of the repeat. The YWTD repeat is found in multiple tandem repeats and has been predicted to form a beta-propeller structure.


Pssm-ID: 395012  Cd Length: 41  Bit Score: 54.87  E-value: 5.63e-10
                          10        20        30
                  ....*....|....*....|....*....|....*....
gi 1108846868 486 IYWTDAAS-KTISVATLDGAKRKFLFNSDLREPASIAVD 523
Cdd:pfam00058   3 LYWTDSSLrASISSADLNGSDRKTLLSEDLQHPNGIAVD 41
Ldl_recept_a pfam00057
Low-density lipoprotein receptor domain class A;
32-67 6.97e-10

Low-density lipoprotein receptor domain class A;


Pssm-ID: 395011  Cd Length: 37  Bit Score: 54.56  E-value: 6.97e-10
                          10        20        30
                  ....*....|....*....|....*....|....*.
gi 1108846868  32 KCDSSQFQCTNGRCITLLWKCDGDEDCADGSDEKNC 67
Cdd:pfam00057   2 TCSPNEFQCGSGECIPRSWVCDGDPDCGDGSDEENC 37
LDLa smart00192
Low-density lipoprotein receptor domain class A; Cysteine-rich repeat in the low-density ...
32-64 1.03e-09

Low-density lipoprotein receptor domain class A; Cysteine-rich repeat in the low-density lipoprotein (LDL) receptor that plays a central role in mammalian cholesterol metabolism. The N-terminal type A repeats in LDL receptor bind the lipoproteins. Other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement. Mutations in the LDL receptor gene cause familial hypercholesterolemia.


Pssm-ID: 197566  Cd Length: 33  Bit Score: 54.18  E-value: 1.03e-09
                           10        20        30
                   ....*....|....*....|....*....|...
gi 1108846868   32 KCDSSQFQCTNGRCITLLWKCDGDEDCADGSDE 64
Cdd:smart00192   1 TCPPGEFQCDNGRCIPSSWVCDGVDDCGDGSDE 33
LDLa cd00112
Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central ...
72-103 1.03e-09

Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure


Pssm-ID: 238060  Cd Length: 35  Bit Score: 54.13  E-value: 1.03e-09
                          10        20        30
                  ....*....|....*....|....*....|..
gi 1108846868  72 CAESDFVCKNGQCVPNRWQCDGDPDCEDGSDE 103
Cdd:cd00112     1 CPPNEFRCANGRCIPSSWVCDGEDDCGDGSDE 32
Ldl_recept_a pfam00057
Low-density lipoprotein receptor domain class A;
70-103 1.22e-09

Low-density lipoprotein receptor domain class A;


Pssm-ID: 395011  Cd Length: 37  Bit Score: 53.79  E-value: 1.22e-09
                          10        20        30
                  ....*....|....*....|....*....|....
gi 1108846868  70 KTCAESDFVCKNGQCVPNRWQCDGDPDCEDGSDE 103
Cdd:pfam00057   1 STCSPNEFQCGSGECIPRSWVCDGDPDCGDGSDE 34
LDLa smart00192
Low-density lipoprotein receptor domain class A; Cysteine-rich repeat in the low-density ...
197-229 1.32e-09

Low-density lipoprotein receptor domain class A; Cysteine-rich repeat in the low-density lipoprotein (LDL) receptor that plays a central role in mammalian cholesterol metabolism. The N-terminal type A repeats in LDL receptor bind the lipoproteins. Other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement. Mutations in the LDL receptor gene cause familial hypercholesterolemia.


Pssm-ID: 197566  Cd Length: 33  Bit Score: 53.79  E-value: 1.32e-09
                           10        20        30
                   ....*....|....*....|....*....|...
gi 1108846868  197 KCPTSEIQCGSGECIHKKWRCDGDPDCKDGSDE 229
Cdd:smart00192   1 TCPPGEFQCDNGRCIPSSWVCDGVDDCGDGSDE 33
LY smart00135
Low-density lipoprotein-receptor YWTD domain; Type "B" repeats in low-density lipoprotein (LDL) ...
509-550 1.93e-09

Low-density lipoprotein-receptor YWTD domain; Type "B" repeats in low-density lipoprotein (LDL) receptor that plays a central role in mammalian cholesterol metabolism. Also present in a variety of molecules similar to gp300/megalin.


Pssm-ID: 214531  Cd Length: 43  Bit Score: 53.37  E-value: 1.93e-09
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|..
gi 1108846868  509 LFNSDLREPASIAVDPLSGFVYWSDWGEPaKIEKAGMNGFDR 550
Cdd:smart00135   3 LLSSGLGHPNGLAVDWIEGRLYWTDWGLD-VIEVANLDGTNR 43
Ldl_recept_a pfam00057
Low-density lipoprotein receptor domain class A;
151-183 2.74e-09

Low-density lipoprotein receptor domain class A;


Pssm-ID: 395011  Cd Length: 37  Bit Score: 53.02  E-value: 2.74e-09
                          10        20        30
                  ....*....|....*....|....*....|...
gi 1108846868 151 TCGAHEFQCSTSSCIPLSWVCDDDADCSDQSDE 183
Cdd:pfam00057   2 TCSPNEFQCGSGECIPRSWVCDGDPDCGDGSDE 34
LDLa cd00112
Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central ...
237-271 2.94e-09

Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure


Pssm-ID: 238060  Cd Length: 35  Bit Score: 52.98  E-value: 2.94e-09
                          10        20        30
                  ....*....|....*....|....*....|....*
gi 1108846868 237 CRPDQFECEDGSCIHGSRQCNGIRDCVDGSDEVNC 271
Cdd:cd00112     1 CPPNEFRCANGRCIPSSWVCDGEDDCGDGSDEENC 35
LY smart00135
Low-density lipoprotein-receptor YWTD domain; Type "B" repeats in low-density lipoprotein (LDL) ...
551-593 3.06e-09

Low-density lipoprotein-receptor YWTD domain; Type "B" repeats in low-density lipoprotein (LDL) receptor that plays a central role in mammalian cholesterol metabolism. Also present in a variety of molecules similar to gp300/megalin.


Pssm-ID: 214531  Cd Length: 43  Bit Score: 52.99  E-value: 3.06e-09
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|...
gi 1108846868  551 RPLVTEDIQWPNGITLDLVKSRLYWLDSKLHMLSSVDLNGQDR 593
Cdd:smart00135   1 RTLLSSGLGHPNGLAVDWIEGRLYWTDWGLDVIEVANLDGTNR 43
LDLa smart00192
Low-density lipoprotein receptor domain class A; Cysteine-rich repeat in the low-density ...
151-183 3.13e-09

Low-density lipoprotein receptor domain class A; Cysteine-rich repeat in the low-density lipoprotein (LDL) receptor that plays a central role in mammalian cholesterol metabolism. The N-terminal type A repeats in LDL receptor bind the lipoproteins. Other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement. Mutations in the LDL receptor gene cause familial hypercholesterolemia.


Pssm-ID: 197566  Cd Length: 33  Bit Score: 52.64  E-value: 3.13e-09
                           10        20        30
                   ....*....|....*....|....*....|...
gi 1108846868  151 TCGAHEFQCSTSSCIPLSWVCDDDADCSDQSDE 183
Cdd:smart00192   1 TCPPGEFQCDNGRCIPSSWVCDGVDDCGDGSDE 33
LDLa smart00192
Low-density lipoprotein receptor domain class A; Cysteine-rich repeat in the low-density ...
112-144 3.58e-09

Low-density lipoprotein receptor domain class A; Cysteine-rich repeat in the low-density lipoprotein (LDL) receptor that plays a central role in mammalian cholesterol metabolism. The N-terminal type A repeats in LDL receptor bind the lipoproteins. Other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement. Mutations in the LDL receptor gene cause familial hypercholesterolemia.


Pssm-ID: 197566  Cd Length: 33  Bit Score: 52.64  E-value: 3.58e-09
                           10        20        30
                   ....*....|....*....|....*....|...
gi 1108846868  112 TCSADEFTCSSGRCVSRNFVCNGQDDCDDGSDE 144
Cdd:smart00192   1 TCPPGEFQCDNGRCIPSSWVCDGVDDCGDGSDE 33
exchanger_TraA NF033759
outer membrane exchange protein TraA; TraA, together with its partner TraB, mediates a large ...
39-252 3.37e-08

outer membrane exchange protein TraA; TraA, together with its partner TraB, mediates a large scale exchange of outer membrane lipoproteins, and lipids, between closely related strains or clonally identical cells, certain delta-proteobacterial species such as Myxococcus xanthus. The exchange mechanism is likely to involve fusion of outer membrane, probably done to coordinate the social behaviors these bacteria display.


Pssm-ID: 411343 [Multi-domain]  Cd Length: 662  Bit Score: 57.09  E-value: 3.37e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1108846868  39 QCTNGRCITLLWKCDG---DEDCADGSDEKNCVKKTcaeSDFVCKNGQ-CVPNRWQ---CDGDPDCEDGsdespEQCRNI 111
Cdd:NF033759  310 QCPNGRCDLTTNQCRGcneDSDCVCDEPTFTCVECN---TDEQCPNGQvCATDLNEcreCNQDSHCPRG-----ESCSNN 381
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1108846868 112 TCSadefTCSSgrcvsrNFVCNGqDDCDDGSDELDCAPPTCGAhefqcsTSSCIPlswvCDDDADCSDQsdeslEQC--- 188
Cdd:NF033759  382 TCQ----PCST------NDSCAG-NSCNCCPNGTQCAAPTPGA------SPSCVE----CTTDSQCADG-----QRCdta 435
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 1108846868 189 -GRQPVIHTKCPTSEiQCGSGeCIhkkwRCDGD-PDCKDGSDEVncpsrTCRPDqFECEDGS-CIHG 252
Cdd:NF033759  436 nGRCVDQVPECNTSD-RCGPG-CV----KCPGDrPYCLDGQVCV-----QCRND-LECGDGQfCLSG 490
LDLa cd00112
Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central ...
152-183 4.17e-08

Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure


Pssm-ID: 238060  Cd Length: 35  Bit Score: 49.51  E-value: 4.17e-08
                          10        20        30
                  ....*....|....*....|....*....|..
gi 1108846868 152 CGAHEFQCSTSSCIPLSWVCDDDADCSDQSDE 183
Cdd:cd00112     1 CPPNEFRCANGRCIPSSWVCDGEDDCGDGSDE 32
LDLa smart00192
Low-density lipoprotein receptor domain class A; Cysteine-rich repeat in the low-density ...
236-268 5.77e-08

Low-density lipoprotein receptor domain class A; Cysteine-rich repeat in the low-density lipoprotein (LDL) receptor that plays a central role in mammalian cholesterol metabolism. The N-terminal type A repeats in LDL receptor bind the lipoproteins. Other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement. Mutations in the LDL receptor gene cause familial hypercholesterolemia.


Pssm-ID: 197566  Cd Length: 33  Bit Score: 49.17  E-value: 5.77e-08
                           10        20        30
                   ....*....|....*....|....*....|...
gi 1108846868  236 TCRPDQFECEDGSCIHGSRQCNGIRDCVDGSDE 268
Cdd:smart00192   1 TCPPGEFQCDNGRCIPSSWVCDGVDDCGDGSDE 33
Ldl_recept_a pfam00057
Low-density lipoprotein receptor domain class A;
279-309 7.88e-08

Low-density lipoprotein receptor domain class A;


Pssm-ID: 395011  Cd Length: 37  Bit Score: 48.78  E-value: 7.88e-08
                          10        20        30
                  ....*....|....*....|....*....|.
gi 1108846868 279 GPGKFKCRSGECIDMSKVCDQEQDCRDWSDE 309
Cdd:pfam00057   4 SPNEFQCGSGECIPRSWVCDGDPDCGDGSDE 34
FXa_inhibition pfam14670
Coagulation Factor Xa inhibitory site; This short domain on coagulation enzyme factor Xa is ...
319-353 2.95e-07

Coagulation Factor Xa inhibitory site; This short domain on coagulation enzyme factor Xa is found to be the target for a potent inhibitor of coagulation, TAK-442.


Pssm-ID: 405372  Cd Length: 36  Bit Score: 47.23  E-value: 2.95e-07
                          10        20        30
                  ....*....|....*....|....*....|....*.
gi 1108846868 319 CLVNNGGCSHICKDLVIGYECDCAAGFELI-DRKTC 353
Cdd:pfam14670   1 CSVNNGGCSHLCLNTPGGYTCSCPEGYKLQeDGRTC 36
Ldl_recept_b pfam00058
Low-density lipoprotein receptor repeat class B; This domain is also known as the YWTD motif ...
440-480 3.08e-07

Low-density lipoprotein receptor repeat class B; This domain is also known as the YWTD motif after the most conserved region of the repeat. The YWTD repeat is found in multiple tandem repeats and has been predicted to form a beta-propeller structure.


Pssm-ID: 395012  Cd Length: 41  Bit Score: 47.16  E-value: 3.08e-07
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|..
gi 1108846868 440 QKLFWADLSQKA-IFSASIDDKVgRHFKMIDNVYNPAAIAVD 480
Cdd:pfam00058   1 GRLYWTDSSLRAsISSADLNGSD-RKTLLSEDLQHPNGIAVD 41
Ldl_recept_b pfam00058
Low-density lipoprotein receptor repeat class B; This domain is also known as the YWTD motif ...
572-612 3.64e-07

Low-density lipoprotein receptor repeat class B; This domain is also known as the YWTD motif after the most conserved region of the repeat. The YWTD repeat is found in multiple tandem repeats and has been predicted to form a beta-propeller structure.


Pssm-ID: 395012  Cd Length: 41  Bit Score: 47.16  E-value: 3.64e-07
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|..
gi 1108846868 572 RLYWLDSKLHM-LSSVDLNGQDRRIVLKSLefLAHPLALTIF 612
Cdd:pfam00058   2 RLYWTDSSLRAsISSADLNGSDRKTLLSED--LQHPNGIAVD 41
Ldl_recept_b pfam00058
Low-density lipoprotein receptor repeat class B; This domain is also known as the YWTD motif ...
614-653 4.56e-07

Low-density lipoprotein receptor repeat class B; This domain is also known as the YWTD motif after the most conserved region of the repeat. The YWTD repeat is found in multiple tandem repeats and has been predicted to form a beta-propeller structure.


Pssm-ID: 395012  Cd Length: 41  Bit Score: 46.78  E-value: 4.56e-07
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|.
gi 1108846868 614 DRVYWIDGENEAVYGANKFTGSELATLV-NNLNDAQDIIVY 653
Cdd:pfam00058   1 GRLYWTDSSLRASISSADLNGSDRKTLLsEDLQHPNGIAVD 41
LDLa smart00192
Low-density lipoprotein receptor domain class A; Cysteine-rich repeat in the low-density ...
279-309 5.44e-07

Low-density lipoprotein receptor domain class A; Cysteine-rich repeat in the low-density lipoprotein (LDL) receptor that plays a central role in mammalian cholesterol metabolism. The N-terminal type A repeats in LDL receptor bind the lipoproteins. Other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement. Mutations in the LDL receptor gene cause familial hypercholesterolemia.


Pssm-ID: 197566  Cd Length: 33  Bit Score: 46.47  E-value: 5.44e-07
                           10        20        30
                   ....*....|....*....|....*....|.
gi 1108846868  279 GPGKFKCRSGECIDMSKVCDQEQDCRDWSDE 309
Cdd:smart00192   3 PPGEFQCDNGRCIPSSWVCDGVDDCGDGSDE 33
LDLa cd00112
Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central ...
279-309 9.03e-07

Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure


Pssm-ID: 238060  Cd Length: 35  Bit Score: 45.66  E-value: 9.03e-07
                          10        20        30
                  ....*....|....*....|....*....|.
gi 1108846868 279 GPGKFKCRSGECIDMSKVCDQEQDCRDWSDE 309
Cdd:cd00112     2 PPNEFRCANGRCIPSSWVCDGEDDCGDGSDE 32
EGF_CA smart00179
Calcium-binding EGF-like domain;
355-385 5.25e-06

Calcium-binding EGF-like domain;


Pssm-ID: 214542  Cd Length: 39  Bit Score: 43.77  E-value: 5.25e-06
                           10        20        30
                   ....*....|....*....|....*....|...
gi 1108846868  355 DIDECQNPGICSQ--ICINLKGGYKCECSRGYQ 385
Cdd:smart00179   1 DIDECASGNPCQNggTCVNTVGSYRCECPPGYT 33
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
355-385 2.30e-05

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


Pssm-ID: 238011  Cd Length: 38  Bit Score: 41.85  E-value: 2.30e-05
                          10        20        30
                  ....*....|....*....|....*....|...
gi 1108846868 355 DIDECQNPGICS--QICINLKGGYKCECSRGYQ 385
Cdd:cd00054     1 DIDECASGNPCQngGTCVNTVGSYRCSCPPGYT 33
FXa_inhibition pfam14670
Coagulation Factor Xa inhibitory site; This short domain on coagulation enzyme factor Xa is ...
665-708 3.54e-05

Coagulation Factor Xa inhibitory site; This short domain on coagulation enzyme factor Xa is found to be the target for a potent inhibitor of coagulation, TAK-442.


Pssm-ID: 405372  Cd Length: 36  Bit Score: 41.45  E-value: 3.54e-05
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....
gi 1108846868 665 CEDDmeNGGCEYLCLPAPQindhspKYTCSCPNGYNLEENGREC 708
Cdd:pfam14670   1 CSVN--NGGCSHLCLNTPG------GYTCSCPEGYKLQEDGRTC 36
cEGF pfam12662
Complement Clr-like EGF-like; cEGF, or complement Clr-like EGF, domains have six conserved ...
691-712 1.53e-03

Complement Clr-like EGF-like; cEGF, or complement Clr-like EGF, domains have six conserved cysteine residues disulfide-bonded into the characteristic pattern 'ababcc'. They are found in blood coagulation proteins such as fibrillin, Clr and Cls, thrombomodulin, and the LDL receptor. The core fold of the EGF domain consists of two small beta-hairpins packed against each other. Two major structural variants have been identified based on the structural context of the C-terminal cysteine residue of disulfide 'c' in the C-terminal hairpin: hEGFs and cEGFs. In cEGFs the C-terminal thiol resides on the C-terminal beta-sheet, resulting in long loop-lengths between the cysteine residues of disulfide 'c', typically C[10+]XC. These longer loop-lengths may have arisen by selective cysteine loss from a four-disulfide EGF template such as laminin or integrin. Tandem cEGF domains have five linking residues between terminal cysteines of adjacent domains. cEGF domains may or may not bind calcium in the linker region. cEGF domains with the consensus motif CXN4X[F,Y]XCXC are hydroxylated exclusively on the asparagine residue.


Pssm-ID: 403760  Cd Length: 24  Bit Score: 36.26  E-value: 1.53e-03
                          10        20
                  ....*....|....*....|..
gi 1108846868 691 YTCSCPNGYNLEENGRECQRIN 712
Cdd:pfam12662   2 YTCSCPPGYTLAGDGRTCVDID 23
NHL_like_5 cd14963
Uncharacterized NHL-repeat domain in bacterial proteins; The NHL (NCL-1, HT2A and LIN-41) ...
474-640 1.56e-03

Uncharacterized NHL-repeat domain in bacterial proteins; The NHL (NCL-1, HT2A and LIN-41) repeat is found in multiple tandem copies, typically as 6 instances. It is about 40 residues long and resembles the WD repeat and other beta-propeller structures.


Pssm-ID: 271333 [Multi-domain]  Cd Length: 268  Bit Score: 41.12  E-value: 1.56e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1108846868 474 PAAIAVDWVYKtIYWTDAASKTISVATLDGAKRKFLFNSDLRE----PASIAVDplSGFVYWSDWG---------EPAKI 540
Cdd:cd14963    58 PYGIAVDSDGN-IYVADLYNGRIQVFDPDGKFLKYFPEKKDRVklisPAGLAID--DGKLYVSDVKkhkvivfdlEGKLL 134
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1108846868 541 EKAGMNGFDRrplvtEDIQWPNGITLDlVKSRLYWLDSKLHMLSSVDLNGQDRRIVLKS---LEFLAHPLALTIFED-RV 616
Cdd:cd14963   135 LEFGKPGSEP-----GELSYPNGIAVD-EDGNIYVADSGNGRIQVFDKNGKFIKELNGSpdgKSGFVNPRGIAVDPDgNL 208
                         170       180
                  ....*....|....*....|....
gi 1108846868 617 YWIDGENEAVYGANKfTGSELATL 640
Cdd:cd14963   209 YVVDNLSHRVYVFDE-QGKELFTF 231
NHL_like_6 cd14962
Uncharacterized NHL-repeat domain in bacterial proteins; The NHL (NCL-1, HT2A and LIN-41) ...
430-533 2.49e-03

Uncharacterized NHL-repeat domain in bacterial proteins; The NHL (NCL-1, HT2A and LIN-41) repeat is found in multiple tandem copies, typically as 6 instances. It is about 40 residues long and resembles the WD repeat and other beta-propeller structures.


Pssm-ID: 271332 [Multi-domain]  Cd Length: 271  Bit Score: 40.65  E-value: 2.49e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1108846868 430 TVALDADiaaQKLFWADLSQKAIFsasIDDKVGRHFKMIDN-----VYNPAAIAVDwVYKTIYWTDAASKTISVATLDGA 504
Cdd:cd14962    16 GVAADGR---GRIYVADTGRGAVF---VFDLPNGKVFVIGNagpnrFVSPIGVAID-ANGNLYVSDAELGKVFVFDRDGK 88
                          90       100       110
                  ....*....|....*....|....*....|
gi 1108846868 505 KRKFLFNSDLRE-PASIAVDPLSGFVYWSD 533
Cdd:cd14962    89 FLRAIGAGALFKrPTGIAVDPAGKRLYVVD 118
EGF_CA pfam07645
Calcium-binding EGF domain;
355-393 3.87e-03

Calcium-binding EGF domain;


Pssm-ID: 311536  Cd Length: 42  Bit Score: 35.79  E-value: 3.87e-03
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|..
gi 1108846868 355 DIDECQNPG-ICSQ--ICINLKGGYKCECSRGYQMDLATGVC 393
Cdd:pfam07645   1 DVDECADGThNCPAntVCVNTIGSFECVCPDGYENNEDGTNC 42
FXa_inhibition pfam14670
Coagulation Factor Xa inhibitory site; This short domain on coagulation enzyme factor Xa is ...
360-387 4.17e-03

Coagulation Factor Xa inhibitory site; This short domain on coagulation enzyme factor Xa is found to be the target for a potent inhibitor of coagulation, TAK-442.


Pssm-ID: 405372  Cd Length: 36  Bit Score: 35.29  E-value: 4.17e-03
                          10        20
                  ....*....|....*....|....*...
gi 1108846868 360 QNPGICSQICINLKGGYKCECSRGYQMD 387
Cdd:pfam14670   3 VNNGGCSHLCLNTPGGYTCSCPEGYKLQ 30
LY smart00135
Low-density lipoprotein-receptor YWTD domain; Type "B" repeats in low-density lipoprotein (LDL) ...
420-458 8.68e-03

Low-density lipoprotein-receptor YWTD domain; Type "B" repeats in low-density lipoprotein (LDL) receptor that plays a central role in mammalian cholesterol metabolism. Also present in a variety of molecules similar to gp300/megalin.


Pssm-ID: 214531  Cd Length: 43  Bit Score: 34.88  E-value: 8.68e-03
                           10        20        30
                   ....*....|....*....|....*....|....*....
gi 1108846868  420 YIQLVEQLRNTVALDADIAAQKLFWADLSQKAIFSASID 458
Cdd:smart00135   1 RTLLSSGLGHPNGLAVDWIEGRLYWTDWGLDVIEVANLD 39
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.19
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH